Respect!Sustainable!Business!AB! Inspektionsrapport!

Storlek: px
Starta visningen från sidan:

Download "Respect!Sustainable!Business!AB! Inspektionsrapport!"

Transkript

1 RespectSustainableBusinessAB Inspektionsrapport Kundens'namn: SKLKommentus Inköpscentral(SKL) Fabriksnamn:' P.Gajahunggalbk. Inspektionsledare:' JeffreyLee(Gekko) Adress:' Hornsgatan Stockholm Land:' Indonesien Rapport'skriven'av:' JeffreyLee(Gekko) EvaIding(Gekko) Kontaktperson:' PeterSvensson Adress:' Jl.RayaGatotSubrotoKm.7 (Jl.Gajahunggal) angerang15135 Rapport'antal'sidor:' 32' Fabriksrepresentation Namn' Position' Företag' MichelDube,Phd. VD illverkning PGajahunggalbk FerryHollen PersonalavdelningChef SylvainSagot KvalitetssäkringAdministrativChef LilisSetiawati Kvalitetssäkring, Avdelningschef HarrisPasha Ställföreträdandechef Försäljning RobertH.Imam Personalavdelning Avdelningschef DaniloD.Verastigue Avdelningschef Ingenjörsavdelningen BennyS.Sukarya ViceChefanläggningD Dr.ItaMariza AdministrativChef Utbildning& Utveckling Misnari PersonalavdelningPersonalchef YunitaRhapsody PersonalavdelningRekrytering Ariful SäkerhetsansvarigAnläggningD AgusDidik Ordförande,fackförening Fabriksochinspektionsinformation olk ja Nej Huvudsaklig'produktion'i'inspekterad'fabrik:' Däck yp'av'inspektion' Förstagångsinspektion förbokad obokad ominspektion Inspektionens'omfattning' IenlighetmeddeområdensomtasuppinomSKI:ssocialaochetiskakrav,samtlokalt ochnationelltgällanderegelverkochlagarföranställningsförhållanden,hälsaoch säkerhetsamtmiljö. 1

2 Innehållsförteckning ALLMÄN'INFORMAION' 3 FABRIKSINFORMAION' 3 DOKUMENKONROLL' 4 SUMMERING'AV'INSPEKIONSOMRÅDEN' 8 ANSÄLLNINGSVILLKOR' 8 BARNARBEEOCHUNGAARBEARE 8 VÅNGSARBEE 8 DISKRIMINERING 9 ARBESIDEROCHÖVERIDSARBEE 9 LÖNEROCHÖVERIDSERSÄNING 10 FÖRENINGSFRIHE 11 HÄLSAOCHSÄKERHE 12 SKYDDSOMBUDOCHSÄKERHESUBILDNING 12 SKYDDSURUSNING 13 NÖDURYMNING 13 OLYCKOROCHILLBUD 14 KEMIKALIESÄKERHE 14 MASKINSÄKERHE 15 PERSONALMASAL 15 ARBESMILJÖ 16 MILJÖ 16 HANERINGAVLEVERANÖREROCHUNDERLEVERANÖRER 17 SUMMERING'AV'INSPEKÖRENS'INRYCK' 18 BILAGA'1,'FABRIKSFOON:'P'GAJAH'UNGGAL'BK.' 25 BILAGA'1'FOO'BRISER'(NC)' 28 BILAGA'2'FÖRBÄRINGSOMRÅDEN'(AFI)'(RISK'FÖR'NC):' 30 BILAGA3GODPRAXIS(GP)OMRÅDEN 31 2

3 3 Allmäninformation Fabriksinformation PGajahunggalbk(G)huvudkontorliggeriJakarta,Indonesien.Gharfem produktionsanläggningarochtvådäckrelateradeproduktionsanläggningariindonesien. HuvudanläggningenliggeriJakartaförortenangerang.Gärdenstörstaintegrerade däcktillverkarenisydostasienochenavdestörstafabrikernaiindonesien. Getablerades1951ochtillverkadedåcykeldäckochcykelslangar.1971började fabrikenproduceramotorcykeldäck.personbilsdäckochdäcktillstörrefordonkomi produktion1981,vareftertillverkningenutvidgadestillradialdäck köpte Michelin(Frankrike)10%kapitalandelariföretaget.SKLköperinradialdäckför personbilargenomvianorab,sverige.vianorärkundhosgsedan20årtillbaka. FöretagetsverkställandedirektörärChristopherChan. Huvudanläggningeniangerangharfemstörreochettantalmindreproduktionshallar. Därutöverbeståranläggningenavlagerrum,tvåmatsalar,enadministrationsbyggnad samthälsovårdsklinik,moské,aktivitetsrumochenlagerbyggnadförverktyg.de radialdäcksomomfattasavvianorsuppköpförsklsräkningärtillverkadeianläggning Dsombestårav24.4hektarbyggnadsutrymmesamt33.2hektarland. angeranganläggningensysselsättertotalt12,800varav3,456arbetarpåanläggningd. Könsfördelningenpåföretagetgenerelltär97%mänoch3%kvinnormenianläggning Där99%män.Deanställdasålderärfördeladmellan18och55år.Denlagstadgade pensionsålderniindonesienär55årmeninspektörenfannattdetförekommerattman förnyarkontraktenochåteranställerpensioneradearbetare.samtligaanställdapå anläggningdärindonesiskamedborgare.15avdehögrechefernaärinteindonesiska medborgareutankommerfrånhelavärlden:europa,australienochandraasiatiska länder. GblevISO14001certifieradeijuni2009och2012förlängdescertifieringenmed ytterligaretreår.fabrikenärocksåcertifieradmotiso/s16949avseendeprodukter tillbilindustrin. Verksamhetenifabrikenärigång24timmaromdygnetunderveckansalladagar. Skiftsystemetäruppdelatifyragruppersomvarderaarbetarfemdagariveckanmed treåttatimmarsskiftperdag.anställdasomintearbetarenligtskiftsystemet,tex kontorsarbetareochingenjörer,arbetarfemellersexdagarpervecka.övertid förekommerblandskiftarbetarnaochinnebärtexattmanarbetarettextraskiftvilket inteärienlighetmedindonesiskarbetslagstiftning. Lunchrastenärentimmeförutompåfredagardådenutökasp.g.a.muslimskfredagsbön tillenochenhalvtimme.fabrikenharstängttvåveckorunderfastemånaden,ramadan, ochdetnoteradesattmånadernainnanramadanutökasproduktionenföratt tillmötesgådennågotökadeefterfrågan.

4 Lönerräknaspådagsbasisochvarierarberoendepåhurmångaskiftdeanställda arbetatunderenmånad.nyanställdaanställspådagsbasisunderentremånaders provanställning.löneutbetalningenfortsätterpådagsbasismedförlängningupptilltvå årstidberoendepåprestation.prövningskerförattmedtillfredställande arbetsprestationblibefordradtillattövergåtillmånadslön.detfinnsarbetaresom undertioårharhaftdagslön.högreutbildadpersonal,texdesomärutbildadepå fabrikensegetträningsinstitut,bliranställdamedmånadslönredanfrånförsta anställningskontraktet. Personalomsättningenärrelativtlågmedettgenomsnittpå24%permånad,utan säsongsvariationer.personaltillväxtenliggerpåungefär5%perår.intervjuade anställdaansergenerelltattgärenbraarbetsgivaremedfördelaktiga arbetsförhållandenochlönersomliggerövergenomsnittet. Detfinnsingaövernattningsmöjligheterpåfabriken,vilketinnebärattallaanställdabor utanföranläggningen.ransporterombesörjsinteavföretaget.anställdablirtilldelade matkupongersomkananvändasienavdetvåmatsalarnapåanläggningen.dessadrivs avexternaaktörer. Anläggningenharmoské,badmintonbanor,närbutiker,aktivitetsanläggningsamt hälsovårdsklinikmedläkareochsjuksköterskor.aktivitetsanläggningenanvändstill rekreationochandraaktiviteter. Dettaärdenförstauppförandekodsinspektioneniföretagetsanläggningarochdärmed ävendenförstaförsklsräkning.fabrikenhartagitvissacsrinitiativmeninteskapat någonledarskapsstrukturännu. Inspektionsinformation. Dennaförbokadeinspektionutfördesmellan21och25nov2013.Områdenoch avdelningarsomomfattadesavinspektionen; Anställningsförhållanden Hälsaochsäkerhet Miljöaspekter Ledningssystemförunderleverantörerbeaktadesikorthetförmöjligpåverkan avvärdekedjan. Dokumentkontroll Följandedokumentgranskadesunderinspektionen. 1. Minimilöndokumentation. 2. Listaöveranställdapådagsbasisochbankinformation(3263anställda). 3. Listaöveranställdapåmånadsbasis. 4. Löneutbetalningsregister(dagsbaseradeanställda):dec2012april Skiftschema. 6. Registerfrånstämpelklocka(Excelutskrift). 7. Urvalurlönebesked(timanställd). 8. Urvalurnärvarolista. 4

5 9. Listaöveranställda(oktober2013). 10. Urvalurlöneutbetalningsregister(månadsbaseradeanställda(jun,aug,okt,2013). 11. Utvaldarbetstidochlöneutbetalningsregister(månadsbaseradanställd). 12. Kollektivavtal. 13. Utvaldapersonligaregister(IDkort,myndighets,studieintyg,hälsokontroll). 14. Matlagningstillstånd. 15. Brandsäkerhetsdokumentation(matsal). 16. Checklistaförbrandutrustning(matsal). 17. Fotonfrånenmindrebrandövning(fotofrån23maj,2013). 18. Procedurvidbrandövning(AnläggningD). 19. Instruktionvidhändelseavstörre,medelstorellermindrebrand. 20. Standardrutinerföranvändningavbrandstege(manual). 21. Brandtillbudsrapport( ). 22. Sammanfattningavbrandtillbudsrapporter2012& Utredningsregisterfrånbrandtillbud. 24. Handlingsplanvidjordbävning. 25. Handlingsplanvidöversvämning. 26. Instruktionförtillvägagångssättvidströmavbrott(slumpvisutvalda produktionsområden). 27. Koordineringsplanförnödsituationer. 28. Sammanfattningavsäkerhetsdatabladgällandehelafabriken. 29. Externaprovrapporterförvatten,luft,buller,temperaturochbelysning(janjuni 2013). 30. Månadsvisabelysningstest(internkontrollvarjemånad(urval2månader). 31. Provpåbullernivådärmankorrigeratursprunglig85dbbullernivåtest. 32. Arbetsfunktion Riskidentifieringochledningssystem(exempelfrånprocessersom däckhärdning,blandning,innerslangstillverkningförradialdäck). 33. Uppföljningsrapportomolycksfall. 34. Olycksfallssammanfattningför VisuellrundvandringskontrollutfördavAvdelningenförHälsa&Säkerhet, 36. Myndighetsdokument(hanteringavmiljöfarligtkemisktavfall),rapportfrånmaj 2012). 37. Standardrutinerförhanteringavmiljöfarligvätska,produktionsochicke produktionsavtal. 38. MiljöcertifikatfrånMiljöministeriet(IndonesianEnvironmentalAgency,BPLH)2:a halvåret, Standardrutinerförmiljöavfall,utsläppochbiologisktnedbrytbartavfall. 40. Gaffeltruckkörkortsamtcertifikatochnärvarolistafrånförartest. 41. illståndochregistreringsbevisförunderleverantörsomhanterarfarligtavfall. 42. Provrapportomavfallshanteringfrånettexterntföretagsomhanteraroljaoch oljefatpåfabriken. 43. Miljöstyrningssystemrapportfrånjan jun,2013(utfördåtmiljöministeriet) 44. Säkerhetsochträningsmaterialfrånexternakonsulter(SentralSistemConsulting). 45. Organisationsschemaöveranläggningeniangerang. 46. RitningavanläggningDochfabriksinformation. 47. Checklistaförurvalavunderleverantörer. 5

6 6 48. Certifieringar:ISO14001:2009;ISO/S Intervjuer.med.anställda. Ledningen(48personer) MichelDube,Phd.VD illverkning SylvainSagotKvalitetssäkringAdministrativChef LilisSetiawatiKvalitetssäkringAvdelningschef Rachmat Kvalitetssäkring AgusRiyahto Kvalitetssäkring RachmaDityaS.Kvalitetssäkring Suwito Kvalitetssäkring Suhjute Personalavdelning HarujosanPersonalavdelning FerryHollen, PersonalavdelningChef RobertH.Imam,Personalavdelning Avdelningschef Misnari AB PersonalavdelningPersonalchef JentyHartati PersonalavdelningLön Feritanty PersonalavdelningLön HendraLesmana PersonalavdelningLön EkoSuwarto PersonalavdelningLön IndrianiP. PersonalavdelningPersonal(radialdäcksproduktion) Minggus PersonalavdelningPersonal Zarmelly AdministrationPersonal YunitaRhapsodyPersonalavdelning,Rekrytering(avlönadepåmånadsbasis) Ranidita PersonalavdelningRekrytering(avlönadepåtimbasis) Dr.ItaMarizaAdministrativChef Utbildningochutveckling JennySriSangrit Utbildningochutveckling Sutarta Utbildningochutveckling NanaSL Utbildningochutveckling HarrisPashaStällföreträdandechef Försäljning(Export) RikoBuntaran Försäljning(Export) DaniloD.VerastigueAvdelningschef Ingenjörsavdelningen Rasam Ansvarigförfastighetsskötsel ArupiAnläggningD,Ingenjörsavdelningen Surijorn AnläggningD,Ingenjörsavdelningen BennySetiawan Certifieradsäkerhetsansvarig DodySutiastono AvdelningförHälsa&Säkerhet Sulukondin AvdelningenförHälsa&Säkerhet Suherman AvdelningenförHälsa&Säkerhet Nasidah AvdelningenförHälsa&Säkerhet BennyS.SukaryaViceChefanläggningD Ariful,SäkerhetsansvarigAnläggningD AndieJanoePoerwanto UnderhållK3LDAnläggningD PrimaMinha K3LD Supendi observatör Hälsa&Säkerhet AgusPratopo GummiblandningsavdelningenAnläggningD

7 7 Sucipto LagerchefLogistik Cahyo AvdelningschefLogistikRåmateriallager Muit Matsal Laurenny Matsal Rifki Inköp Eltonyie Inköp Fackförening(6personer) AgusDidik,KetuaSPSI(Fackföreningsordförande) JoniPrihatinSPSI(Generalsekreterare,fackföreningenförkemiochgruvindustri) IsanSetiawan SPSI(fackföreningenförkemiochgruvindustri) Udinaryvdia SPSI(fackföreningenförkemiochgruvindustri) SigitPrihantoro SPSI(fackföreningenförkemiochgruvindustri) Dana SPSI(fackföreningenförkemiochgruvindustri) Hälsovårdskliniktvåläkareochtvåsjuksköterskor. Ickeledningsanställda(47personer) intervjueriproduktionen;anläggningd,lager, packning,specialutrustningsoperatörer,säkerhetsavdelningen. Slumpmässigtutvaldaarbetare(1012personer) frågorställdaunderrundvandring ochbesökifabrikslokalerochmatsal. Sammanlagtintervjuades120personer.

8 8 Summeringavinspektionsområden Anställningsvillkor Barnarbeteochungaarbetare Ingenförekomstavbarnarbete(ILOnr138och182) Barnarbete,enligtdefinitioneniILOkonventionen,fårinteförekommaochföretaget harettansvarförattutvecklasocialtochekonomiskthållbaraalternativ(t.ex. utbildning)tillbarnarbeteidefalldeförekommer. FN:sbarnkonvention,artikel32 Varjebarnharrättattskyddasmotekonomisktutnyttjandeocharbetesomskadar barnetellerhindrarhans/hennesskolgång Gsrekryteringspolicyärattendastanställaarbetaresomär18årelleräldre.Detfinns ingaindikationerpåöverträdelser.fabrikentittarpåidkortochharkopiorav studieintyg,utdragurpolisochfamiljeregister.ingettyderpåattgbrytermotsin egenpolicyellerindonesisklagstiftning.omenminderårigavmisstagharanställts avbrytsanställningskontraktetbådefördenminderårigaochdenansvarigapersonalen. InspektöreninformeradeattdettainteärtillräckligtiförhållandetillSKLs uppförandekod. Enligtindonesisklagstiftning(ACNr.13Year2003ConcerningManpower)ärdet tillåtetattanställaarbetskraftunder18årochenligtparagraf69tillåtetattanställa13 15åringaromdeutförenklareuppgifter.DärförbehöverGskapaentydligpolicyför atthanteraminderårigarbetskraft. Krav:tillverkarenskallutvecklaettsystemförattförebygga,undersökaförekomstav, ochtahandomfallavbarnarbeteidenegnaorganisationen. Prioritering:Riskföravvikelser vångsarbete Ingenförekomstavtvångsarbete(ILOnr29och105) Attutnyttjanågonformavtvångsellerstraffarbeteaccepterasinte. Detfinnsingabeläggföratttillverkarenärellervaritinvolveradinågonformav tvångsarbete.fabrikenkvarhålleringapersonligadokumentellerdepositionavpengar. Vidintervjuermedarbetarefastställdesinformationochdokumentationfrån fabriksledningenochinspektörenfanningabevisförattnågotavföljandeförekommer; Avskuldtillföretagetframkallatellerpåannatvisofrivilligtarbete vingandetillanställning Exploateringavkontraktssystemet Människohandel Fängelsearbete Ingaavvikelserhittades.

9 9 Diskriminering Ingenförekomstavdiskriminering(ILOnr100och111) Diskrimineringpågrundavetnisktillhörighet,kön,religionsocialtursprung, handikapp,politiskaåsikterellersexuellorienteringfårinteförekomma. Iföretagetsrekryteringsmaterialgesingendirektindikationomattdiskriminering förekommer. Enexternläkareutföretthälsotestpåarbetssökandesomäraktuellaföranställning.I hälsotestetingårblodprovförhepatitb,röntgen,urinprovmm.enföretagsläkare värderaromdetbehövsgörasvidareundersökningaravenarbetssökande.exempelvis högtglykosvärdemedförvidaretester.enligtledningenförekommeringagraviditets ellerhivtester.personalavdelningenförklaradeattdeanvänderläkartestenföratt gallrakandidaterföranställningeftersomvissasjukdomarkanvarasmittsamma.inga dokumentpåvisadeattensådangallringutförs.enligtpersonalavdelningentestas kandidaterförfärgblindheteftersomvissaarbetsuppgifterkräverexaktfärgbedömning förattundvikafelproduktionocholyckor.fabrikenregistrerarreligiöstillhörighetför attkunnaplaneraproduktionenunderreligiösahögtider.inspektörenrekommenderar attledningenutformarenickediskrimineringspolicysombeskriverhurovanstående faktoreranvändsirekryteringsprocesserochbefordran. Krav:Enickediskrimineringspolicysomtydligtbeskriverhurovannämndafaktorer (läkarundersökningochreligion)användsianställningsochbefordringsprocesser. Prioritering:Riskföravvikelser Arbetstiderochövertidsarbete Normalarbetstidfördagskiftsarbeteär08:00till16:30femdagariveckaneller08:00 till17:30sexdagariveckan.skiftsystemetäruppdelatifyragruppersomvardera arbetarfemdagarperveckamedtreåttatimmarsskiftperdag: 07:0015:00 15:0023:00 23:0007:00 Skiftarbetarearbetarsammaskiftfemdagarochgårpåettnyttskifteftertvåvilodagar. Alladagarförutomfredagharmanentimmeslunchrastmedanfredagslunchenär förlängdtillenochenhalvtimmeförattgetidtillfredagsbön.iövrigtharallarätttill15 minutersbönerastperdag.anställdaäterlunchidenexterntdrivnamatsalen,dock ansvararfabrikenförmåltiderundernattskiftet. Nyanställdahartremånadersprovanställningochefterdettafårmankontraktmedlön pådagsbasis.eftertvåårövergårlönenoftasttillfastmånadslönberoendepåomden anställdaleverupptillproduktivitetsochnärvarokrav.detförekommerdockfalldär anställdaharhaftdagslöniupptilltioår.deintervjuadearbetarnaansågatt lönesystemetärrättvistochingenansågattdeofrivilligthöllskvaridagslöne betalningen.pensionsåldernärnormalt55årvilketöverensstämmermedindonesisk lagstiftning.vissaanställdaförnyarsinakontraktefter55år.kontorsarbetareoch arbetaremedhögreutbildning,bl.a.frångsinternutbildning,fåroftast månadsbaseradlönfrånbörjan.

10 10 Mångaanställdaärkvarframtillpensionen.Personalomsättningärca12%permånad utansäsongsavvikelser.detförekommeringensäsongsvisökningavefterfrågandock producerasnågotmerinnanramadandåfabrikenärstängditvåveckor.dettainnebär ennågothögreövertidsfrekvensochökatantaltimanställda. Allaarbetare,kontorsarbetarnainkluderat,bäruniformermedsynligtfabriksID anordnadeavg.dettabekräftadesiintervjuermedarbetare.detfinnsinga övernattningsmöjligheterpåfabrikenvilketgörattallaarbetareborutanförområdet. Allaproduktionshallarochlagerrumharfingeravtryckläsaresomenbartanvändsi börjanochslutetavettskiftdåmanintestämplarutunderrasterna.registertagnafrån stämpelklockanvisarattanställdaoftaarbetarövertid.intervjuadearbetarebekräftar attövertidärfrivilligtochattavtaltecknasmedarbetsgivarenattövertidaccepteras. Inspektörenfannattstämpelklockanbararegistrerarnärvaroochinteövertid.Manuellt registerförsiställetavförmänförövertidsarbete.dessaregisteröverförsmanuelltini lönesystemetpåpersonalavdelningen.dagsochmånadsbaseradelönerutbetalas genomseparatasystem.registrenfördagsbaseradelönerfannspåanläggningeni angerangmedanregistrenförmånadsbaseradelönerfannspåhuvudkontoretijakarta ochkundedärförintejämförasmedstämpelklockanvidinspektionstillfället.ett registerurvalmedtagetfrånjakartagranskades. EnligtArtikel78(1)bidenindonesiskaanställningslagen(ACNR13YEAR2003, ConcerningManpower)ärtretimmardenhögsttillåtnaövertidenperdag;14timmar perveckaoch56timmarpermånad.övertidfördagslönearbetareoch månadslönearbetareinnebärextratimmarochextraskift.registerfrånstämpelklockan visarpå100timmarsövertidivissafallvilketöverskridertillåtenövertidochävenatt detvåavtaladevilodagarnaintealltidtasut(sebilaga2nc1).ledningenärmedveten omdettaochharvidtagitåtgärderförattminskaövertidsarbete. Krav:Arbetsgivaremåstesetillattettledningssysteminförssomförprotokollöver anställdasarbetstidochvarnarnärenanställdöverskriderdenlagstadgadegränsenför övertid. Prioritering:Störreavvikelse. Krav:Arbetsgivaremåsteinföraetttransparentledningssystemsomgerdeanställda möjlighetattkontrolleraegenarbetstid. Prioritering:Riskföravvikelse. Lönerochövertidsersättning Övertidbetalasmedenochenhalvgångertimlönenunderennormalarbetsdagförden förstaövertidstimmenochtvågångertimlöndenresterandetiden.imlönenberäknas genomattmultiplicera1/173medmånadslönen,exklusivebonusochövriga ersättningar. Månadsavlönadpersonalbetalasden25:evarjemånadochövertidsersättningbetalas den10:evarjemånad.dagsavlönadebetalasfördensammanlagdaarbetadetiden inklusiveövertidden30:evarjemånad.lönerbetalasviabanköverföringar.

11 11 Löneninkluderar: Grundlön Övertidsersättning Skiftersättning Närvarobonus Logiersättning ransportersättning MinimilöneniangerangärRp (US$218)permånad.Detförekomingafallav lönerlägreänminimibeloppet.inspektörenvaldeettantalanställdaslöneregisterför löneochövertidsuträkningar. Vidberäkningargjordapåinspektionsunderlagupptäcktesintenågraoegentligheter. Dokumentationförsocialförsäkringsutbetalningartillhandahöllsavfabrikenunder inspektionenochingaoegentligheterupptäcktes.enbartanställdameddagslönfår lönespecifikation.anställdamedmånadslönkanfålönespecifikationvidförfrågan. Krav:Fabrikenmåstegelönespecifikationervidvarjeutbetalningsåattanställdakan kontrollerasinautbetalningar. Prioritet:Riskföravvikelse Föreningsfrihet Föreningsfrihetochorganisationsrätt(ILOnr87och98) Iländerdärföreningsrättenärbegränsadellerunderutveckling,skallleverantören verkaförattanställdafårmötaföretagsledningenförattdiskuteralöneoch arbetsvillkorutannegativakonsekvenser. Paragraf104iIndonesiensarbetslagstiftninggerarbetarnarätttillattdeltaioch organiserafackföreningarienlighetmedlagen. Sedan2001ärfackföreningenSerikatPekerjaKimiaEnergidanPetambanganSerikat PekerjaSeluruhIndonesiarepresenteradpåfabriken(Fackföreningenförkemikalie ochgruvindustri).detfinnsingaandrafackföreningarrepresenterade.ungefär90%av samtligaanställdapåfabriken(13800)äranslutna.anställdaharrättattväljaomde villblianslutna(9095%avangeranggspersonaläranslutna).ledningenstödjer fackföreningenochharintesattnågrarestriktioner. 21avGsstyrelsemedlemmarärmedifackföreningenochansvararförföljande kommittéer: Organisering(medlemskap) Utbildningochsäkerhet Kommunikation(inomfackföreningen) Ledning konflikter Anställningstrygghetochreligion

12 12 Valavstyrelse: Valberedningen,somväljerfackföreningsordförande,bestårav510personer. Valberedningenanordnarmötemedde195fackligarepresentantersomnominerar kandidaterförordförandepostengenomattskrivaettnamnpåenvalsedel.allamed20 nomineringarkandiderartillordförandeposten.alla13000medlemmarharrösträtt. Styrelsen,sombestårav21medlemmarutsessedanavengruppbeståendeav avgåendeordförande,dennyaordföranden,sekreterare,enarbetstagarrepresentant samttvåfackföreningsmedlemmar.styrelsenochfackföreningsrepresentanterharen mandatperiodpåtreår. Fackföreningenkantvingaledningenattanpassafabrikentillgällandelagstiftning. FemårigtmedlemskapifackföreningenkostarRp10000.Fackföreningenärgenerellt settdenendakommunikationsvägentillledningen. Ettkollektivavtalpåfabrikenförhandladesframavfackföreningen2001.Dettaavtal förnyasvartannatår(bilaga3 GP3). Någraintervjuadeyngreanställdaupplevdeattdeblevtvingadeattgåmedi fackföreningen. Krav:Arbetsgivarenskallskapaettsystemsomgeralternativavägarattkommunicera problemmedledningen.särskiltföranställdasominteärfackföreningsanslutna. Prioritet:Riskföravvikelser. Hälsaochsäkerhet Arbetsmiljönskallhållaennivåsomöverensstämmermedinternationellariktlinjer. Anställdaskallinformerasomdeeventuellahälsoriskersomarbetetkanmedföra.Alla anställdaskallhatillgångtillochanvändarelevantskyddsutrustning. Skyddsombudochsäkerhetsutbildning DeanställdashälsaochsäkerhetansvarasprimärtavavdelningenförHälsa&Säkerhet (HSE). AvdelningenförHälsa&Säkerhetansvararförföljandeområden: Skyddsutrustning(PPE) Översvämning,jordbävningochströmavbrott(säkerhetsföreskrifter) Kemikalier(säkerhetsdatablad) Dammpartiklar,belysning,utsläpp,temperatur,buller,luft Arbetsolyckor Incidentkontroll Avfall(återvinningsbart,ejåtervinningsbart,farligt) Miljöpåverkan AvdelningenförHälsa&Säkerhetansvararinteförföljande: Maskinunderhållochsäkerhet(ingenjörsavdelningensansvar) Energiochresursförbrukning(ingenjörsavdelningensansvar) Säkerhetsträning(utbildningsavdelningensansvar)

13 13 K3LDgruppenansvararförimplementeringenavsäkerhetsförordningarfrån avdelningenförhälsa&säkerhet.varjeskiftharenkommittébeståendeavledningoch arbetaresomrapporterartillk3ld.k3ldansvararförregelbundnamötenmeddessa kommittéer. BennySetiawanärcertifieradsäkerhetsansvarig(enligtkravfrånGovernmentMinistry ofmanpower).hanansvararförkoordineringavsäkerhet,säkerhetsträning, skyddsutrustning,arbetstillstånd(bådeåtanställdaochexterntinhyrdpersonal) riskanalys,maskinskötselochmiljöpolicy(iso14001). Inspektörengickigenomföljandedokument: Riskanalysrapport(nov2012),medfokuspåriskfaktoreriproduktionochmiljö. Riskanalysförmaskiner(2juli,2012),nyinköptamaskinerinklusive skyddsutrustning. Olycksfallsrapport(fallfrånenstege) Dr.ItaMariza,administrativchefförutbildningsavdelningen,äransvarigför säkerhetsorienteringavnyanställdaochinternutbildningavanställda.förmänmåste rapporteratillhonomomorienteringenseffektivitet. Skyddsutrustning Gharutförtriskanalyspåallaarbetsuppgifterpåfabriken.Deflestaarbetsuppgifterna krävernågonformavskyddsutrustning.intervjueravanställdabekräftarattdefått adekvatträningochanvänderskyddsutrustning,dockobserverarinspektörenatt användningenavskyddsutrustningvarinkonsekventochoftainteenligtföreskrifterna. Avsaknadavinstruktioneromhurskyddsutrustningenskallanvändasnoterasochide falldärinstruktionerfannssaknadespassandeskyddsutrustning.ivissafallvarförsta hjälpenlådaninteutrustadenligtföreskrifternaochiblandfannsdeninlåstpåkontor (sebilaga2förbättringsområden,nc9,nc10). Krav:Arbetsgivaremåstehaettfungerandeledningssystemsompåminnerarbetareatt användaadekvatskyddsutrustningochkorrigeraranvändandetavskyddsutrustning. Prioritet:Mindreavvikelse Krav:Närdetfinnsinstruktioneromskyddsutrustning,måstedennasamtförstahjälpen lådafinnastillgänglig. Prioritet:Riskföravvikelse Nödutrymning Ledningssystemenbeskrivernödutrymningsrutinerochinspektörengavstillgångtill materialet.bränderkategoriserasiomfattningsommindre,mellanstoraochstörreoch hanteraspåolikasätt.mindrebränderförekommermedjämnamellanrum(åttamindre brändernoteradesunderdeförstatiomånadernaav2013).evakueringbehöverinte skevidmindrebrand.varjebrandtillfälleregistrerasochförebyggandeåtgärdertas.

14 14 Brandutrymningochbrandövningutförsvidfleratillfällenvarjeår.Mindreomfattande brandövningarutförsengångpermånadochenstörrebrandövningutförsengångper år.anställdafårutbildningianvändningavbrandposterlikvälsombrandsläckare. Intervjuadpersonalärmedvetenomnödutgångarochbrandtrappor.Brandsläckare placeradeiparfinnsvidsamtligamarkeradenödutgångarochinspekterasvarjemånad. Nödutrymningochnödutgångsskyltarsaknadesinågraavlokalernasominteanvändsi produktionen,nämligenmatsalochaktivitetsrum.detfinnsingautrymningsplanereller brandövningarsomtäckerdessalokaler(bilaga2 NC4,NC5,NC6).Enstaka nödutgångarärintetydligtmarkeradeellersaknashelt(bilaga2 NC11,12,13). Elavbrottavolikaomfattningförekommerocheftersomfabrikenäridrift24timmar perdagärmanutrustadmednödgeneratorer. Nödbelysningärintekonsekventriktadmotnödutgångarnaochdenärintekoppladtill nödgeneratorer.ledningeninformeradedockattsåvarfalletmendettakundeinte bekräftasellertestasunderrevisionen.paragraf10.1.2(firepreventionstandardsin BuildingDesign)byggnadsdesignstadganangerattallnödbelysningskallvara batteridriveniåtminstonetjugominuter. Krav:Arbetsgivarenmåstesetillattdetfinnssäkerhetsföreskriftertillallabyggnader inklusivedesominteanvändstillproduktion(aktivitetsrum,matsalochmoské). Prioritet:Störreavvikelse Krav:Arbetsgivarenmåstesetillattnödbelysningfungerarävenunderelavbrott. Prioritet:Riskföravvikelse Olyckorochtillbud illverkarenförettrapportregisteröverolyckor,ochharettledningssystemsom beskriverhurmanskallhandskasmedtillbud.över25tillbudrapporteradesförraåret. Inspektörentogdelavregistrensombeskrevorsaktillolyckornaochåtgärder(bilaga3 GP1). Vidolycksfallförsdenskadadetillfabrikensegenhälsovårdsklinik,somharegnaläkare ochsjuksköterskorsamtärutrustadmedmediciner,förstahjälpenochsyre.iettfåtal fallhardendrabbadeförtstillettnärliggandesjukhus. Detfinnsingetsomtyderpåattdetfinnsettstyrsystemsomföljerupprapporteringom tillbudsomkundehaorsakatallvarligskada. Krav:Fabrikenmåsteetableraettutförligtledningssystemsomidentifierarochrättar tilltillbudocholyckor. Prioritet:Riskföravvikelse Kemikaliesäkerhet Kemikalierochfarligtmateriallagraspåolikaställenpåanläggningen.Detfinnsett kemikalielagerutanfördensåkalladeanläggningasamtiventileraderuminnei

15 anläggninga.detfannssäkerhetsdatabladförsamtligakemikaliersomvartillgängliga vidförfrågan. Följandepunktertyderpåatthanteringavkemikalierkundeförbättras: 1) Råmaterialmärktasommiljöfarligaellersomkrävdeskyddsutrustninglagrades oftaihopmedråmaterialsomintevarmiljöfarliga.allaformeravråmaterial behandladeslikadant. 2) Säkerhetsdatabladfannsintealltidtillgängliginärhetenavkemikalierna. Arbetarnakundeintealltiddirekttaredapåhurkemikaliernaskullehanteras. 3) Skyddsutrustningenligtsäkerhetsdatabladvarintealltidplaceradinärhetenav kemikalierna. 4) Ingenpersonalfinnsmedsärskiltansvararförkemikalierna. Detharinterapporteratsomnågrastörretillbudmedkemikaliermenavdelningenför Hälsa&Säkerhetmåsteimplementeraettledningssystemsomkontrollerarkemikalier. Krav:Arbetsgivarenmåstesetillattgiftigtråmaterialavskiljsfrånofarligtråmaterial. Prioritet:Riskföravvikelse. Krav:Säkerhetsdatabladmåstefinnasinärhetenavkemikalier. Prioritet:Riskföravvikelse. Krav:Skyddsutrustningmåsteplacerasinärhetenavkemikalier. Prioritet:Störreavvikelse. Krav:Utseochutbildapersonalsomhanterarkemikalier. Prioritet:Riskföravvikelse. Maskinsäkerhet Ingenjörsavdelningenäransvarigförinspektionochriskanalysavmaskiner,och säkerhetssystem. Underhållavmaskinerskerpåföljandesätt: 1. Förebyggandeunderhåll(dagligen,varjemånad,årligen). 2. Underhålliförbättringssyfte. 3. Uppgradering. Inspektörengickigenometturvalavtillbudsrapporter. Vissamaskinoperatörer somt.ex.gaffeltruckförare måstevaracertifierade(kopior avcertifikatverifierades). Personalmatsal Detfinnstvåmatsalarpåfabrikenmedolikaexternaaktörer.Fabrikenharlicensattha matsal.bådaoperatörernaharlicensatttillagamat.detfinnsingetledningssystemsom omfattarmatsalen. 15

16 16 Måltiderserverasmotmatkupongersomanställdaerhålleravfabriken.Matsalenär öppenfrån06:00till19:00.intervjuadpersonalvarnöjdmedarrangemanget. Nattarbetarefårmatavfabriken. Krav:Arbetsgivarenmåsteskapaettledningssystemsomriktasspecifiktmotmatsalen angåendesäkerhetsrutinerochhälsokontroller. Arbetsmiljö Detfinnsettfungerandestyrsystemförmiljöfaror.AvdelningenförHälsa&Säkerhetär ansvarigfördetta.externaparterutförårligatesterangåendeluft,dammpartiklar, buller,temperatur,belysning,luktochavloppsvatten. Fabrikenutförtemperaturochbelysningstestervarjemånad. Följandedokumentgranskades: Externtestrapport(luft,buller,avloppsvatten,lukt,temperaturochbelysning(1 januaritill1juni,2013) Belysningstestrapport(internkontrollvarjemånad),2slumpmässigtutvalda månader. Rapportombuller internrapportfebruari2013ochexternrapport,maj2013. Vissaavdelningarhadebullernivåersomöverstegdenlagstadgadegränsenochdär användshörselskydd. Ingaavvikelserfunna. Miljö Företagetskallsträvaefterattminskasåvälsinenergiochresursförbrukningsomsitt avfallochutsläpptillmark,atmosfärochvatten.kemikalierskallhanteraspåettför människanochnaturensäkertsätt. AvdelningenförHälsa&Säkerhetansvararförledningssystemenangående avfallshanteringochutsläpp.ingenjörsavdelningenansvararförledningssystemen angåendeenergiochresursförbruksamtiso14001ochcsrinitiativ. Produktionsavfallindelasigiftigakemikalier,annatgiftigtavfall,återvinningsbartoch ickeåtervinningsbart.ettledningssystemärimplementeratförvarjeenskild sophantering.externaparteransvararförsophanteringenochcertifikatgranskadesav inspektören. Följandedokumentgicksigenomavinspektören: Miljöstyrningssystemrapport,januari juni,2013(utfördåtmiljöministeriet). Elektricitet,vattenochbränsleförbrukning. Analysavvattenförbrukning. Analysavutsläpp(vätskeutsläpp,industriavfall,gas,aska,ånga,buller) Planförstyrsystemgällandeutsläpp(förbränning,avlopp,fläkt, skyddsutrustning).

17 Detfinnsingaindikationerpåattgiftigtavfallsläppsutinaturen.Intehellerattde allmännautsläppenöverskriderlaglignivå.förnärvarandeharföretageningenenhetlig planförattmätaocharbetamedutsläppsreduceringmeningenjörsavdelningenarbetar medenplanförattminskaenergiochbränsleförbrukningochmanuppvisar dokumentationöverplaneringavavloppsvattenreningsamtanvändningavsolceller. GblevISO14001certifierade2009ochfickdetförnyat2012.Miljöstyrningsdokument fannspåhuvudkontoretijakartaochkunderdärförintegranskasvidinspektionen. Baravissaavstyrsystemetsdirektivförmedladestillavdelningarna.CSRträningärdock endelavledningsutvecklingen(bilaga3 GP4). GframhäverderasCSRinitiativ(CorporateCitizenship)påsinhemsida.CSRinitiativen handlarblandannatomaids/hivutbildning,utvecklingsprojektidenlokala omgivningen,nödhjälpochfinansielltstödtillfattigaskolelever. Krav:Ledningenmåsteknytasammanallamiljöinitiativtillettövergripande miljöledningssystem. Prioritet:Riskföravvikelse Hanteringavleverantörerochunderleverantörer HanteringavleverantörerochunderleverantörerärintespecifiktomnämntiSKIs uppförandekodmenrevisioneninkluderadeändåprocessernakringtillverkarens upphandlingförattidentifierapotentiellaavvikelserivärdekedjan. Föratthanteraenleverantörslistapåhundratalsunderleverantörerfinnsenskriftlig inköpsstandard( PurchasingFlow )förattvägledavidurvalochnomineringav leverantörer.systemetinkluderarettklassificeringssysteminnehållande produktkvalitet,ledningssystem,prisochleveranskompetens.fabrikenundersöker certifikatsomiso14001,ävenomdessainteverkarhanågonstörrebetydelsei urvalsprocessen.inspektörenpåpekadeattkunderkankrävaattginvolverarmiljö ochsocialaaspekteriurvaletavunderleverantörer. 17

18 18 Summeringavinspektörensintryck DådettavardenförstauppförandekodsinspektionensomGhardeltagitivar ledningenmånomhändelseprocessenochangelägenattinvolverapersonaleni inspektionen.underöppningsmötetdeltog35representanterfrånledningenvaraven delkomresandefrånhuvudkontoretijakarta.ledningenvarflexibelochhjälpsamdå enavinspektörernafickställainsinresavilketinnebarattantaletdagarbehövde utökassomettresultatavatteniställetförtvåinspektörerutfördeinspektionen. Fotograferingianläggningenvarbelagdmedrestriktionersåtillvidaattinspektöreninte fickfotograferasjälviproduktionshallarna.fotograferingensköttesavfabriks representantersomgavinspektörenettusbminnemedavfabrikenutvaldabilder.i övrigtfickinspektörenfotograferasjälvefterattobjektgodkäntsavledningen. Ettstortantaldokumentnödvändigaförinspektionenförvaraspåhuvudkontoreti Jakarta.rotsattmångadokumenthadetagitsmedtillanläggningeniangeranginför inspektionen,ienlighetmedinspektörensplaneringochupplägg,kundedethavarit fördelaktigtattutföradelaravinspektionenpåhuvudkontorettexdokumentanalysoch ledningsmöte.föratteffektiviserainförframtidainspektionerkanledningenöverväga attgöradennauppdelning. Detfannsingabevispåbarnarbetare.Detfinnsdockingatydligariktlinjeromrutiner ifallenminderåriganställs.inspektöreninformeradeattdettaintetillfredsställerskis uppförandekodombarnarbete.handlingsplanombarnarbetemåsteutformas. Bevispåtvångsarbetehittadesinte.Detfinnsingateckenpåattanställdasdokumenttas omhandellerattdepositionkrävsvidanställning. Dendagsbaseradelönenövergårmestadelstillmånadsbaseradlöneftertvåår.Dock kandagslöneutbetalningenförlängasomdenanställdainteleverupptillförväntade kravomproduktivitetochnärvaro.intervjuadpersonalgerinteintryckavattanseatt systemetärorättvistellerattdeofrivilligtblirpåtvingadearbete. Denormalaarbetstidernaärinomramenförindonesisklagstiftningochövertidsarbete skerpåfrivilligbasisenligtpersonalen.vidgranskningavtimochlöneregister avslöjadesdockattnågraanställdaarbetarövertidsomöverskriderdenindonesiska lagstiftningen.åtgärderbörtassåattettsystemimplementerassomkontrollerar övertid.ingalönerunderlagstadgadminimilönobserverades. Närdetgällerarbetstidsredovisningsåanvändsenstämpelklockavidarbetsdagens börjanochslutmeninformationenfråndennaingårinteilöneberäkningensomistället baseraspåmanuellanoteringaravförmänilagerochverkstad.dessahandskrivna registeröverförsmanuelltinilönesystemetpåpersonalavdelningen. Dagslönearbetarefårenlistavarjemånadsomindikerarberäknadarbetstidpermånad medanmånadslönearbetarenfårensådanenbartvidsärskildförfrågan.

19 19 Inspektörenföreslogattregistreringsamtuträkningavarbetstidbörvaramer transparentochöverskådligförattanställdaskallkunnakontrolleraarbetstidi förhållandetilllöneutbetalning. Detförekomingaskillnaderilöneersättningellerbefordringsomvisarpåsystematisk diskriminering.detstandardiseraderekryteringsdokumentetvisadeintehellerpå någonsystematiskdiskriminering. Enexternläkareutföretthälsotestpåarbetssökandesomäraktuellaföranställning.I hälsotestetingårblodtestförhepatitb,röntgen,urintestmm.högtglykosvärdemedför vidaretester.läkartestenanvändsförattgallrakandidaterföranställningeftersom vissasjukdomarkanvarasmittsamma.kandidatertestasförfärgblindheteftersom vissaarbetsuppgifterkräverexaktfärgbedömningförattundvikafelproduktionoch olyckor.fabrikenregistrerarreligiöstillhörighetförattkunnaplaneraproduktionen underreligiösahögtider.inspektörenrekommenderarattledningenutformarenicke diskrimineringspolicysombeskriverhurovanståendefaktoreranvändsi rekryteringsprocesserochbefordran. Sedan2001ärfackföreningenförkemikalieochgruvindustrisektorn,representeradpå fabriken.merän90%avhelagsarbetsstyrkaäranslutna.detfinns195 fackrepresentanterpåg.fackföreningenharförhandlattillsigmångafördelaktiga avtal,texkollektivavtalsomomförhandlasvartannatår.intervjuadpersonallitarpåatt ledningendiskuterarproblemsomfackligarepresentantertarupp.detfannsinga indikationeravpåtryckningarfrånledningenattintegåmedifackföreningen.detkan dockisammanhangetnoterasattettantalavde45intervjuadeanställdadockupplevde påtryckningarattblifackligtanslutna. FöretagshälsovårdsamthälsaochsäkerhethanterasavSäkerhetsavdelningensom ansvararförföretagetssäkerhetsförordningar.k3ldkallasdenledningstillsatta gruppenpåanläggningdsomansvararfördagligasäkerhetsprocedureroch rapporterartillsäkerhetsavdelningen.varjeskiftharenegensäkerhetskommitté beståendeavförmänocharbetare somrapporterartillk3ld. Ingenjörsavdelningenansvararförsäkerhetirelationtillmaskinunderhåll. Utbildningsavdelningenansvararförövergripandesäkerhetsorienteringavnypersonal. Anläggningenpresterarvälinomföljandeområden:riskutbildning,analys,åtgärder, kommunikationavhälsa&säkerhetochtilldelningavsäkerhetsansvarpå avdelningarna.registeruppdaterasmedjämnamellanrumochdethållsregelbundna brandövningar. Förbättringarkangörasinomföljandeområden: ydligtmarkeradebrandutgångarochstrategisktplaceradnödbelysningsom måstetestasregelbundet.

20 Brandsäkerhetochutrymningsrutineribyggnadersominteanvändsför produktionalltsåaktivitetsrumochmatsalar,samtombesörjaattdörrarskall öppnasutåt. Simuleringsövningargällandeströmavbrott. Bättrerutinerförattsäkerställaattanställdaanvänderkorrektskydds utrustning. Kemikalierskallbevarasochhanteraspåettsäkraresätt: Separerafarligakemikalierfrånandrakemikalier. Användsäkerhetsdatabladförkemikalierdärdetföreskrivs. Utrustapersonalsomhanterarfarligakemikaliermedrättskyddsutrustning. Utseansvarigpersonalsomfårregelbundenutbildningikemikaliehantering. GblevISO14001certifieratår2009(förnyades2012).Ansvaretförattlevaupptill certifieringendelasmellaningenjörsavdelningenochsäkerhetsavdelningen. Inspektörenkundeintesedetfullständigadokumentetsombeskriverprocedureri förhållandetilliso14001dådetbevaraspåhuvudkontoretijakarta. Detskerenårligkontrollavluftkvalitet,bullernivå,temperatur,lukt,belysningoch spillvattenkvalitetpåanläggningen.kontrollenutförsavexternakontrollanter.vid tidenförinspektioneninstalleradesettnyttventilationssystemidäckhärdningshallen. Produktionsavfallindelasimiljöfarligakemikalier,annatmiljöfarligtavfallsamt återvinningsbartavfall.avfallshanteringskerexternt. GbörinföraenallmäninstruktionavseendeföljandemiljöaspekterenligtSKIs uppförandekod: Lägreenergiförbrukning. Reduceringavavfall. Reduceringavutsläpptillatmosfär,vattenochmark. Hanteringavkemisktochmiljöfarligtavfall. Matsalarnaanvänderettkupongsystemfördeanställdasmåltider. Brandsäkerhetenärundermåligimatsalarnaeftersommärktanödutgångareller evakueringsinstruktionersaknas. IbeskrivningenavurvalsprocessenförunderleverantörernämnsattmanangerISO 14001somkriterier,mensåärintefallet.Enligtledningenplanerarmanattaktivtfölja ISO14001iurvalsprocessen(någonmålsättningfördettafinnsinte). ÖverlagärinspektörensbedömningavGsledningssystemförsociala,etiskaoch miljöaspekterpositivochkommunikationenmedledningochadministrationärgod. Företagetvarvilligtattseöverdeområdendärförbättringarbehövdesmedhänseende tillskiskod,sebilaga2.dethadevaritönskvärtominspektörenvaritfriareatt fotograferaianläggningarnaiställetfördestriktarestriktionernasomförekom. 20

!Respect!Sustainable!Business!AB! Inspektionsrapport!

!Respect!Sustainable!Business!AB! Inspektionsrapport! RespectSustainableBusinessAB Inspektionsrapport Kundens'namn:'SKL KommentusInköpscentral (SKL) Fabriksnamn:' GitiRadialTire(Anhui)Co. Ltd. GitiTire(Anhui)Co.Ltd Inspektionsledare:' JeffreyLee(Gekko) Adress:'

Läs mer

Uppförandekod för AAK Group (kort version)

Uppförandekod för AAK Group (kort version) Uppförandekod för AAK Group (kort version) INLEDNING AAK:s vision är att vara det självklara valet för förädlade vegetabiliska oljor. För att vi ska uppnå detta är det avgörande för AAK att samtliga anställda

Läs mer

FISKARS UPPFÖRANDEKOD FÖR LEVERANTÖRER (SUPPLIER CODE OF CONDUCT)

FISKARS UPPFÖRANDEKOD FÖR LEVERANTÖRER (SUPPLIER CODE OF CONDUCT) FISKARS UPPFÖRANDEKOD FÖR LEVERANTÖRER (SUPPLIER CODE OF CONDUCT) Fiskars strävar efter en långsiktigt lönsam affärsverksamhet på ett etiskt och ansvarsfullt sätt som stöder en hållbar utveckling. Fiskars

Läs mer

HUSQVARNA-KONCERNENS UPPFÖRANDEKOD

HUSQVARNA-KONCERNENS UPPFÖRANDEKOD HUSQVARNA-KONCERNENS UPPFÖRANDEKOD Code of conduct HANS LINNARSON, VD och koncernchef Husqvarna har under sin l ånga och tr aditionsrik a historia byggt upp et t mycket got t anseende som är ovärderligt.

Läs mer

Revisionsrapport. - Uppföljandekontroll av etiska och sociala krav

Revisionsrapport. - Uppföljandekontroll av etiska och sociala krav Revisionsrapport - Uppföljandekontroll av etiska och sociala krav Svensk leverantör: Lammhults Reviderad tillverkare: Leverantören Land: Kina Revisionsdatum: 6-7/5 2014 Revisorer: Winni Sun och Amy Wang,

Läs mer

Enkätfrågor till uppföljning av Uppförandekoden

Enkätfrågor till uppföljning av Uppförandekoden Enkätfrågor till uppföljning av Uppförandekoden Södertälje kommuns och dess bolags uppförandekod 1 Har ert företag en egen uppförandekod? Om ja, vänligen ladda upp er egen uppförandekod. 2 Har ert företag

Läs mer

Uppförandekod Kort version The global leader in door opening solutions

Uppförandekod Kort version The global leader in door opening solutions Uppförandekod Kort version The global leader in door opening solutions 2 Uppförandekod Denna version av uppförandekoden är en sammanfattning av vår uppförandekod. Den distribueras till alla medarbetare.

Läs mer

Revisionsrapport. - Uppföljandekontroll av etiska och sociala krav

Revisionsrapport. - Uppföljandekontroll av etiska och sociala krav Revisionsrapport - Uppföljandekontroll av etiska och sociala krav Svensk leverantör: Almedahls Alingsås AB Reviderad tillverkare: Borch Textile Poland Land: Polen Revisionsdatum: 2014-05-12 2014-05-13

Läs mer

Självutvärdering för leverantörer

Självutvärdering för leverantörer Självutvärdering för leverantörer Innehållsförteckning 1. Introduktion 2. Miljö 3. Affärsetik 4. Arbetsmiljö och sociala villkor 5. Föreningsfrihet 6. Arbetstid 7. Löner 8. Tvångsarbete 9. Barnarbete 10.

Läs mer

CY innehåll 1.0 POli

CY innehåll 1.0 POli te r & ar m b än et PO LI sk sf CY fö li ör r ga h å rä l tt la ig nd he e n oc h m än sk lig a rä tt ig he te r Sv er ig e po lic y fö r ar be ts fö rh ål la nd en Po licy Ca rl sb er g innehåll 1.0 Föreningsfrihet

Läs mer

Uppförandekod för leverantörer

Uppförandekod för leverantörer Uppförandekod för leverantörer 1 Inledning 1.1 Uppförandekodens grundval: Internationella standarder Denna uppförandekod ( uppförandekoden ) grundar sig på de allmänna principerna i FN:s allmänna förklaring

Läs mer

Loomis AB UPPFÖRANDEKOD. Loomis AB, Vallgatan 11 plan 4, Box 902, 170 09 Solna Växeltelefonnummer: 08-522 920 00, www.loomis.com

Loomis AB UPPFÖRANDEKOD. Loomis AB, Vallgatan 11 plan 4, Box 902, 170 09 Solna Växeltelefonnummer: 08-522 920 00, www.loomis.com Loomis AB UPPFÖRANDEKOD Loomis AB, Vallgatan 11 plan 4, Box 902, 170 09 Solna Växeltelefonnummer: 08-522 920 00, www.loomis.com 2 av 5 Ramar för Loomis uppförandekod Loomis uppförandekod skall spegla våra

Läs mer

SJ koncernens Uppförandekod för leverantörer

SJ koncernens Uppförandekod för leverantörer SJ koncernens Uppförandekod för leverantörer I SJs uppförandekod för leverantörer anger vi våra grundläggande krav vad gäller mänskliga rättigheter och arbetsvillkor, miljö och affärsetik. SJ förväntar

Läs mer

Uppförandekod för Quintiles leverantörer

Uppförandekod för Quintiles leverantörer Uppförandekod för Quintiles leverantörer 2 En hållbar affärsverksamhet är viktig för Quintiles. Denna uppförandekod för leverantörer ( koden ), som är baserad på internationellt erkända normer, syftar

Läs mer

Uppförandekod INLEDNING

Uppförandekod INLEDNING Uppförandekod INLEDNING Denna uppförandekod omfattar samtliga leverantörer och deras underleverantörer och alla övriga affärspartner till H&M Hennes & Mauritz AB (publ.), ett svenskregistrerat aktiebolag

Läs mer

RUSTA UPPFÖRANDEKOD 2012 RUSTA AB 1

RUSTA UPPFÖRANDEKOD 2012 RUSTA AB 1 RUSTA UPPFÖRANDEKOD 2012 RUSTA AB 1 INNEHÅLL 1 Rusta uppförandekod... 3 2 Lagliga krav... 3 3 Affärsetik... 4 4 Barnarbete... 4 5 Säkerhet... 4 6 Arbetarnas rättigheter... 6 7 Arbetsmiljö i fabrikerna...

Läs mer

Semcon Code of Conduct

Semcon Code of Conduct Semcon Code of Conduct Du håller nu i Semcons Code of Conduct som handlar om våra koncerngemensamma regler och förhållningssätt. Semcons mål är att skapa mervärde för sina intressenter och bygga relationer

Läs mer

Husqvarna Group rapporterar årligen om sitt hållbarhetsarbete i enlighet med riktlinjerna för Global Reporting Initiative.

Husqvarna Group rapporterar årligen om sitt hållbarhetsarbete i enlighet med riktlinjerna för Global Reporting Initiative. Uppförandekod Husqvarna Groups uppförandekod följer FNs Global Compacts principer kring mänskliga rättigheter, arbetsrätt, miljö och korruption riktade till företag. Husqvarna Group stödjer FN Global Compact

Läs mer

Eettiset ohjeet. Etisk regelsæt Eettiset ohjeet. Code of Conduct. Eettiset ohjee. Etikos kodeksas. Verhaltenskodex. ode of Conduct.

Eettiset ohjeet. Etisk regelsæt Eettiset ohjeet. Code of Conduct. Eettiset ohjee. Etikos kodeksas. Verhaltenskodex. ode of Conduct. Kódex správania Kódex správania ode of Conduct Eettiset ohjeet Etikos kodeksas Kodeks postępowania Kodeks postępowania Verhaltenskodex iska tisk Verhaltenskodex regelsæt regler Etisk regelsæt Eettiset

Läs mer

Code of Conduct Uppförandekod

Code of Conduct Uppförandekod Code of Conduct Uppförandekod Inledning och bakgrund Femtorp AB förser marknaden med söta livsmedel och dessertprodukter från de främsta tillverkarna. Våra kunder kan förvänta sig en hög servicegrad, kunskap

Läs mer

YES. environment SEGERS. social TO SOCIAL RESPONSIBILITY. rights. religion. strong CSR. skin. color. financial. logistics. good.

YES. environment SEGERS. social TO SOCIAL RESPONSIBILITY. rights. religion. strong CSR. skin. color. financial. logistics. good. SEGERS skin good religion corporate sex time color logistics YES TO SOCIAL RESPONSIBILITY worth social workwear environment strong CSR code of conduct supplier rights financial VI SÄGER JA TILL SOCIALT

Läs mer

CSR Ansvarsfullt företagande

CSR Ansvarsfullt företagande CSR Ansvarsfullt företagande Det finns ett ökat tryck på våra företag att respektera mänskliga rättigheter, grundläggande arbetsrättsprinciper och grundläggande miljöstandarder oavsett var i världen vi

Läs mer

Leverantörskvalificering

Leverantörskvalificering siemens.com Leverantörskvalificering Siemens AB Bäste leverantör, Kvalitet, miljö och arbetsmiljö värderas högt på Siemens. Ni som leverantör till oss bidrar aktivt till vårt gemensamma arbete att till

Läs mer

IMFs modell för internationellt ramavtal

IMFs modell för internationellt ramavtal IMFs modell för internationellt ramavtal INLEDNING 1. Den ekonomiska globaliseringen minskar hindren för handel med varor och tjänster och överföring av kapital, och den gör det möjligt för transnationella

Läs mer

Uppförandekoden ska finnas tillgänglig på engelska och svenska på IVL:s hemsida.

Uppförandekoden ska finnas tillgänglig på engelska och svenska på IVL:s hemsida. Vår uppförandekod IVL:s uppförandekod Allmänt IVL Svenska Miljöinstitutet AB (IVL) åtnjuter högt anseende som ett ansvarstagande företag. Det bygger på integritet och affärsverksamhet som är konsekvent

Läs mer

Sammanfattning av rapporten Leksakstillverkning i Kina en uppföljning av sociala kriterier för Göteborgs kommun, 2009-12-02

Sammanfattning av rapporten Leksakstillverkning i Kina en uppföljning av sociala kriterier för Göteborgs kommun, 2009-12-02 Sammanfattning av rapporten Leksakstillverkning i Kina en uppföljning av sociala kriterier för Göteborgs kommun, 2009-12-02 Göteborgs Upphandlingsbolag är ett kommunägt företag. Företagets huvuduppgift

Läs mer

2012-02-15. Säkerhet i fält. Dödsolyckor i arbetet 1955-2009 efter kön. Arbetstagare. Källa: AV/ISA

2012-02-15. Säkerhet i fält. Dödsolyckor i arbetet 1955-2009 efter kön. Arbetstagare. Källa: AV/ISA Renare Mark Norr, 2012-02-14 Säkerhet i fält Christin Jonasson Dödsolyckor i arbetet 1955-2009 efter kön. Arbetstagare Källa: AV/ISA 1 Fördelning efter orsaker Antal dödsfall i arbetsolyckor bland förvärvsarbetande

Läs mer

Växjö Kommun. David Braic, upphandlingschef. Hållbar upphandling, 14 mars 2013

Växjö Kommun. David Braic, upphandlingschef. Hållbar upphandling, 14 mars 2013 Växjö Kommun David Braic, upphandlingschef Hållbar upphandling, 14 mars 2013 1 Etiska krav - Växjös perspektiv Växjö kommun Politiskt tryck Moralisk fråga Tidigare Sanningsförsäkran kring jämställdhet,

Läs mer

Handledning för åtgärder och rapportering vid avvikelser från SKI 1 :s sociala och etiska krav

Handledning för åtgärder och rapportering vid avvikelser från SKI 1 :s sociala och etiska krav Handledning för åtgärder och rapportering vid avvikelser från SKI 1 :s sociala och etiska krav 1 SKL Kommentus Inköpscentral 1 Innehåll Handledning för åtgärder och rapportering vid avvikelser från SKI:s

Läs mer

Historien om StudentConsulting

Historien om StudentConsulting Historien om StudentConsulting Grundades av studenterna Tobias Lindfors och Niklas Jansson i en studentkorridor 1997 i Luleå. Ett av Nordens åtta största bemannings- och rekryteringsföretag, helt specialiserade

Läs mer

Uppförandekod för leverantörer

Uppförandekod för leverantörer April 2011 Uppförandekod för leverantörer INLEDNING Att bedriva affärsverksamhet med en högt ställda etiska krav är grundläggande för Sodexo. Därför har vi utvecklat denna Uppförandekod för att tydliggöra

Läs mer

Medarbetarboken. Senast uppdaterad: 130218

Medarbetarboken. Senast uppdaterad: 130218 Senast uppdaterad: 130218 Medarbetarboken Tanken med den här boken är att vi som jobbar på A.Schulman Nordic ska kunna finna svar på frågor vi stöter på i det dagliga arbetet - inte minst kring olika personalrelaterade

Läs mer

Uppförandekod. CSR Sid 1 (11) Copyright 2009, 2009 by FTA Foreign Trade Association, Brussels The English version is the legally binding one.

Uppförandekod. CSR Sid 1 (11) Copyright 2009, 2009 by FTA Foreign Trade Association, Brussels The English version is the legally binding one. Sid 1 (11) Uppförandekod BSCI 2.3-11/09 Sid 2 (11) Uppförandekod 1 Bakgrund I enlighet med ILO:s konventioner, FN:s Allmänna förklaring om de mänskliga rättigheterna, FN:s konventioner om barns rättigheter

Läs mer

KINNARPS UPPFÖRANDEKOD KINNARPS UPPFÖRANDEKOD

KINNARPS UPPFÖRANDEKOD KINNARPS UPPFÖRANDEKOD 1 KINNARPS UPPFÖRANDEKOD 2 INLEDNING Kinnarps, som grundades av Jarl och Evy Andersson 1942, har sina rötter i den svenska landsbygden. Från början var Kinnarps ett litet familjeföretag, men har idag vuxit

Läs mer

Bild 1. Bild 2. Bild 3. Alla vill och kan skapa en bra arbetsmiljö

Bild 1. Bild 2. Bild 3. Alla vill och kan skapa en bra arbetsmiljö Bild 1 Alla vill och kan skapa en bra arbetsmiljö 2012-09-17 Informationsgruppen, distriktet i Stockholm 2012-09-07 1 Bild 2 Adam Jansson, arbetsmiljöinspektör Distriktet i Stockholm arbetsmiljoverket@av.se

Läs mer

ja till socialt ansvar

ja till socialt ansvar ja till socialt ansvar www.unglobalcompact.org Grunden är FN s globala fördrag vi säger ja till socialt ansvar I en värld där orättvisorna är stora och många textilföretag blundar väljer vi på Segers att

Läs mer

Alla vill och kan skapa en bra arbetsmiljö

Alla vill och kan skapa en bra arbetsmiljö Alla vill och kan skapa en bra arbetsmiljö 2012-09-17 Informationsgruppen, distriktet i Stockholm 2012-09-10 1 Adam Jansson, arbetsmiljöinspektör Distriktet i Stockholm arbetsmiljoverket@av.se Informationsgruppen,

Läs mer

Information till utländska bärplockare

Information till utländska bärplockare Information till utländska bärplockare Dessa regler gäller för utländska bärplockare Det här är en informationsbroschyr från Arbetsmiljöverket för dig som vill arbeta som bärplockare i Sverige. Arbetsmiljöverket

Läs mer

Internationellt Avtal rörande respekt för och främjande av Internationella normer för arbetslivet och fackliga rättigheter. Mellan

Internationellt Avtal rörande respekt för och främjande av Internationella normer för arbetslivet och fackliga rättigheter. Mellan 1 Internationellt Avtal rörande respekt för och främjande av Internationella normer för arbetslivet och fackliga rättigheter Mellan Elanders ( Bolaget ) och UNI Global Union ( UNI ) 2 1. Inledning: 1.1

Läs mer

Antagande av ny s k uppförandekod i samband med offentliga upphandlingar. Dnr KS 2012-56

Antagande av ny s k uppförandekod i samband med offentliga upphandlingar. Dnr KS 2012-56 Utdrag ur protokoll fört vid sammanträde med kommunstyrelsens arbetsutskott i Falkenberg 2012-11-20 FALKENBERG 328 Antagande av ny s k uppförandekod i samband med offentliga upphandlingar. Dnr KS 2012-56

Läs mer

Samordna avtalsförhandlingar

Samordna avtalsförhandlingar Avtalsförhandlingar och dialog mellan arbetsmarknadens parter inom offentliga tjänster EPSU:s 4:e avtalskonferens Samordna avtalsförhandlingar En översikt av EPSU:s nuvarande avtalspolitik och förslag

Läs mer

Cirkulär 3/2012 2012-03-13

Cirkulär 3/2012 2012-03-13 Cirkulär 3/2012 2012-03-13 Grönt cirkulär distribueras till arbetsplatserna Avtalsuppgörelse med SEKO 2012 Bilagor Lönetabeller för Väg och Banavtalet. INNEHÅLL 1. Avtalsperiod och ikraftträdande 2. Lön

Läs mer

2014-09-23. CSR-Policy. Corporate Social Responsibility. Policy antagen: 2014-09-23 Styrelsen A-lotterierna EF. (Utfärdare: Eric Widegren)

2014-09-23. CSR-Policy. Corporate Social Responsibility. Policy antagen: 2014-09-23 Styrelsen A-lotterierna EF. (Utfärdare: Eric Widegren) 2014-09-23 CSR-Policy Corporate Social Responsibility Policy antagen: 2014-09-23 Styrelsen A-lotterierna EF (Utfärdare: Eric Widegren) Innehåll 1 CSR-Policy... 3 2 A-lotterierna-koncernens CSR-arbete...

Läs mer

Rutin för intern miljörevision

Rutin för intern miljörevision Sida 1 (5) Syfte Regelbundna interna miljörevisioner ska genomföras för att säkerställa att universitetets miljöledningssystem är korrekt infört och underhållet. Omfattning Rutinen ska användas vid all

Läs mer

INTRAPRENADER Policy och riktlinjer

INTRAPRENADER Policy och riktlinjer INTRAPRENADER Policy och riktlinjer Förslag Baserat på beslut i kommunstyrelsen 2006-01-10, samt medbestämmandeförhandlingar 2005-11-16 och 2005-12-01 Alternativa driftformer Kommunfullmäktige i Eksjö

Läs mer

Alla vill och kan skapa en bra arbetsmiljö

Alla vill och kan skapa en bra arbetsmiljö Alla vill och kan skapa en bra arbetsmiljö Barnverket 2014-03-14 Informationsgruppen, distriktet i Stockholm 2014-03-04 1 Adam Jansson, arbetsmiljöinspektör enheten för region öst arbetsmiljoverket@av.se

Läs mer

CSR. corporate social responsibility inom inekogruppen

CSR. corporate social responsibility inom inekogruppen CSR corporate social responsibility inom inekogruppen maj 2014 CSR INOM inekogruppen 1 CSR corporate social responsibility inom inekogruppen Det är vår fasta övertygelse att ansvarsfullt företagande gagnar

Läs mer

Kom igång med utbildningen bättrevardag.nu!

Kom igång med utbildningen bättrevardag.nu! Kom igång med utbildningen bättrevardag.nu! Det här dokumentet riktar sig till dig som ansvarar för att personalen får utbildning på ett företag eller själv utbildar om arbetsmiljö för vuxna eller ungdomar

Läs mer

Version 2.0, 2013-09-24. Uppförandekod. (Code of Conduct)

Version 2.0, 2013-09-24. Uppförandekod. (Code of Conduct) Version 2.0, 2013-09-24 Uppförandekod (Code of Conduct) Uppförandekod Kalix Tele24 tillhandahåller telefonister till företag, myndigheter och organisationer inom ett mycket stort spektra av verksamheter.

Läs mer

Val av leverantör och leverantörens ansvar

Val av leverantör och leverantörens ansvar - förord De flesta företag kräver en bra produkt och kvalitet till ett motsvarande relevant pris av sina leverantörer. Vi på Nudie Jeans tycker dessutom att det är mycket viktigt att ta ett större ansvar

Läs mer

Checklista för en god arbetsmiljö. Denna checklista har utarbetats av Folksam Skadeförsäkring i samarbete med övervakande arbetarskyddsmyndigheter.

Checklista för en god arbetsmiljö. Denna checklista har utarbetats av Folksam Skadeförsäkring i samarbete med övervakande arbetarskyddsmyndigheter. Checklista för en god arbetsmiljö Denna checklista har utarbetats av Folksam Skadeförsäkring i sam med övervakande arbetarskyddsmyndigheter. 1 Checklista för en god arbetsmiljö En god arbetsmiljö finns

Läs mer

POLARICA ANSVARSFULL BÄRPLOCKNING

POLARICA ANSVARSFULL BÄRPLOCKNING POLARICA ANSVARSFULL BÄRPLOCKNING Vi behöver de thailändska bärplockarna och därför måste vi göra allt vi kan för att de ska åka hem med ett leende på läpparna. Tommy Innala, vd Polarica AB Ansvarsfull

Läs mer

Lönepolicy. Lönepolicy. i Falköpings kommun. Antagen av kommunfullmäktige 2013-11-25

Lönepolicy. Lönepolicy. i Falköpings kommun. Antagen av kommunfullmäktige 2013-11-25 Lönepolicy i Falköpings kommun Antagen av kommunfullmäktige 2013-11-25 Innehållsförteckning Inledning 3 Syfte 3 Almänna utgångspunkter 3 Lönesättning inom Falköpings kommun 4 Inlöst övertidsersättning

Läs mer

Miljöledningssystem FURNITURE CONSULTING AB

Miljöledningssystem FURNITURE CONSULTING AB Miljöledningssystem FURNITURE CONSULTING AB 2008-01-01, reviderad 2011-08-01 Miljöledningssystem FC. AB Organisation och ansvar Ledningsgrupp Verkställande direktör Dan-Henrik Eriksson Ekonomi/ administration

Läs mer

Mars 2008. Enskild överenskommelse. en möjlighet för dig att påverka dina villkor

Mars 2008. Enskild överenskommelse. en möjlighet för dig att påverka dina villkor Mars 2008 Enskild överenskommelse en möjlighet för dig att påverka dina villkor Varför enskilda överenskommelser? Vi pratar ofta om hur vi ska få ihop vårt livspussel. Vad det innebär är givetvis väldigt

Läs mer

Allmänheten om kollektivavtal

Allmänheten om kollektivavtal Akademikerförbundet SSR Allmänheten om kollektivavtal Rapport från opinionsundersökning 24 april 2009 Arne Modig 1 Sammanfattning Allmänheten om kollektivavtal Många svenskar har en positiv inställning

Läs mer

Enskild överenskommelse. En möjlighet för dig att påverka dina villkor

Enskild överenskommelse. En möjlighet för dig att påverka dina villkor Enskild överenskommelse En möjlighet för dig att påverka dina villkor 2 Varför enskild överenskommelse Vi pratar ofta om hur vi ska få ihop vårt livspussel. Vad det innebär är givetvis väldigt individuellt.

Läs mer

Avtalsyrkande avtalsrörelsen 2012 - KFS

Avtalsyrkande avtalsrörelsen 2012 - KFS Britta Kärnström Löner och yrkesvillkor Sida 1 Avtalsyrkande avtalsrörelsen 2012 - KFS Inledning Vi i Vision värnar om den svenska välfärden vilken skapar trygghet och välmående för både medborgare och

Läs mer

Medarbetarpolicy. för Institutet för språk och folkminnen

Medarbetarpolicy. för Institutet för språk och folkminnen BILAGA Medarbetarpolicy för Medarbetarpolicyn har tagits fram i samarbete mellan institutets samtliga avdelningar. Policyn gäller i första hand i två år, och ska sedan utvärderas och revideras. Fastställd

Läs mer

Arbetsmiljöverkets föreskrifter om systematiskt arbetsmiljöarbete. Föreskrifternas tillämpningsområde. Definition av systematiskt arbetsmiljöarbete

Arbetsmiljöverkets föreskrifter om systematiskt arbetsmiljöarbete. Föreskrifternas tillämpningsområde. Definition av systematiskt arbetsmiljöarbete AFS 2001:1 Arbetsmiljöverkets föreskrifter om systematiskt arbetsmiljöarbete Utkom från trycket Den 16 mars 2001 Beslutade den 15 februari 2001 (Ändringar införda t.o.m. 2008-09-30) Arbetsmiljöverket meddelar

Läs mer

Innehåll. 1.0 Arbete och mänskliga rättigheter 2.0 Hälsa och säkerhet 3.0 Miljö 4.0 Affärsetik

Innehåll. 1.0 Arbete och mänskliga rättigheter 2.0 Hälsa och säkerhet 3.0 Miljö 4.0 Affärsetik up p le fö ve r lic r an a en n de st tö ko ag re d ar r o fö e ch r Innehåll 1.0 Arbete och mänskliga rättigheter 2.0 Hälsa och säkerhet 3.0 Miljö 4.0 Affärsetik Bakgrund Carlsberg-gruppens uppförandekod

Läs mer

Alla vill och kan skapa en bra arbetsmiljö. Informationsgruppen, distriktet i Stockholm 2014-10-17 1

Alla vill och kan skapa en bra arbetsmiljö. Informationsgruppen, distriktet i Stockholm 2014-10-17 1 Alla vill och kan skapa en bra arbetsmiljö Informationsgruppen, distriktet i Stockholm 2014-10-17 1 Adam Jansson, arbetsmiljöinspektör Region öst arbetsmiljoverket@av.se Informationsgruppen, distriktet

Läs mer

Internationella Fairtrade-kriterier

Internationella Fairtrade-kriterier December 2011 Internationella Fairtrade-kriterier Sammanfattning Fairtrade och internationella Fairtrade-kriterier Välj Fairtrade-märkta produkter och skapa förutsättningar för odlare och anställda i utvecklingsländer

Läs mer

Arbetsmiljöarbetet inom Åklagarmyndigheten

Arbetsmiljöarbetet inom Åklagarmyndigheten ÅM-A 2010/0191 Arbetsmiljöarbetet inom Åklagarmyndigheten Riktlinjer inkl handlingsplan för 2010 RIKTLINJER FÖR ARBETSMILJÖARBETET UNDER 2010 Arbetsgivarens ansvar Riksåklagaren har det övergripande ansvaret

Läs mer

TRIBONAS UPPFÖRANDEKOD 2015

TRIBONAS UPPFÖRANDEKOD 2015 TRIBONAS UPPFÖRANDEKOD 2015 Vårt ansvar som arbetsgivare och medarbetare Vår företagskultur Tribonas företagskultur präglas av tre kärnvärden: Engagemang - På Tribona lägger vi stor vikt vid att sätta

Läs mer

Socialt ansvarstagande i upphandling. Uppförandekod för leverantörer

Socialt ansvarstagande i upphandling. Uppförandekod för leverantörer Socialt ansvarstagande i upphandling Uppförandekod för leverantörer Hållbar upphandling med gemensam styrka Gemensam uppförandekod för leverantörer Sedan 2006 samarbetar Stockholms läns landsting, Region

Läs mer

Mål och åtgärder för miljöarbetet vid Malmö högskola 2009-2012

Mål och åtgärder för miljöarbetet vid Malmö högskola 2009-2012 Mah/förvaltning Sid 1(6) Mål och åtgärder för miljöarbetet vid Malmö högskola 2009-2012 Inledning Vid Malmö högskola bedrivs forskning, utbildning och samverkan inom miljöområdet. Genom denna s k indirekta

Läs mer

Du gör skillnad. Stark tillsammans

Du gör skillnad. Stark tillsammans Du gör skillnad Stark tillsammans Du gör skillnad Som medlem är du alltid i fokus hos oss. Tillsammans hjälps vi åt och ser till att medlemskapet lönar sig för dig och dina arbetskamrater. Ditt engagemang

Läs mer

SJ-koncernens interna uppförandekod

SJ-koncernens interna uppförandekod SJ-koncernens interna uppförandekod SJ-koncernens interna uppförandekod Syftet med uppförandekoden är att ge vägledning för hur vi med utgångspunkt i SJs värdeord agerar och bemöter varandra och i mötet

Läs mer

Innehåll. 1.0 System och dokumentation 2.0 Arbetsmiljö 3.0 Akuta fall och arbetsskador 4.0 Hälsa och friskvård 5.0 Rehabilitering

Innehåll. 1.0 System och dokumentation 2.0 Arbetsmiljö 3.0 Akuta fall och arbetsskador 4.0 Hälsa och friskvård 5.0 Rehabilitering po li cy fö r ar be ts & mi sä lj ö ke, rh hä et ls a Sv er ig e po lic y fö r ar be ts m ilj ö, hä lsa och sä ke rh et Po lic y Car ls be rg Innehåll 1.0 System och dokumentation 2.0 Arbetsmiljö 3.0 Akuta

Läs mer

UPPFÖRANDEKOD. Midroc Europe 3 2 0 2011-06-01. Dokument nr. Översättning av MSS-100-11000-APO-00102. Allmänna ändringar, nytt dokumentnummer

UPPFÖRANDEKOD. Midroc Europe 3 2 0 2011-06-01. Dokument nr. Översättning av MSS-100-11000-APO-00102. Allmänna ändringar, nytt dokumentnummer UPPFÖRANDEKOD Dokument nr Översättning av MSS-100-11000-APO-00102 3 2 1 0 2011-06-01 Allmänna ändringar, nytt dokumentnummer Rev. Datum Beskrivning Handl Granskad Godkänd 2(5) Översättning INNEHÅLL ÖVERSÄTTNING...

Läs mer

Region Skånes Miljöbevis - checklista

Region Skånes Miljöbevis - checklista Region Skånes Miljöbevis - checklista Denna checklista består av kriterier som ni som mottagare av bidragsfinansiering från Region Skåne ska fylla i om ni får minst sex prisbasbelopp eller mer per tolvmånadersperiod.

Läs mer

FÖRETAGSORGANISATION KVALITETSPOLICY

FÖRETAGSORGANISATION KVALITETSPOLICY FÖRETAGSORGANISATION KVALITETSPOLICY Företag Namn Gunnar Perssons Grävmaskins AB Adress Bergstena, Sjölyckan Postnr o postadress 441 92 ALINGSÅS Telefon kontor 0322 63 50 40 Telefax 0322 63 50 40 Hemsideadress

Läs mer

Överföring av hemsjukvårduppgifter till ny huvudman

Överföring av hemsjukvårduppgifter till ny huvudman Överföring av hemsjukvårduppgifter till ny huvudman Uppdraget Arbetsgruppen har fått i uppdrag att komma med förslag hur överföring av hemsjukvårdsarbetsuppgifter kan flyttas från Norrbottens läns landsting

Läs mer

SKF etiska riktlinjer. för leverantörer och underleverantörer

SKF etiska riktlinjer. för leverantörer och underleverantörer SKF etiska riktlinjer för leverantörer och underleverantörer SKF etiska riktlinjer för leverantörer och underleverantörer SKFs leverantörer och underleverantörer spelar en viktig roll i vår efterfrågekedja

Läs mer

Reglemente för Huddinge kommuns upphandling

Reglemente för Huddinge kommuns upphandling 1 (10) Antaget av kommunfullmäktige 1995-06-12, 91, med ändring i kommunstyrelsen 1996-12-02, 271, i kommunfullmäktige 2001-10-08, 147, 2003-01-20, 5, 2005-10-24, 20, 2008-12-08, 213, 2013-06-11 22, 2014-06-10

Läs mer

Säkerhetsföreskrifter och miljöregler hos Övik Energi

Säkerhetsföreskrifter och miljöregler hos Övik Energi Säkerhetsföreskrifter och miljöregler hos Övik Energi 2 (8) Välkommen till Övik Energi! Vi vill med dessa säkerhetsföreskrifter och miljöregler göra dig uppmärksam på vilka regler som gäller vid vistelse

Läs mer

Miljökrav och socialt ansvar i offentlig upphandling

Miljökrav och socialt ansvar i offentlig upphandling Miljökrav och socialt ansvar i offentlig upphandling Bengt Strömstedt Miljöchef Försvarets materielverk (FMV) www.fmv.se bengt.stromstedt@fmv.se Vi levererar komplexa produkter för militär och civil användning.

Läs mer

Manual Kvalitet, Miljö och Arbetsmiljö

Manual Kvalitet, Miljö och Arbetsmiljö To t a l p r o j e k t i M ä l a r d a l e n A B Manual Kvalitet, Miljö och Arbetsmiljö enligt ISO 9001:2008, ISO 14001:2004 och OHSAS 18001:2007 Ett sammandrag Totalprojekt i Mälardalen AB har för att

Läs mer

Vägledning vid kontraktsvillkor gällande socialt ansvarstagande

Vägledning vid kontraktsvillkor gällande socialt ansvarstagande Vägledning vid kontraktsvillkor gällande socialt ansvarstagande Detta är en vägledning för entreprenörer som har Trafikkontorets sociala kontraktsvillkor inskrivna i sina avtal. Syftet är att underlätta

Läs mer

Arbetsrättsliga krav vid offentlig upphandling

Arbetsrättsliga krav vid offentlig upphandling Arbetsrättsliga krav vid offentlig upphandling - om möjligheterna att ställa krav på kollektivavtalsvillkor Upphandlingsdagarna 29 januari 2015 Lisa Sennström Definition av socialt ansvarsfull upphandling

Läs mer

Systematiskt arbetsmiljöarbete Uppgiftsfördelning av arbetsmiljöuppgifter

Systematiskt arbetsmiljöarbete Uppgiftsfördelning av arbetsmiljöuppgifter Systematiskt arbetsmiljöarbete sfördelning av arbetsmiljöuppgifter 1(7) Fördelning av arbetsmiljöarbetsuppgifter Institutionen för Tema (reviderad 26 april 2010) Dnr Tema-2010-00082 På Institutionen för

Läs mer

+ FÖRHANDLINGSPROTOKOLL. KFS kontor, Hornsgatan 1, Stockholm

+ FÖRHANDLINGSPROTOKOLL. KFS kontor, Hornsgatan 1, Stockholm + FÖRHANDLINGSPROTOKOLL Datum 2010-06-02 1 (9) Ärende Förhandlingar angående lön och allmänna anställningsvillkor med mera för branschområde Trafik Plats Parter Närvarande KFS kontor, Hornsgatan 1, Stockholm

Läs mer

CR-ramverk för Ratos innehav

CR-ramverk för Ratos innehav CR-ramverk för Ratos innehav Implementerat under 2011 120304 CBL 1 Ledningsstruktur och styrning av CR-arbetet Nivå 1 (grundläggande) Ansvaret för styrning av CR-frågor hos företagsledningen Rutiner finns

Läs mer

Gör bra, få bra. Styrande dokument Redovisande dokument Hantering av avvikande produkter/tjänster Korrigerande åtgärder Förebyggande åtgärder

Gör bra, få bra. Styrande dokument Redovisande dokument Hantering av avvikande produkter/tjänster Korrigerande åtgärder Förebyggande åtgärder Gör bra, få bra Detta dokument utgör Data Networks VBY ABs kvalitets och miljöledningssystem och innehåller information om hur vi arbetar med kvalitet och miljö. Dokumentet motsvarar kraven i aktuell ISO

Läs mer

Riktlinjer för Habilitering & Hälsa. Miljöarbete 2014-2016

Riktlinjer för Habilitering & Hälsa. Miljöarbete 2014-2016 Riktlinjer för Habilitering & Hälsa Miljöarbete 2014-2016 Riktlinjer för miljöarbete Habilitering & Hälsa 2014-2016 Habilitering & Hälsa ska: följa den miljölagstiftning, föreskrifter och övriga krav som

Läs mer

SÖDERSJUKHUSETS PERSONALPOLICY

SÖDERSJUKHUSETS PERSONALPOLICY SÖDERSJUKHUSETS PERSONALPOLICY Man kan se det som att vi alla har två arbeten - ett arbete där vi utför de arbetsuppgifter vi är utbildade för, och ett arbete där vi aktivt bidrar till att utveckla verksamheten.

Läs mer

Om betydelsen av vinstsyftet i aktiebolagslagen

Om betydelsen av vinstsyftet i aktiebolagslagen Rolf Skog 140627 Om betydelsen av vinstsyftet i aktiebolagslagen Inledning Affärsverksamhet kan bedrivas i olika associationsformer, däribland i bolag. I svensk lag finns bestämmelser om enkla bolag, handelsbolag

Läs mer

Jämställdhetsplan 2013-2015

Jämställdhetsplan 2013-2015 Jämställdhetsplan 2013-2015 I jämställdhetsplanen beskrivs Tyresö kommuns övergripande mål för jämställdhetsarbetet samt de aktiva åtgärder som kommunen som arbetsgivare planerar att vidta för att främja

Läs mer

Korsreferenstabell GRI

Korsreferenstabell GRI Posten Norden Hållbarhetsredovisning 2010: Korsreferenstabell GRI Posten Nordens hållbarhetsredovisning för 2010 är upprättad enligt Global Reporting Initiatives (GRI) riktlinjer för hållbarhetsredovisning,

Läs mer

Introduktion Saneringsbranschen

Introduktion Saneringsbranschen Introduktion Saneringsbranschen Innehåll Välkommen till saneringsbranschen 1 Ditt nya jobb 2 Den första tiden 3 Ansvar för introduktionen 3 Service och kvalitet 4 Professionell hållning 5 Service lönar

Läs mer

SKI Kundnöjdhet. Så får du kvitto på ditt ledarskap!! Att mäta kvalitetsarbete. 3 Februari 2010. Mari Nilsson, Svenskt Kvalitetsindex

SKI Kundnöjdhet. Så får du kvitto på ditt ledarskap!! Att mäta kvalitetsarbete. 3 Februari 2010. Mari Nilsson, Svenskt Kvalitetsindex SKI Kundnöjdhet Så får du kvitto på ditt ledarskap!! Att mäta kvalitetsarbete 3 Februari 2010 Mari Nilsson, Svenskt Kvalitetsindex Kort om SKI Har genomfört kund/brukarstudier under mer än 20 år. Idag

Läs mer

INTRAPRENADER Policy Kiruna Kommun

INTRAPRENADER Policy Kiruna Kommun INTRAPRENADER Policy Kiruna Kommun Fastställd av kommunfullmäktige 2009-02-23 11 Intraprenader En intraprenad är en enhet inom den kommunala förvaltningen med utökade befogenheter samt utökat ansvar för

Läs mer

PLAN FÖR UTBILDNING OCH KOMPETENS- UTVECKLING AV PERSONAL 2011-2013

PLAN FÖR UTBILDNING OCH KOMPETENS- UTVECKLING AV PERSONAL 2011-2013 M 709 202009 Sida av PLAN FÖR UTBILDNING OCH KOMPETENS UTVECKLING AV PERSONAL 20203 Beskrivning Planen för utbildning och kompetensutveckling av personal gäller högskolans miljöledningssystem utifrån identifierat

Läs mer

MILJÖLEDNINGSSYSTEM. Bröderna Näslund Byggare AB Januari 2008

MILJÖLEDNINGSSYSTEM. Bröderna Näslund Byggare AB Januari 2008 MILJÖLEDNINGSSYSTEM Bröderna Näslund Byggare AB Januari 2008 Revision A mars 2009 Revision B mars 2011 Revision C april 2012 INNEHÅLL MILJÖLEDNINGSSYSTEM 3 Vår miljöpolicy 3 Våra riktlinjer 3 Våra miljömål

Läs mer

Wedins Code of Conduct

Wedins Code of Conduct Wedins Code of Conduct Ett sunt företag och en god förebild 2 Wedins Code of Conduct 3 Socialt ansvar 6 Hälsa och säkerhet 8 Miljö 10 Djuromsorg 12 Genomförande och kontroll 14 Ett sunt företag och en

Läs mer

Hållbar upphandling för en hållbar utveckling

Hållbar upphandling för en hållbar utveckling Hållbar upphandling för en hållbar utveckling Hållbar Upphandling Sveriges regioner och landsting ansvarar för att alla invånare har tillgång till en god och väl fungerande hälso- och sjukvård, tandvård

Läs mer

Du gör skillnad. Stark tillsammans

Du gör skillnad. Stark tillsammans Du gör skillnad Stark tillsammans Du gör skillnad Som medlem är du alltid i fokus hos oss. Tillsammans hjälps vi åt och ser till att medlemskapet lönar sig för dig och dina arbetskamrater. Ditt engagemang

Läs mer