Tentamen i 2D1396 Bioinformatik, 2 juni 2006
|
|
- Lars Öberg
- för 9 år sedan
- Visningar:
Transkript
1 Tentamen i 2D396 Bioinformatik, 2 juni 2006 Kursansvarig: Lars Arvestad Inga hjälpmedel förutom skrivmedel är tillåtna. Skriv tydligt! Skriv bara på en sida av pappret och behandla bara en uppgift per pappersblad. Ge dina svar tydliga motiveringar. Lämna plats för kommentarer vid rättning. För godkänt krävs 5 poäng, 20 poäng ger betyg 4, och vid 25 poäng ges betyg 5. Du får tillgodoräkna dig bonuspoäng från hemtalen även på denna tenta. Lösningsförslag kommer att hittas på kursens hemsida. Resultaten anslås bredvid huvudingången till SBC:s korridor. Lycka till! No aids beyond writing equipment are accepted. Write clearly! Please use only one side of each paper and don t address more than one question per page. Justify your answers! Leave room for comments during grading. A passing grade is awarded at 5 points, 20 points are required for grade 4, and 25 points for grade 5. Suggested solutions will be available from the course web page. Exam results will be posted by SBC s main entrance. Good luck! Del. Varför finns det så många delprogram i Blast-paketet: blastp, blastn, tblastn, blastx, och tblastx? Vilka är de viktigaste skillnaderna mellan dem? (2p) Why are there som many subprograms in the Blast package: blastp, blastn, tblastn, blastx, och tblastx? What are the main differences between them? Var god börja nästa uppgift på nytt papper. Please start next question on a new paper. 2. I figur finner du ett fylogenetiskt träd. Ge en avståndsmatris som stämmer perfekt överens med kantlängderna i trädet! (2p) Figure shows a phylogenetic tree with branchlengths. Write down a distance matrix that agrees perfectly with the branchlengths! a d b 7 0 e Figur. c
2 3. Förklara följande begrepp. (5p) (a) Homologi (b) Sekundärstruktur (c) Synonyma codon (d) Positive inside rule (e) Molekylär klocka Please explain the following terms. (a) Homology (b) Secondary structure (c) Synonymous codons (d) Positive inside rule (e) Molecular clock 4. Förklara i ord vad HMM:en avbildad i figur 2 modellerar. Ge ett (enkelt) exempel på DNA som modellen passar väl mot. (2p) Explain in words what the HMM in Figure 2 is modelling. Give a simple example of DNA data that the model fits well with. Figur I figur 3 finner du två olika linjeringar. Vilken av dessa kommer att få högst Z-värde, och varför? Vi linjerar med en scoringfunktion som sätter + på identiska par och - på icke-identiska. Varje indel-symbol (-) har score -. (2p) Figure 3 displays two different alignments. Which one will get the highest Z-value, and why? We align using a scoring function that sets + for identical letter pairs and - for non-identical letters. Each indel character (-) has score -. (a) ACGTACGTACGTACGT AAGTAAG---GTAGGT (b) AAAAAAAAAAAAAACC AAAAAAA---CAAAAA Figur Hur definierar SCOP respektive Pfam begreppet domän? (2p) How does SCOP respectively Pfam define the term domain? Del 2 6. SCOP och CATH är två system för hierarkisk klassificering av proteindomäner. De skiljer sig åt en smula, men de har gemensamt att de delar upp domänfamiljer i klasser efter sekundärstruktur och exempel på klasser är α, β, α + β, och α/β. Föreslå en metod för automatisk klassificering av proteindomäner efter dessa klasser. Ge en översiktlig beskrivning av vad som krävs och diskutera eventuella svagheter med ditt förslag. (2p) SCOP and CATH are two systems for hierarchical classifications of protein domains. They have som differences, but one thing in common is that they use secondary structure for class definitions and examples of classes are α, β, α + β, and α/β. Suggest a method for automatic classification of protein domains into these classes. Give a basic overview of what is necessary and discuss potential weaknesses with your suggestion. 2
3 7. Forskare på bioteknikinstitutionen har nyligen tittat på en uppsättning gener hos Populus och andra växter som är intressanta därför att de är inblandade i regleringen av cellulosaproduktion. Man fann en mycket välbevarad domän som är karakteristisk för dessa gener, men övriga delar av generna uppvisar mycket få likheter. Figur 4 visar en linjering av domänfamiljen, med övriga delar av generna borttagna. (a) En av generna från Arabidopsis, At5g37478, saknade som synes en viktig del av domänen. Givet hur välbevarad domänerna var i övrigt var detta förvånande och man kunde misstänka att det berodde på en dålig genprediktion. Därför ville man undersöka om man kunde hitta en en fullständig domän i den contig som genen/domänen kom ifrån. Föreslå två olika metoder för att göra detta och ge en fördel och en nackdel med var metod. (4p) (b) Skillnaderna mellan domänsekvenserna är tydliga, trots att de är välbevarade, och det finns anledning att tro att ett fylogenetiskt träd återskapat baserat på domänen (med resten av generna borttaget) är relativt pålitligt. Men en bootstrap-analys ger mycket svagt stöd till så gott som alla kanter. Hur kommer det sig? (p) Researchers at the Biotech department have recently looked at a set of genes in Populus and other plants that are interesting because they are involved in the regulation of cellulose production. It was found that a well conserved domain was characteristic for these genes, while the rest of the genes show very little similaities. Figure 4 shows an alignment of the domainfamily, with other parts of the genes removed. (a) One of the Arabidopsis genes, At5g37478, misses an important part of the domain. Given the conservation of the domain family, this was surprising and it was guessed that a bad gene prediction was the root of the problem. Therefore, it was investigated whether one could find a complete domain in the contig that the gene/domain came from. Suggest two different methods for doing this and give one advantage and one disadvantage for each method. (b) The difference between the domain sequences are clear, despite their conservation, and there is reason to expect a phylogenetic tree reconstructed from the domain (with the rest of the genes discarded) to be fairly reliable. But a bootstrap analysis gives very weak support for almost all edges. How come? Ptr LHTGQRALKRAMFNYSVATKIYMNE-QQKRQIERIQKIIEE--EEVRTMRKEMVPRAQLM 8 At5g MFNYSVATNYYIQK-LQKKQEERLQKMIEE--EEIRMLRKEMVPKAQLM 84 Os09g LHTEERAIKRAGFNYQVASKINTNE-IIRRFEEKLSKVIEE--REIKMMRKEMVHKAQLM 45 AT3G LHSDIRAVERAEFDYQVTEKINLVE-QYKTERERQQKLAEE--EEIRRLRKEFVPKAQPM 432 AT5G LHSDVRAVERAEFDYQVAEKMSFIE-QYKMERERQQKFAEE--EEIRRLRKEFVPKAQPM 442 Ptr LHSDIRAVERADFDHQVSEKMSLIE-QYKMERERQRKLAEE--EEIRRLRKELVPKAQPM 39 Ptr LRSDIRAVERADFDHQVSEKMSLIE-QYKMERERQQKLAEE--EEVRRLRKELVPKAQPM 443 Os2g LHSEIRSVGRARFDHQVAERNSFLE-KLNMERERQQKLDEE--LEIKQLRKEQVPRAHPM 382 Os03g LHSDVRAIERAEFDQYVSERNKFAE-QLRLERERQQKLEEE--EMIKQLRKELVPKAQPM 248 AT5G LHVDHRPIERADFDHKIKEKEMMYK-RHLEEAEAAKMVEEE--RALKQLRRTIVPQTRPV 266 ATG LHVEHRAVERADFDHKIKEKENQYK-RYREESEAAKMVEEE--RALKQMRKTMVPHARPV 672 Ptr LNADHRAVGRAEFDQKVKEKEMLYK-RYREESETARMMEEE--KALKQLRRTMVPHARPV 784 Ptr LHADQRAVERAEFDHKVKEKEMLYK-RYREESETAKMMEEE--KALKQLRRTMVPHARPV 76 Os07g LHVDERAVQRSEFDNMVKEKEITYK-RFREENEFAQKIEEE--KAFKQLRRTFVPQARPL 754 Ptr FRSEERVAKRKEFFQKLGEKNNAKEDTEKKHLHARPKEKAE--HDLKKLRQSAVFRGKPS 244 AT3G FRSDERAEKRKEFFKKVEEKNKKEK-EDKFSCGFKANQNTNLASEEHKNPQVGGFQVTPM 46 Figur 4. Numbers indicate start and stop residues for the domain in the gene product. Grey levels are proportional to column conservation, with amino acid properties taken into account (some replacements are more dramatic than others). 3
4 8. I sammanfattningen för en artikel av Ternes et al. (J. Biol. Chem. 2006) står det så här. Fungal glucosylceramides play an important role in plant-pathogen interactions enabling plants to recognize the fungal attack and initiate specific defense responses. A prime structural feature distinguishing fungal glucosylceramides from those of plants and animals is a methyl group at the C9-position of the sphingoid base, the biosynthesis of which has never been investigated. Using information on the presence or absence of C9-methylated glucosylceramides in different fungal species, we developed a bioinformatics strategy to identify the gene responsible for the biosynthesis of this C9-methyl group. This phylogenetic profiling allowed the selection of a single candidate out of 24 7 methyltransferase sequences present in each of the fungal species with C9-methylated glucosylceramides. A Pichia pastoris knock-out strain lacking the candidate sphingolipid C9- methyltransferase was generated, and indeed, this strain contained only non-methylated glucosylceramides. Beskriv hur Ternes (antagligen) använde fylogenetisk profilering för att hitta den gen som ansvar för framtagningen av metyl-gruppen. (3p) The abstract of a paper by Ternes et al. (J. Biol. Chem. 2006) is given above (in the Swedish formulation). Describe how Ternes (most likely) used a phylogenetic profiling to find the gene creating the methyl-group. 9. I kursen har vi nämnt scoring-matriser för sekvensjämförelser, tex Blosum62 och PAM250, men ni har inte behövt bekymra er om vilken ni faktiskt har använt. Verktyg som Blast använder vettiga standardvärden och i fallet med scoring-matriser är det Blosum62 som används. Dessa matriser är dock väldigt generella och det finns exempel på data där de är långt ifrån optimala. (a) Ett exempel där det tagits fram alternativa scoringmatriser är för jämförelser av transmembranproteiner. Varför skulle Blosum62 inte vara lämplig om det var just transmembranregioner man jämför? (2p) (b) Antag att du blir ombedd att göra en scoring-matris för jämförelser av proteiner från två olika klasser av bakterier X och Y. Till din hjälp har du ett program som beräknar en scoringmatris givet en indata-matris som beskriver hur ofta aminosyra a har ersatts aminosyra b (för alla a och b), och hur ofta den hållits konserverad. Ditt arbetsmaterial är proteinsekvenser från ett X-genom och ett Y -genom. Beskriv hur du skulle gå till väga. (3p) We have mentioned scoring matrices for sequence comparisons in the course, for example Blosum62 and PAM250, but you have not had to worry about which one you have actually used. Tools such as Blast use reasonable default settings and Blosum62 is used in the case of scoring matrices. These matrices are however very general and there are examples of data where they are far from optimal. (a) One example of data for which specialized scoring matrices have been used is transmembrane proteins. Why would Blosum62 be unsuitable when transmembrane regions are compared? (b) Suppose you were asked to compute a scoring matrix for comparisons of proteins from two different classes of bacteria, X and Y. You have access to a computer program that computes a scoring matrix given an input matrix that describes how often a residue a has been replaced by residue b (for all pairs of a and b), and how often a stayed conserved. Your working material is protein sequences from one X genome and one Y genome. Describe your approach. 4
5 Suggested solutions to exam June 2, 2006, in 2D396 Bioinformatics Lars Arvestad Part. The programs handle two types of data, proteins and DNA. For example, blastp compares protein sequences with protein databases, while blastn compares DNA sequences to DNA databases. Translation of DNA is the other main point sought for in this question: tblastn and blastx compares proteins with DNA, and vice versa, while translating the DNA to make it comparable with proteins. Finally, tblastx compares DNA with DNA while translating both to amino acid sequences. 2. D a b c d e a 0 b 4 0 c d e Look it up! 4. The HMM describes repetitions of a 0 bp region, where all positions but two and perfectly conserved. Example data: ACACATACGT ACACGTGCGT. Comment: This a so-called tandem repeat that is found in the mitochondrial DNA in dogs and wolves (see Savolainen et al, Mol Biol Evol, 2000) and it is due to a mechanism called replication slippage. 5. Alignment (a) will get the highest Z-score. The reason is that the complexity of the sequences in (b) is so low that any alignment of the shuffled sequences, according to Z-score methodology, will get a similar score to the given alignment. According to a FASTA program, alignment (a) has Z 75 and the value for (b) is so insignificant that it is not reported. 6. SCOP defines a protein domain to be an independent structural unit. Regardless of its context, i.e., other domains present, it will fold to the same molecular structure. In Pfam a domain is an independent evolving unit and no reference to structure is given. In practice, this means that domains are sets of subsequences that are all very similar to each other. Part 2 6. A simple approach to solving this is to do a secondary structure prediction, say using PSIpred, and use that as a basis for classification. For instance, if there are lots of α elements and no β are reported, we call it an all-α. A similar rule is needed for the all-β class. For α + β we check if on part (beginning or end) of the protein contains α elements (and
6 coil, etc) while the rest contains β elements. For α/β we check that the groups of α and β predictions take turns. An important problem with this solution is that it is sensitive to errors in predictions. In practice, an all-α protein may be predicted to contain some β elements, which would ruin the prediction. 7. (a) One could use Blast or Fasta and search with another domain sequence in the contig. This is easy to do and you don t have to rely on having good gene prediction at all. On the other hand, you might get a spurious hit and/or not see that the domain you find is not part of a gene at all. Also, if the domain is split up in different exons we might not find the similarity. Using an HMM for the domain family on all ORFs in the contig has the same advantages and disadvantages. One could also try different gene prediction programs and see if they make other predictions. That way, we could actually determine whether a full, protein coding, gene is there. This could reveal other interesting similarities that does not involve the domains. The drawback is that gene predictions are hard to do and all gene prediction softwares may make serious mistakes. Henrik Aspeborg at the Biotech department did use this latter method successfully, and At5g37478 was shown to have a full domain within a gene which was similar to the closest Populus homologue. (b) Since the domain family is both conserved and short, the bootstrapping procedure is handicapped by not having informational columns. In each bootstrap iteration, only about 63% of the columns are actually used and this means that 37% of data is not used. In this case, that is too much data to throw away and a lot of edges in the tree cannot be resolved in the bootstrap procedure. Using another method (not covered in the course) that does not throw away data, we could actually show that the phylogeny quite trustworthy. 8. Ternes and his coauthors looked at the gene content of all known fungi genomes to see if there was a gene that was present in all genomes that had the mentioned C9-methylation, and was absent when no C9-methylation was used. The reasoning was that the methylation gene would not be necessary in the latter genomes and therefore redundant which during evolution would cause it to disappear. In the former genomes, where the gene is necessary, selection would make sure it stays. Ternes did find such a gene, and some other candidates with almost as good correlation. A knockout experiment showed that they immediately had found the right gene. 9. (a) The elements of scoring matrices contain log-odds scores, i.e., logarithms of fractions of probabilities. These probabilities reflect (expected) amino acid composition and replacement frequencies of the sequences compared. If you are working with data with very different amino acid frequencies, the scoring matrix will give you the wrong idea about what is a common replacement and not. Hence, in transmembrane regions, the typical hydrophobic amino acid composition differs a lot from what you find on average in proteins. (b) A brief suggestion: find pairs of protein sequences, one from X and one from Y, that are homologous and preferably orthologous. This can be done using Blasting, perhaps together with a phylogenetic analysis. Then, when we have the pairs of homologous proteins, we align them pairwise and count replacements. This will be the input to that program of ours. 2
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
Webbregistrering pa kurs och termin
Webbregistrering pa kurs och termin 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en länk till Studieöversiktssidan. På den sidan
denna del en poäng. 1. (Dugga 1.1) och v = (a) Beräkna u (2u 2u v) om u = . (1p) och som är parallell
Kursen bedöms med betyg, 4, 5 eller underänd, där 5 är högsta betyg. För godänt betyg rävs minst 4 poäng från uppgifterna -7. Var och en av dessa sju uppgifter an ge maximalt poäng. För var och en av uppgifterna
Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!!
Exam Molecular Bioinformatics X (MB) - March, - Page of Skriv svar på varje uppgift på separata blad. Lycka till!! Write the answers to each of the questions on separate sheets of paper. ood luck!! ) Sequence
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik Kurs: MA152G Matematisk Analys MA123G Matematisk analys för ingenjörer Tentamensdag: 2012-03-24 kl 14.30-19.30 Hjälpmedel : Inga hjälpmedel
Materialplanering och styrning på grundnivå. 7,5 högskolepoäng
Materialplanering och styrning på grundnivå Provmoment: Ladokkod: Tentamen ges för: Skriftlig tentamen TI6612 Af3-Ma, Al3, Log3,IBE3 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles
http://marvel.com/games/play/31/create_your_own_superhero http://www.heromachine.com/
Name: Year 9 w. 4-7 The leading comic book publisher, Marvel Comics, is starting a new comic, which it hopes will become as popular as its classics Spiderman, Superman and The Incredible Hulk. Your job
Support Manual HoistLocatel Electronic Locks
Support Manual HoistLocatel Electronic Locks 1. S70, Create a Terminating Card for Cards Terminating Card 2. Select the card you want to block, look among Card No. Then click on the single arrow pointing
Workplan Food. Spring term 2016 Year 7. Name:
Workplan Food Spring term 2016 Year 7 Name: During the time we work with this workplan you will also be getting some tests in English. You cannot practice for these tests. Compulsory o Read My Canadian
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, EITA50, LP4, 209 Inlämningsuppgift av 2, Assignment out of 2 Inlämningstid: Lämnas in senast kl
FÖRBERED UNDERLAG FÖR BEDÖMNING SÅ HÄR
FÖRBERED UNDERLAG FÖR BEDÖMNING SÅ HÄR Kontrollera vilka kurser du vill söka under utbytet. Fyll i Basis for nomination for exchange studies i samråd med din lärare. För att läraren ska kunna göra en korrekt
Make a speech. How to make the perfect speech. söndag 6 oktober 13
Make a speech How to make the perfect speech FOPPA FOPPA Finding FOPPA Finding Organizing FOPPA Finding Organizing Phrasing FOPPA Finding Organizing Phrasing Preparing FOPPA Finding Organizing Phrasing
This exam consists of four problems. The maximum sum of points is 20. The marks 3, 4 and 5 require a minimum
Examiner Linus Carlsson 016-01-07 3 hours In English Exam (TEN) Probability theory and statistical inference MAA137 Aids: Collection of Formulas, Concepts and Tables Pocket calculator This exam consists
and u = och x + y z 2w = 3 (a) Finn alla lösningar till ekvationssystemet
Kursen bedöms med betyg,, 5 eller underkänd, där 5 är högsta betyg. För godkänt betyg krävs minst poäng från uppgifterna -7. Var och en av dessa sju uppgifter kan ge maximalt poäng. För var och en av uppgifterna
Användning av Erasmus+ deltagarrapporter för uppföljning
Användning av Erasmus+ deltagarrapporter för uppföljning Internationaliseringsdagarna 2016 2016-11-02 Anders Clarhäll Participant Report Form Identification of the Participant and General Information (Motivation)
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
Webbreg öppen: 26/ /
Webbregistrering pa kurs, period 2 HT 2015. Webbreg öppen: 26/10 2015 5/11 2015 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en
En bild säger mer än tusen ord?
Faculteit Letteren en Wijsbegeerte Academiejaar 2009-2010 En bild säger mer än tusen ord? En studie om dialogen mellan illustrationer och text i Tiina Nunnallys engelska översättning av Pippi Långstrump
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
Samverkan på departementsnivå om Agenda 2030 och minskade hälsoklyftor
Samverkan på departementsnivå om Agenda 2030 och minskade hälsoklyftor Resultat från en intervjustudie i Finland, Norge och Sverige Mötesplats social hållbarhet Uppsala 17-18 september 2018 karinguldbrandsson@folkhalsomyndighetense
6 th Grade English October 6-10, 2014
6 th Grade English October 6-10, 2014 Understand the content and structure of a short story. Imagine an important event or challenge in the future. Plan, draft, revise and edit a short story. Writing Focus
Kvalitetsarbete I Landstinget i Kalmar län. 24 oktober 2007 Eva Arvidsson
Kvalitetsarbete I Landstinget i Kalmar län 24 oktober 2007 Eva Arvidsson Bakgrund Sammanhållen primärvård 2005 Nytt ekonomiskt system Olika tradition och förutsättningar Olika pågående projekt Get the
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
Introduktion till vetenskaplig metodik. Johan Åberg
Introduktion till vetenskaplig metodik Johan Åberg Innehåll Forskarvärlden Viktiga begrepp Referenshantering Den vetenskapliga rapporten Vetenskaplig diskussion Forskarvärlden Forskare mäts i antal publikationer
EXPERT SURVEY OF THE NEWS MEDIA
EXPERT SURVEY OF THE NEWS MEDIA THE SHORENSTEIN CENTER ON THE PRESS, POLITICS & PUBLIC POLICY JOHN F. KENNEDY SCHOOL OF GOVERNMENT, HARVARD UNIVERSITY, CAMBRIDGE, MA 0238 PIPPA_NORRIS@HARVARD.EDU. FAX:
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Collaborative Product Development:
Collaborative Product Development: a Purchasing Strategy for Small Industrialized House-building Companies Opponent: Erik Sandberg, LiU Institutionen för ekonomisk och industriell utveckling Vad är egentligen
1. Varje bevissteg ska motiveras formellt (informella bevis ger 0 poang)
Tentamen i Programmeringsteori Institutionen for datorteknik Uppsala universitet 1996{08{14 Larare: Parosh A. A., M. Kindahl Plats: Polacksbacken Skrivtid: 9 15 Hjalpmedel: Inga Anvisningar: 1. Varje bevissteg
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
Unit course plan English class 8C
Hanna Rüngen Wallner Unit course plan English class 8C Spring term 2018-01-11 w.2-8 forgery safe robbery burglar crime scene Mål och syfte med arbetsområdet Utveckla sin förmåga att: - kommunicera i tal
Om oss DET PERFEKTA KOMPLEMENTET THE PERFECT COMPLETION 04 EN BINZ ÄR PRECIS SÅ BRA SOM DU FÖRVÄNTAR DIG A BINZ IS JUST AS GOOD AS YOU THINK 05
Om oss Vi på Binz är glada att du är intresserad av vårt support-system för begravningsbilar. Sedan mer än 75 år tillverkar vi specialfordon i Lorch för de flesta olika användningsändamål, och detta enligt
Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5. Skriv svaren på varje fråga på SEPARATA blad.
Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5 Skriv svaren på varje fråga på SEPARATA blad. Skriv namn på VARJE blad. Du kan svara på engelska eller svenska. Motivera eller förklara
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Boiler with heatpump / Värmepumpsberedare
Boiler with heatpump / Värmepumpsberedare QUICK START GUIDE / SNABBSTART GUIDE More information and instruction videos on our homepage www.indol.se Mer information och instruktionsvideos på vår hemsida
INSTALLATION INSTRUCTIONS
INSTALLATION - REEIVER INSTALLATION INSTRUTIONS RT0 RF WIRELESS ROOM THERMOSTAT AND REEIVER MOUNTING OF WALL MOUTING PLATE - Unscrew the screws under the - Pack contains... Installation - Receiver... Mounting
F ξ (x) = f(y, x)dydx = 1. We say that a random variable ξ has a distribution F (x), if. F (x) =
Problems for the Basic Course in Probability (Fall 00) Discrete Probability. Die A has 4 red and white faces, whereas die B has red and 4 white faces. A fair coin is flipped once. If it lands on heads,
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
(D1.1) 1. (3p) Bestäm ekvationer i ett xyz-koordinatsystem för planet som innehåller punkterna
Högsolan i Sövde (SK) Tentamen i matemati Kurs: MA4G Linjär algebra MAG Linjär algebra för ingenjörer Tentamensdag: 4-8-6 l 4.-9. Hjälpmedel : Inga hjälpmedel utöver bifogat formelblad. Ej ränedosa. Tentamen
Lösenordsportalen Hosted by UNIT4 For instructions in English, see further down in this document
Lösenordsportalen Hosted by UNIT4 For instructions in English, see further down in this document Användarhandledning inloggning Logga in Gå till denna webbsida för att logga in: http://csportal.u4a.se/
Studieteknik för universitetet 2. Books in English and annat på svenska
Studieteknik för universitetet 2 Books in English and annat på svenska Inte bara svenska till engelska Vardagsspråk till akademiskt språk Böcker på engelska. Lektioner, diskussioner och tentor på svenska.
Problem som kan uppkomma vid registrering av ansökan
Problem som kan uppkomma vid registrering av ansökan Om du har problem med din ansökan och inte kommer vidare kan det bero på det som anges nedan - kolla gärna igenom detta i första hand. Problem vid registrering
Att stödja starka elever genom kreativ matte.
Att stödja starka elever genom kreativ matte. Ett samverkansprojekt mellan Örebro universitet och Örebro kommun på gymnasienivå Fil. dr Maike Schindler, universitetslektor i matematikdidaktik maike.schindler@oru.se
DVG C01 TENTAMEN I PROGRAMSPRÅK PROGRAMMING LANGUAGES EXAMINATION :15-13: 15
DVG C01 TENTAMEN I PROGRAMSPRÅK PROGRAMMING LANGUAGES EXAMINATION 120607 08:15-13: 15 Ansvarig Lärare: Donald F. Ross Hjälpmedel: Bilaga A: BNF-definition En ordbok: studentenshemspråk engelska Betygsgräns:
English. Things to remember
English Things to remember Essay Kolla instruktionerna noggrant! Gå tillbaka och läs igenom igen och kolla att allt är med. + Håll dig till ämnet! Vem riktar ni er till? Var ska den publiceras? Vad är
EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09
EXTENAL ASSESSENT SAPLE TASKS SWEDISH BEAKTHOUGH LSPSWEB/0Y09 Asset Languages External Assessment Sample Tasks Breakthrough Stage Listening and eading Swedish Contents Page Introduction 2 Listening Sample
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 17 August 2015, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 17 August 2015, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 2234765). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
Kursplan. EN1088 Engelsk språkdidaktik. 7,5 högskolepoäng, Grundnivå 1. English Language Learning and Teaching
Kursplan EN1088 Engelsk språkdidaktik 7,5 högskolepoäng, Grundnivå 1 English Language Learning and Teaching 7.5 Higher Education Credits *), First Cycle Level 1 Mål Efter genomgången kurs ska studenten
6. a) Visa att följande vektorer är egenvektorer till matrisen A = 0 2 0 0 0 0 1 1, och ange motsvarande
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA5 Vektoralgebra TEN2 Datum: juni 25 Skrivtid: 3
Kursplan. MT1051 3D CAD Grundläggande. 7,5 högskolepoäng, Grundnivå 1. 3D-CAD Basic Course
Kursplan MT1051 3D CAD Grundläggande 7,5 högskolepoäng, Grundnivå 1 3D-CAD Basic Course 7.5 Higher Education Credits *), First Cycle Level 1 Mål Studenten ska efter avslutad kurs ha inhämtat grunderna
Matthew Thurley Industriell bildanalys (E0005E) Response rate = 65 %
Matthew Thurley Industriell bildanalys (E000E) Response rate = % Survey Results Legend Relative Frequencies of answers Std. Dev. Mean Question text Left pole % % Right pole n=no. of responses av.=mean
Tentamen i Matematik 2: M0030M.
Tentamen i Matematik 2: M0030M. Datum: 203-0-5 Skrivtid: 09:00 4:00 Antal uppgifter: 2 ( 30 poäng ). Examinator: Norbert Euler Tel: 0920-492878 Tillåtna hjälpmedel: Inga Betygsgränser: 4p 9p = 3; 20p 24p
Hur fattar samhället beslut när forskarna är oeniga?
Hur fattar samhället beslut när forskarna är oeniga? Martin Peterson m.peterson@tue.nl www.martinpeterson.org Oenighet om vad? 1.Hårda vetenskapliga fakta? ( X observerades vid tid t ) 1.Den vetenskapliga
Flervariabel Analys för Civilingenjörsutbildning i datateknik
Flervariabel Analys för Civilingenjörsutbildning i datateknik Henrik Shahgholian KTH Royal Inst. of Tech. 2 / 9 Utbildningens mål Gällande matematik: Visa grundliga kunskaper i matematik. Härmed förstås
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Exempel på uppgifter från 2010, 2011 och 2012 års ämnesprov i matematik för årskurs 3. Engelsk version
Exempel på uppgifter från 2010, 2011 och 2012 års ämnesprov i matematik för årskurs 3 Engelsk version 2 Innehåll Inledning... 5 Written methods... 7 Mental arithmetic, multiplication and division... 9
Provlektion Just Stuff B Textbook Just Stuff B Workbook
Provlektion Just Stuff B Textbook Just Stuff B Workbook Genomförande I provlektionen får ni arbeta med ett avsnitt ur kapitlet Hobbies - The Rehearsal. Det handlar om några elever som skall sätta upp Romeo
- den bredaste guiden om Mallorca på svenska! -
- den bredaste guiden om Mallorca på svenska! - Driver du företag, har en affärsrörelse på Mallorca eller relaterad till Mallorca och vill nå ut till våra läsare? Då har du möjlighet att annonsera på Mallorcaguide.se
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Calculate check digits according to the modulus-11 method
2016-12-01 Beräkning av kontrollsiffra 11-modulen Calculate check digits according to the modulus-11 method Postadress: 105 19 Stockholm Besöksadress: Palmfeltsvägen 5 www.bankgirot.se Bankgironr: 160-9908
BÄNKVÅG / BENCH SCALE Modell : SW-III / Model : SW-III ANVÄNDARMANUAL / USER MANUAL SW-III WWW.LIDEN-WEIGHING.SE 2014-03-26 OBS! Under vågen sitter en justerbar skruv (se bild). Standardinställning är
State Examinations Commission
State Examinations Commission Marking schemes published by the State Examinations Commission are not intended to be standalone documents. They are an essential resource for examiners who receive training
Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen
Examensarbete Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen Malin Carlström, Sandra Mårtensson 2010-05-21 Ämne: Informationslogistik Nivå: Kandidat Kurskod: 2IL00E Projektmodell
EVALUATION OF ADVANCED BIOSTATISTICS COURSE, part I
UMEÅ UNIVERSITY Faculty of Medicine Spring 2012 EVALUATION OF ADVANCED BIOSTATISTICS COURSE, part I 1) Name of the course: Logistic regression 2) What is your postgraduate subject? Tidig reumatoid artrit
LUNDS TEKNISKA HÖGSKOLA Inst. for Elektro- och Informationsteknik. SIGNALBEHANDLING I MULTIMEDIA, ETI265 Inlämningsuppgift 1 (av 2), Task 1 (out of 2)
LUNDS TEKNISKA HÖGSKOLA Inst. for Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, ETI65 Inlämningsuppgift (av ), Task (out of ) Inlämningstid: Inlämnas senast kl 7. fredagen den 5:e maj
Kurskod: TAMS11 Provkod: TENB 28 August 2014, 08:00-12:00. English Version
Kurskod: TAMS11 Provkod: TENB 28 August 2014, 08:00-12:00 Examinator/Examiner: Xiangfeng Yang (Tel: 070 2234765) a. You are permitted to bring: a calculator; formel -och tabellsamling i matematisk statistik
VAD SKULLE DU HA VALT PDF
VAD SKULLE DU HA VALT PDF ==> Download: VAD SKULLE DU HA VALT PDF VAD SKULLE DU HA VALT PDF - Are you searching for Vad Skulle Du Ha Valt Books? Now, you will be happy that at this time Vad Skulle Du Ha
OPPOSITION FOR MASTER S PROJECT
Kerstin Frenckner, tel 08 790 9754, e-mail:. kfrenck@csc.kth.se2 February 12, 2009 Copyright CSC, KTH OPPOSITION FOR MASTER S PROJECT The duties of an opponent are to: Critically review the report in question
Schenker Privpak AB Telefon VAT Nr. SE Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr Säte: Borås
Schenker Privpak AB Interface documentation for web service packageservices.asmx 2012-09-01 Version: 1.0.0 Doc. no.: I04304b Sida 2 av 7 Revision history Datum Version Sign. Kommentar 2012-09-01 1.0.0
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Windlass Control Panel v1.0.1
SIDE-POWER Windlass Systems 86-08950 Windlass Control Panel v1.0.1 EN Installation manual Behåll denna manual ombord! S Installations manual SLEIPNER AB Kilegatan 1 452 33 Strömstad Sverige Tel: +46 525
Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:
Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock
FANNY AHLFORS AUTHORIZED ACCOUNTING CONSULTANT,
FANNY AHLFORS AUTHORIZED ACCOUNTING CONSULTANT, SWEDEN HOW TO CREATE BLOG CONTENT www.pwc.se How to create blog content Fanny Ahlfors Authorized Accounting Consultant 5 Inbound Methodology Attract Convert
Course evaluation SMD098, Lp2 2001
Course evaluation SMD098, Lp2 2001 My own comments I am not fully satisfied with how the course turned out. My biggest mistake is that I assumed that the students knew more about digital design than they
TFYA41-Thin Film Physics /Tunnfilmsfysik/
1 (5) TFYA41-Thin Film Physics /Tunnfilmsfysik/ Sändlista Håkan Örman Torun Berlind Elin Önstorp Sandra Gustavsson Kostas Sarakinos Magnus Johansson Kurskod TFYA41 Examinator Kostas Sarakinos Kursen gavs
Evaluation Ny Nordisk Mat II Appendix 1. Questionnaire evaluation Ny Nordisk Mat II
Evaluation Ny Nordisk Mat II Appendix 1. Questionnaire evaluation Ny Nordisk Mat II English version A. About the Program in General We will now ask some questions about your relationship to the program
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
Självkörande bilar. Alvin Karlsson TE14A 9/3-2015
Självkörande bilar Alvin Karlsson TE14A 9/3-2015 Abstract This report is about driverless cars and if they would make the traffic safer in the future. Google is currently working on their driverless car
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation
Questionnaire for visa applicants Appendix A
Questionnaire for visa applicants Appendix A Business Conference visit 1 Personal particulars Surname Date of birth (yr, mth, day) Given names (in full) 2 Your stay in Sweden A. Who took the initiative
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM
Rastercell Digital Rastrering Hybridraster, Rastervinkel, Rotation av digitala bilder, AM/FM rastrering Sasan Gooran (VT 2007) Önskat mått * 2* rastertätheten = inläsningsupplösning originalets mått 2
Kursplan. NA3009 Ekonomi och ledarskap. 7,5 högskolepoäng, Avancerad nivå 1. Economics of Leadership
Kursplan NA3009 Ekonomi och ledarskap 7,5 högskolepoäng, Avancerad nivå 1 Economics of Leadership 7.5 Higher Education Credits *), Second Cycle Level 1 Mål Studenterna skall efter genomgången kurs: kunna
Support for Artist Residencies
1. Basic information 1.1. Name of the Artist-in-Residence centre 0/100 1.2. Name of the Residency Programme (if any) 0/100 1.3. Give a short description in English of the activities that the support is
Solutions to exam in SF1811 Optimization, June 3, 2014
Solutions to exam in SF1811 Optimization, June 3, 14 1.(a) The considered problem may be modelled as a minimum-cost network flow problem with six nodes F1, F, K1, K, K3, K4, here called 1,,3,4,5,6, and
E: 9p D: 10p C: 14p B: 18p A: 22p
MID SWEDEN UNIVERSITY DMA Examination 2017 MA095G & MA098G Discrete Mathematics (English) Time: 5 hours Date: 16 March 2017 Pia Heidtmann The compulsory part of this examination consists of 8 questions.
#minlandsbygd. Landsbygden lever på Instagram. Kul bild! I keep chickens too. They re brilliant.
#minlandsbygd Kul bild! I keep chickens too. They re brilliant. Så vacka bilder. Ha det bra idag. @psutherland6 Thanks Pat! Yes the sun was going down... Hahahaha. Gilla Kommentera Landsbygden lever på
This is England. 1. Describe your first impression of Shaun! What kind of person is he? Why is he lonely and bullied?
This is England 1. Describe your first impression of Shaun! What kind of person is he? Why is he lonely and bullied? 2. Is Combo s speech credible, do you understand why Shaun wants to stay with Combo?
UTLYSNING AV UTBYTESPLATSER VT12 inom universitetsövergripande avtal
UTLYSNING AV UTBYTESPLATSER VT12 inom universitetsövergripande avtal Sista ansökningsdag: 2011-05-18 Ansökan skickas till: Birgitta Rorsman/Kjell Malmgren Studentavdelningen Box 100 405 30 Göteborg Eller
Blueprint Den här planeringen skapades med Blueprints gratisversion - vänligen uppgradera nu. Engelska, La06 - Kursöversikt, 2015/2016.
Blueprint Den här planeringen skapades med Blueprints gratisversion - vänligen uppgradera nu Engelska, La06 - Kursöversikt, 2015/2016 v.6-12 Book Project During this project you will be reading English
SVENSK STANDARD SS :2010
SVENSK STANDARD SS 8760009:2010 Fastställd/Approved: 2010-03-22 Publicerad/Published: 2010-04-27 Utgåva/Edition: 2 Språk/Language: svenska/swedish ICS: 11.140 Sjukvårdstextil Sortering av undertrikå vid
Kursplan. FR1050 Franska: Skriftlig språkfärdighet I. 7,5 högskolepoäng, Grundnivå 1. French Written Proficiency I
Kursplan FR1050 Franska: Skriftlig språkfärdighet I 7,5 högskolepoäng, Grundnivå 1 French Written Proficiency I 7.5 Higher Education Credits *), First Cycle Level 1 Mål Kursen syftar till att utveckla