Role of interleukin-15 and interleukin-18 in the secretion of sil-6r and sgp130 by human neutrophils
|
|
- Rut Sandberg
- för 6 år sedan
- Visningar:
Transkript
1 Short Communication Mediators of Inflammation, 12(3), 179/183 (June 2003) BACKGROUND: Available data indicate that neutrophils (PMN) produce a wide range of cytokines with the potential to modulate immune response. Recent investigation have shown that interleukin (IL)-15 and IL-18 potentiated several functions of normal neutrophils. It has been reported that IL-18-induced cytokine production may be significantly enhanced by coincident addition of IL-15. Aims: In the present study we compared the effect of recombinant human (rh)il-15 and rhil-18 as well as effect of a rhil-15 and rhil-18 combination on the induction secretion of sil-6ra and sgp130 by human neutrophils. Methods: PMN were isolated from heparinized whole blood of healthy persons. The PMN were cultured for 18 h at 378C in a humidified incubator with 5% CO 2. rhil-15 and/or rhil-18 and lipopolysaccharide were tested to PMN stimulation. The culture supernatants of PMN were removed and examined for the presence of sil-6r and sgp130 by human enzyme-linked immunosorbent assay kits. Cytoplasmic protein fractions of PMN were analysed for the presence of sil-6r and sgp130 by western blotting using monoclonal antibodies capable of detecting these proteins. Cells were lysed and cytoplasmic proteins were electrophoresed on sodium dodecyl sulfate-polyacrylamide gel electrophoresis. The resolved proteins were transferred onto nitrocellulose and incubated with the primary monoclonal antibodies anti-sil-6r and anti-sgp130. The membranes were incubated at room temperature with alkaline phosphatase anti-mouse immunoglobulin G. Immunoreactive protein bans were visualized by an AP Conjugate Substrate Kit. Results and conclusion: The results of our investigation revealed that IL-15 alone, similarly to IL-18, has no significant ability for the regulation of both soluble IL-6 receptors, sil-6r and sgp130, released by human neutrophils. It is interesting to note that the secretion of sgp130 was changed after PMN stimulation with rhil-15 in the presence of rhil-18. The combination of rhil-15 and rhil-18 was shown to induce PMN to secretion relatively higher amounts of sgp130 compared with the stimulation of PMN with rhil-15 alone and rhil-18 alone. The results obtained suggest that IL-15 and IL-18, belonging to the inflammatory cytokines, through the regulation of sgp130 secretion must be also considered as antiinflammatory mediators that may influence the balance reactions mediated by the IL-6 cytokine family. Role of interleukin-15 and interleukin-18 in the secretion of sil-6r and sgp130 by human neutrophils E. Jablonska CA and M. Marcinczyk Department of Immunology, Medical University of Bialystok, Waszyngtona 15A, Bialystok, Poland CA Corresponding author Fax: / ewaj@amb.edu.pl Key words: Neutrophils, Soluble interleukin-6 receptor a, Soluble gp130, Interleukin-15, Interleukin-18 Introduction Interleukin (IL)-15 is a pleiotropic cytokine that shares the biological activities with of IL-2. IL-15 uses both b-chains and g-chains of the IL-2 receptor for binding and signalling. The IL-15 receptor (IL- 15R) complex also includes a specific a subunit (IL- 15Ra), distinct from the IL-2Ra chain. IL-15R is expressed on various cells of the immune response, including T cells and B cells, NK cells and, more recently, peripheral blood neutrophils. 1 4 IL-15 plays an important role in both innate and adaptive immunity. It stimulates antigen-driven T-cell proliferation, it has co-stimulatory activity for prolif- ISSN print/issn online/03/ Taylor & Francis Ltd DOI: /
2 E. Jablonska & M. Marcinczyk eration and immunoglobulin (Ig) production by B cells, and is an efficient activator of natural killer and lymphokine activated killer (LAK) cells. 2,4 Recent investigation have shown that IL-15 potentiated several functions of normal neutrophils (PMNs) involved in the innate immune response against invading pathogens. IL-15 was observed to enhance phagocytosis, nuclear factor-kb activation and IL-8 production, and to delay apoptosis of these cells. 4 6 Available data indicate that PMN produce a wide range of cytokines with potential to modulation of immune response. The induction of PMN can lead to the synthesis of cytokines such as IL-1, IL-3, IL-6, IL-8, IL-12, transforming growth factor-b1 interferon-a, granulocyte-colony stimulating factor, granulocyte / macrophage-colony stimulating factor (GM-CSF), tumor necrosis factor (TNF)-a, growth-related oncogene (Gro)a, macrophage inflammatory protein (MIP)-1a and MIP-1b. 4,7 It was also found that PMN, similar to the other immune cells, are able to produce naturally occuring proteins that regulate the activity of certain cytokines in biological fluids or in tissue culture supernatants. 7 PMNs have the ability to simultaneous release IL-6 and its regulators: soluble receptors, sil-6ra and sgp130, that control both local and systemic IL-6-mediated responses. 7,8 Because various stimuli are able to induce the cellular release of cytokines and their soluble receptors, it is of interest to examine the role of other inflammatory cytokines in the regulation of IL-6 regulatory protein production. Previous studies in our laboratory have established that IL-18 is a promising candidate for the enhanced secretion of IL-6 by human neutrophils but not for both soluble receptors of IL-6. 8 It is known that IL-18 does not act alone, but in combination with other cytokines, such as IL-12 and/or IL-15. Different combinations of IL-18, IL-12 and IL-15 induce distinct effects. For example, McInnes et al. reported that IL- 18-induced cytokine production may be significantly enhanced by coincident addition of IL In the present study we compared the effect of recombinant human (rh)il-15 and rhil-18 as well as synergistic effect of rhil-15 with rhil-18 on the induction secretion of sil-6ra and sgp130 by human neutrophils. Studies of the interrelations between these mediators may provide new data on the inflammatory network cytokine controlled by these cells. Materials and methods Neutrophils and peripheral blood mononuclear cells (PBMC) were isolated from heparinized (10 U/ml) whole blood of 15 healthy persons by Gradisol G gradient (1.115 g/ml). This method enables simultaneous separation of two highly purified leukocyte 180 Mediators of Inflammation Vol fractions: mononuclear cells containing 95% lymphocytes, and polymorphonuclear cells containing 94% PMN. The purity of isolated PMN and PBMC was determined by May /Grunewald /Giemsa staining. Cells were suspended in the culture medium (RPMI-1640, autologous serum, penicillin and streptomycin) to provide 5/10 6 cells/cm 3. The PMN were cultured in 96-well plates (Falcon) for 18 h at 378C in a humidified incubator with 5% CO 2 (Nuaire TM ). RhIL- 15 (50 ng/ml; R&D Systems, Minneapolis, USA) and/ or rhil-18 (50 ng/ml; R&D Systems) and LPS (50 ng/ ml; Sigma) were tested to stimulate secretion by PMN. After 18 h incubation, the culture supernatants of PMN were removed and examined for the presence of sil-6r and sgp130 by human ELISA kits (R&D Systems) obtained from BIOKOM. Cytoplasmic protein fractions of PMN and PBMC were analysed for the presence of sil-6r and sgp130 by western blotting using monoclonal antibodies capable of detecting these proteins, anti-sil-6r and anti-sgp130, respectively (R&D Systems, from BIO- KOM). Cells were lysed directly by sonication, and cytoplasmic proteins were electrophoresed on sodium dodecyl sulfate-polyacrylamide gel electrophoresis. The resolved proteins were transferred onto nitrocellulose and incubated with the primary monoclonal antibodies anti-sil-6r and anti-sgp130. The membranes were incubated at room temperature with alkaline phosphatase anti-mouse IgG. Immunoreactive protein bans were visualized by the AP Conjugate Substrate Kit. Results SIL-6Ra and sgp130 protein expression in human PMN and PBMC detected by western blot We used a specific monoclonal antibody directed against the intracellular forms of sil-6r and sgp130 for western blot in PMN and for comparison in PBMC. As shown in Fig. 1, the antibody in human unstimulated and LPS-stimulated PMN and PBMC identified bands of 110 and 55 kda, respectively, from each donor. Western blot analysis showed that the samples of unstimulated PMN and PBMC contained a 110 kda protein that was stained by an anti-sgp130 monoclonal antibody. These samples also contained a 55 kda protein stained by an anti-sil-6r monoclonal antibody. The LPS-stimulated PMN and PBMC expressed a little increased sil-6r protein in comparison with the unstimulated cell lines. In contrast, sgp130 expression in unstimulated and LPS-stimulated cells was on the same level. Comparison of sil- 6R and sgp130 bands indicated that the expression of sgp130 is more intensive than expression of sil-6r.
3 IL-15 and IL-18 in the secretion of sil-6r and sgp130 FIG. 1. Western blot analysis of sil-6r and sgp130 proteins expression in human PMN and PBMC cells. We showed detection of sil-6r and sgp130 proteins from human unstimulated (line A) and LPS-stimulated (line B), rhil-15-stimulated (line C), rhil- 18-stimulated (line D), and rhil-15/rhil-18-stimulated (line E) PMNs. Whole cell lysates were obtained from fresh PMN of healthy donors. One hundred micrograms of total proteins from PMN were loaded onto a 10% sodium dodecyl sulfate (SDS)- polyacrylamide gel electrophoresis and transferred to a nitrocellulose filter. The filter was incubated with 1:1000 dilution of respective antibody. Sizes of protein standards are given in kilodaltons. One representative western blot of a few independent experiments is shown. SIL-6Ra and sgp130 concentrations in the culture supernatants of PMN detected by enzyme-linked immunosorbent assay In the culture supernatants of unstimulated PMN we observed about 10 times more sgp130 than sil-6ra (23.8 ng/ml and 2.27 ng/ml, respectively). Similar to rhil-18, rhil-15 did not have a significant effect on the release of sil-6ra and sgp130. However, concentrations of both soluble molecules in the culture supernatants of rhil-15-stimulated PMN were non-significantly higher than those in the culture supernatants of rhil-18-stimulated PMN (Fig. 2). LPS stimulation led to a significant increase in the sil-6r secretion by PMN in comparison with unstimulated PMN. We did not observe that kind of relation in the case of sgp130 secretion by PMN (Fig. 2). Release of sil-6r by PMN stimulated with rhil-15 and rhil-18 together were in the levels of sil-6r in the culture of PMN stimulated with rhil-15 only. In contrast to sil-6r, secretion of sgp130 by PMN after stimulation with rhil-15 and rhil-18 together was higher than sgp130 secretion by PMN after stimulation with rhil-15 or rhil-18 alone. Discussion Results of our investigation revealed that IL-15, similarly to IL-18, has no important ability in the regulation of both soluble IL-6 receptors, sil-6r and sgp130, release by human neutrophils. The lack of effect of these cytokines on the sil-6r secretion appears to confirm data demonstrated by other authors who did not find a significant influence of most inflammatory cytokines on sil-6ra production. They demonstrated that IL-1b, IL-6, IL-4, IL-10 or TNF-a did not affect the sil-6r production. 10 We have found that LPS alone stimulated significantly greater amounts of sil-6ra than medium controls, rhil-15 alone, rhil-18 alone as well as the combination of rhil-15 and rhil-18. Similarly, the secretion of sgp130 was independent of the presence of LPS, rhil-15 or rhil-18. It is interesting to note that the secretion of sgp130 was changed after PMN stimulation with rhil-15 in the presence of rhil-18. The combination of rhil-15 and rhil-18 was shown to induce PMN to secretion relatively higher amounts of sgp130 compared with the stimulation of PMN with rhil-15 alone and rhil- 18 alone. Our results indicate that rhil-15 alone and rhil-18 alone, in the used concentrations, do not Mediators of Inflammation Vol
4 E. Jablonska & M. Marcinczyk FIG. 2. The concentrations of sil-6r and sgp130 in the culture supernatants of LPS-stimulated, rhil-15-stimulated and rhil-18- stimulated PMN. * Statistical difference with unstimulated cells (pb/0.05). provide signals sufficient to induce soluble IL-6 receptor release by human neutrophils. However, there are available data suggesting a significant role of IL-15 and IL-18 in regulatory function of PMN. 5,6 An important role for IL-18 in the stimulation of PMN activity was recently documented. It has been found that the capacity of PMN to release IL-1b, IL-6, IL-8 and TNF-a was enhanced by the presence of IL In our previous study we indicated that IL-18 is also a promising candidate for the enhanced secretion of IL-6 by human neutrophils. However, we have not found a significant effect of IL- 18 on the soluble IL-6 receptors. 12 Additionally, we investigated an effect of IL-15 on the simultaneous secretion of IL-1b and its soluble receptor type II (sil- 1RII) by human neutrophils from normal and tumour-bearing hosts. Our observations indicated that IL-15 induces IL-1b but not sil-1rii release by these cells Mediators of Inflammation Vol The observation indicating various actions of cytokine alone and of cytokine in combination with others are in agreement with reports of different authors. For instance, Fehniger et al. demonstrated that the optimal co-stimulatory monokine combination for GM-CSF production by human natural killer cells was IL-18 and IL A probable explanation for the synergistic effect of IL-18 with IL-15 on the secretion of sgp130 by PMN may be an influence of these cytokines on their specific membrane-bound receptor expression. A recent report characterizing IL-15R and IL-18R expression on PMN revealed that these cells constitutively express both IL-15R and IL-18R mrna and proteins. 5,11 It is possible that IL-15 and IL-18 synergize in inducing sgp130 production by PMN via induction of their membrane-bound receptor expression on PMN, IL-18R can be up-regulated by IL-15 and, conversely, IL-15R may be regulated by the
5 IL-15 and IL-18 in the secretion of sil-6r and sgp130 presence of IL-18. Further examinations involving estimation of membrane-bound receptor expression are needed to confirm of these suggestions. In conclusion, the results obtained revealed that IL- 15 and IL-18 belonging to the inflammatory cytokines, through the regulation of sgp130 secretion, should also be considered anti-inflammatory mediators that may influence the balance reactions mediated by the IL-6 cytokine family, involving also IL-11, leukemia inhibiting factor (LIF), oncostatin M (OSM), ciliary neurotrophic factor (CNTF) or cardiotrophin (CT)-1. However, the clinical studies involving inflammation and other pathological conditions may be helpful to explain an importance of these observations. References 1. Mori A, Suko M, Kaminuma O, et al. IL-15 promotes cytokine production of human T helper cells. J Immunol 1996; 156: 2400 / Nishimura H, Yajima T, Naiki Y, et al. Differential roles of interleukin 15 mrna isoforms generated by alternative splicing in immune responses in vivo. J Exp Med 2000; 191: 157/ Smith XG, Bolton EM, Ruchatz H, Wei X, Liew FY, Bradley JA. Selective blockade of IL-15 by soluble IL-15 receptor a-chain enhances cardiac allograft survival. J Immunol 2000; 165: 3444 / Cassatella MA. The production of cytokines by polymorphonuclear neutrophils. Immunol Today 1995; 16: 21/ Girard D, Paquet M-E, Paquin R, Beaulieu AD. Differential effects of interleukin-15 (IL-15) and IL-2 on human neutrophils: modulation of phagocytosis, cytoskeleton rearragament, gene expression, and apoptosis by IL-15. Blood 1996; 88: 3176 / McDonald PP, Russo MP, Ferrini S, Cassatella MA. Interleukin 15 (IL-15) induces NF-kB activation and IL-8 production in human neutrophils. Blood 1998; 92: 4828 / Jablonska E, Jablonski J, Holownia A. Role of neutrophils in release of some cytokines and their soluble receptors. Immunol Lett 1999; 70: 191 / Jablonska E, Jablonski J. Effect of IL-18 on the release of IL-6 and its soluble receptors: sil-6ra and sgp130 by human neutrophils. Immunol Invest 2002; 31: 159 / McInnes IB, Gracie JA, Leung BP, Wei X-Q, Liew FY. Interleukin 18: a pleiotropic participant in chronic inflammation. Immunol Today 2000; 21: 312 / Jones SA, Horiuchi S, Topley N, Yamamoto N, Fuller GA. The soluble interleukin 6 receptor: mechanisms of production and implications in disease. FASEB J 2001; 15: 43/ Leung BP, Culshaw S, Gracie JA, et al. A role for IL-18 in neutrophils activation. J Immunol 2001; 167: 2879 / Jablonska E, Izycka A, Jablonski J, Wawrusiewicz N, Piecuch J. Role of IL-18 in the secretion of IL-1b, sil-1rii, and IL-1Ra by human neutrophils. Immunol Invest 2001; 30: 221/ Jablonska E, Piotrowski L, Kiluk M, Jablonski J, Grabowska Z, Markiewicz W. Effect of IL-15 on the secretion of IL-1b, IL-1Ra and sil-1rii by PMN from cancer patients. Cytokine 2001; 16: 173/ Fehniger TA, Shah MH, Turner MJ, et al. Differential cytokine and chemokine gene expression by human NK cells following activation with IL-18 or IL-15 in combination with IL-12: implications for the innate immune response. J Immunol 1999; 162: 4511/4520. Received 18 February 2003 Accepted 27 March 2003 Mediators of Inflammation Vol
6 MEDIATORS of INFLAMMATION The Scientific World Journal Gastroenterology Research and Practice Diabetes Research International Endocrinology Immunology Research Disease Markers Submit your manuscripts at BioMed Research International PPAR Research Obesity Ophthalmology Evidence-Based Complementary and Alternative Medicine Stem Cells International Oncology Parkinson s Disease Computational and Mathematical Methods in Medicine AIDS Behavioural Neurology Research and Treatment Oxidative Medicine and Cellular Longevity
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation
Questionnaire on Nurses Feeling for Hospital Odors
J. Japan Association on Odor Environment Vol. -1 No. 0,**0 437 *, ** * * Questionnaire on Nurses Feeling for Hospital Odors Tomoyo ITAKURA*, **, Megumi MITSUDA*, Takuzo INAGAKI*,,/. + +-/ 13.+... + +,,
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET National Swedish parental studies using the same methodology have been performed in 1980, 2000, 2006 and 2011 (current study). In 1980 and 2000 the studies
SWESIAQ Swedish Chapter of International Society of Indoor Air Quality and Climate
Swedish Chapter of International Society of Indoor Air Quality and Climate Aneta Wierzbicka Swedish Chapter of International Society of Indoor Air Quality and Climate Independent and non-profit Swedish
Measuring child participation in immunization registries: two national surveys, 2001
Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
Health café. Self help groups. Learning café. Focus on support to people with chronic diseases and their families
Health café Resources Meeting places Live library Storytellers Self help groups Heart s house Volunteers Health coaches Learning café Recovery Health café project Focus on support to people with chronic
Pre exam I PATHOLOGY FOR MEDICAL STUDENTS
Pre exam I PATHOLOGY FOR MEDICAL STUDENTS 2003-11-04 Max 42 credit points Pass 27 credit points NAME:.. Good Luck! 1 Define metaplasia. Provide 3 clinical examples of common metaplastic changes. 4 p Vad
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Introduktion till vetenskaplig metodik. Johan Åberg
Introduktion till vetenskaplig metodik Johan Åberg Innehåll Forskarvärlden Viktiga begrepp Referenshantering Den vetenskapliga rapporten Vetenskaplig diskussion Forskarvärlden Forskare mäts i antal publikationer
KOL med primärvårdsperspektiv ERS 2014. Björn Ställberg Gagnef vårdcentral
KOL med primärvårdsperspektiv ERS 2014 Björn Ställberg Gagnef vårdcentral Nationella programrådet Astma och KOL Identifierade insatsområden Nationella programrådet Astma och KOLinsatsområden för KOL Diagnostik,
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
SUPPLEMENTARY FIGURE LEGENDS
SUPPLEMETARY FIGURE LEGEDS Supplementary Fig. 1. Flow cytometric analysis of wildtype, mutant and chimeric protein surface expression. Cells transduced with the individual constructs indicated were stained
Kristina Säfsten. Kristina Säfsten JTH
Att välja metod några riktlinjer Kristina Säfsten TD, Universitetslektor i produktionssystem Avdelningen för industriell organisation och produktion Tekniska högskolan i Jönköping (JTH) Det finns inte
Validering av kvalitetsregisterdata vad duger data till?
Validering av kvalitetsregisterdata vad duger data till? Anders Ekbom, Professor Karolinska Institutet Institutionen för medicin Solna Enheten för klinisk epidemiologi Karolinska Universitetssjukhuset
Inflammation och immunologi - vad en psykiater bör veta Susanne Bejerot, Daniel Eklund, Eva Hesselmark, Mats Humble
Inflammation och immunologi - vad en psykiater bör veta Susanne Bejerot,, Eva Hesselmark, Mats Humble Inflammation relevans för psykiatri Patienter ur flera psykiatriska sjukdomsgrupper uppvisar förhöjda
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
Aktivering av signalen via TCR involverar många steg som måste stämma:
Aktivering av signalen via TCR involverar många steg som måste stämma: 1) TCR-MHC kontakt 2) Protein Tyrosin kinaser fosforilerar 10 ITAMs på CD3 och speciellt ζ. 3) Protein tyrosin kinas ZAP-70 binder
Cancersmärta ett folkhälsoproblem?
Cancersmärta ett folkhälsoproblem? Åsa Assmundson Nordiska högskolan för folkhälsovetenskap Master of Public Health MPH 2005:31 Cancersmärta ett folkhälsoproblem? Nordiska högskolan för folkhälsovetenskap
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
District Application for Partnership
ESC Region Texas Regional Collaboratives in Math and Science District Application for Partnership 2013-2014 Applying for (check all that apply) Math Science District Name: District Contacts Name E-mail
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
The Finite Element Method, FHL064
The Finite Element Method, FHL064 Division of Solid Mechanics Course program, vt2, 20 Course description The finite element method (FEM) is a numerical method able to solve differential equations, i.e.
Tentamen 12/ Medicinsk Teknik Fördjupningskurs Implantat och biomaterial, 7E1112 (KTH), MTF003 (KI)
Tentamen 12/3 2003 0900-1300 Medicinsk Teknik Fördjupningskurs Implantat och biomaterial, 7E1112 (KTH), MTF003 (KI) You may answer in Swedish or English. Namn:... Personnummer:.. Poäng:... Betyg:... Rättat
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION SUPPLEMENTARY METHODS Preparation of the cells for transmission electron microscopy - Cells grown on coverslips were fixed for 45 minutes with 2.5% glutaraldehyde (50 mm cacodylate
Methods to increase work-related activities within the curricula. S Nyberg and Pr U Edlund KTH SoTL 2017
Methods to increase work-related activities within the curricula S Nyberg and Pr U Edlund KTH SoTL 2017 Aim of the project Increase Work-related Learning Inspire theachers Motivate students Understanding
Senaste trenderna från testforskningen: Passar de industrin? Robert Feldt,
Senaste trenderna från testforskningen: Passar de industrin? Robert Feldt, robert.feldt@bth.se Vad är på gång i forskningen? (ICST 2015 & 2016) Security testing Mutation testing GUI testing Model-based
SkillGuide. Bruksanvisning. Svenska
SkillGuide Bruksanvisning Svenska SkillGuide SkillGuide är en apparat utformad för att ge summativ återkoppling i realtid om hjärt- och lungräddning. www.laerdal.com Medföljande delar SkillGuide och bruksanvisning.
FaR-nätverk VC. 9 oktober
FaR-nätverk VC 9 oktober 13.30-16.00 Dagens träff Information från oss Material Nytt om FaR-mottagningarna Utbildningar hösten Ny forskning Presentation av flödesschema FaR-rutin på VC med fokus på uppföljning
Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance?
r Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance? - A pilot study Susan Sarwari and Mohammed Fazil Supervisors: Camilla Ahlgren Department of
(Aloe vera L.) Downloaded from jcb.sanru.ac.ir at 20: on Thursday October 24th Liliaceae
71... 1390 /7 / / (Aloe vera L.) 2 2 1..... (Aloe vera L.).... MS (2 ). P (1 ) I (0/25 ) -1-2 90/12/21 : 89/6/22 : IAA (0/1 ) (0/5 0/2 ) Kin (1-0/5 ). I (1 ) (1-0/2 ). 10/66 1/36 (2 ) + Kin (0/5 ) + (2
Materialplanering och styrning på grundnivå. 7,5 högskolepoäng
Materialplanering och styrning på grundnivå Provmoment: Ladokkod: Tentamen ges för: Skriftlig tentamen TI6612 Af3-Ma, Al3, Log3,IBE3 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Fysisk aktivitet och hjärnan
1 Fysisk aktivitet och hjärnan Professor Ingibjörg H. Jónsdóttir Hälsan och stressmedicin, VGR Institutionen för kost och idrottsvetenskap Göteborgs Universitet Kvinnlig simultankapacitet troligen en myt
EVALUATION OF ADVANCED BIOSTATISTICS COURSE, part I
UMEÅ UNIVERSITY Faculty of Medicine Spring 2012 EVALUATION OF ADVANCED BIOSTATISTICS COURSE, part I 1) Name of the course: Logistic regression 2) What is your postgraduate subject? Tidig reumatoid artrit
Syns du, finns du? Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap
Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap Syns du, finns du? - En studie över användningen av SEO, PPC och sociala medier som strategiska kommunikationsverktyg i svenska företag
Den framtida redovisningstillsynen
Den framtida redovisningstillsynen Lunchseminarium 6 mars 2015 Niclas Hellman Handelshögskolan i Stockholm 2015-03-06 1 Källa: Brown, P., Preiato, J., Tarca, A. (2014) Measuring country differences in
Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:
Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
UTLYSNING AV UTBYTESPLATSER VT12 inom universitetsövergripande avtal
UTLYSNING AV UTBYTESPLATSER VT12 inom universitetsövergripande avtal Sista ansökningsdag: 2011-05-18 Ansökan skickas till: Birgitta Rorsman/Kjell Malmgren Studentavdelningen Box 100 405 30 Göteborg Eller
Förändrade förväntningar
Förändrade förväntningar Deloitte Ca 200 000 medarbetare 150 länder 700 kontor Omsättning cirka 31,3 Mdr USD Spetskompetens av världsklass och djup lokal expertis för att hjälpa klienter med de insikter
Kursplan. JP1040 Japanska III: Språkfärdighet. 15 högskolepoäng, Grundnivå 1. Japanese III: Language Proficiency
Kursplan JP1040 Japanska III: Språkfärdighet 15 högskolepoäng, Grundnivå 1 Japanese III: Language Proficiency 15 Higher Education Credits *), First Cycle Level 1 Mål Efter avslutad kurs ska de studerande
Könsfördelningen inom kataraktkirurgin. Mats Lundström
Könsfördelningen inom kataraktkirurgin Mats Lundström Innehåll Fördelning av antal operationer utveckling Skillnader i väntetid Effekt av NIKE Skillnader i synskärpa före operation Skillnader i Catquest-9SF
Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands
Skill-mix innovation in the Netherlands dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands m.kroezen@erasmusmc.nl The skill-mix innovation of interest BEFORE AFTER How did the Netherlands
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Kursbok: The immune system Peter Parham. Kapitel 5 Hela skall läsas och kunnas utom: Kapitel 5.5; Fig. 5.9 Kapitel 5.11 och 5.12
T-cellsutveckling. Kursbok: The immune system Peter Parham Kapitel 5 Hela skall läsas och kunnas utom: Kapitel 5.5; Fig. 5.9 Kapitel 5.11 och 5.12 Några viktiga punkter för att börja med: T celler: thymus
The cornerstone of Swedish disability policy is the principle that everyone is of equal value and has equal rights.
Swedish disability policy -service and care for people with funcional impairments The cornerstone of Swedish disability policy is the principle that everyone is of equal value and has equal rights. The
The Algerian Law of Association. Hotel Rivoli Casablanca October 22-23, 2009
The Algerian Law of Association Hotel Rivoli Casablanca October 22-23, 2009 Introduction WHY the Associations? NGO s are indispensable to the very survival of societal progress Local, National or International
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Klassificering av brister från internaudit
Klassificering av brister från internaudit Del-21G seminarium 2015 Jukka Salo Slou Klassificering av brister från internaudit Vid VK har det visat sig att Procedurer för klassificering av brister finns,
Att använda immunförsvaret vid behandling av cancer
Att använda immunförsvaret vid behandling av cancer Jonas Mattsson, M.D., Ph.D. Professor in Cell Therapy Center for Allogeneic Stem Cell Transplantation (CAST) Karolinska University Hospital 2 Immunologi
Consumer attitudes regarding durability and labelling
Consumer attitudes regarding durability and labelling 27 april 2017 Gardemoen Louise Ungerth Konsumentföreningen Stockholm/ The Stockholm Consumer Cooperative Society louise.u@konsumentforeningenstockholm.se
Assigning Ethical Weights to Clinical Signs Observed During Toxicity Testing
: Assigning Ethical Weights to Clinical Signs Observed During Toxicity Testing Supplementary Data Information (in Swedish) given to the test participants concerning the hypothetical experiment English
EXPERT SURVEY OF THE NEWS MEDIA
EXPERT SURVEY OF THE NEWS MEDIA THE SHORENSTEIN CENTER ON THE PRESS, POLITICS & PUBLIC POLICY JOHN F. KENNEDY SCHOOL OF GOVERNMENT, HARVARD UNIVERSITY, CAMBRIDGE, MA 0238 PIPPA_NORRIS@HARVARD.EDU. FAX:
Luftfartsavdelningen Sektionen för flygutbildning MANUALER VÄLKOMNA EN KORT SAMMANFATTNING AV INNEHÅLLET I RESPEKTIVE MANUAL
MANUALER VÄLKOMNA EN KORT SAMMANFATTNING AV INNEHÅLLET I RESPEKTIVE MANUAL 1 TRAINING MANUAL TM OPERATIONS MANUAL OM QUALITY MANUAL QM 2 TRAINING MANUAL AMC1 ORA.ATO.230 (a) PART 0 AMINISTRATION PART A
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
Bilaga 5 till rapport 1 (5)
Bilaga 5 till rapport 1 (5) EEG som stöd för diagnosen total hjärninfarkt hos barn yngre än två år en systematisk litteraturöversikt, rapport 290 (2018) Bilaga 5 Granskningsmallar Instruktion för granskning
Alias 1.0 Rollbaserad inloggning
Alias 1.0 Rollbaserad inloggning Alias 1.0 Rollbaserad inloggning Magnus Bergqvist Tekniskt Säljstöd Magnus.Bergqvist@msb.se 072-502 09 56 Alias 1.0 Rollbaserad inloggning Funktionen Förutsättningar Funktionen
Inkvarteringsstatistik. Göteborg & Co
Inkvarteringsstatistik Göteborg & Co Mars 2012 FoU/ Marknad & Försäljning Gästnätter storstadsregioner Mars 2012, hotell och vandrarhem Gästnattsutveckling storstadsregioner Mars 2012, hotell och vandrarhem
ASSESSMENT AND REMEDIATION FOR CHILDREN WITH SPECIAL EDUCATIONAL NEEDS:
ASSESSMENT AND REMEDIATION FOR CHILDREN WITH SPECIAL EDUCATIONAL NEEDS: THE ROLE OF WORKING MEMORY, COMPLEX EXECUTIVE FUNCTION AND METACOGNITIVE STRATEGY TRAINING Avdelningen för psykologi Mittuniversitetet
EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09
EXTENAL ASSESSENT SAPLE TASKS SWEDISH BEAKTHOUGH LSPSWEB/0Y09 Asset Languages External Assessment Sample Tasks Breakthrough Stage Listening and eading Swedish Contents Page Introduction 2 Listening Sample
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
The Arctic boundary layer
The Arctic boundary layer Interactions with the surface, and clouds, as learned from observations (and some modeling) Michael Tjernström Department of Meteorology & the Bert Bolin Center for Climate Research,
Teenage Brain Development
Teenage Brain Development In adults, various parts of the brain work together to evaluate choices, make decisions and act accordingly in each situation. The teenage brain doesn't appear to work like this.
Hur fattar samhället beslut när forskarna är oeniga?
Hur fattar samhället beslut när forskarna är oeniga? Martin Peterson m.peterson@tue.nl www.martinpeterson.org Oenighet om vad? 1.Hårda vetenskapliga fakta? ( X observerades vid tid t ) 1.Den vetenskapliga
REHAB BACKGROUND TO REMEMBER AND CONSIDER
Training in water REHAB BACKGROUND TO REMEMBER AND CONSIDER PHASE I: PROLIFERATION PROTECTION, 0-6 WEEKS PHASE II: TRANSITION PROGRESSION, 7-12 WEEKS PHASE III: REMODELLING FUNCTION, 13-32 WEEKS PHASE
Manhour analys EASA STI #17214
Manhour analys EASA STI #17214 Presentatör Johan Brunnberg, Flygteknisk Inspektör & Del-M Koordinator Sjö- och luftfartsavdelningen Operatörsenheten Sektionen för teknisk operation 1 Innehåll Anmärkningen
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
http://marvel.com/games/play/31/create_your_own_superhero http://www.heromachine.com/
Name: Year 9 w. 4-7 The leading comic book publisher, Marvel Comics, is starting a new comic, which it hopes will become as popular as its classics Spiderman, Superman and The Incredible Hulk. Your job
Om oss DET PERFEKTA KOMPLEMENTET THE PERFECT COMPLETION 04 EN BINZ ÄR PRECIS SÅ BRA SOM DU FÖRVÄNTAR DIG A BINZ IS JUST AS GOOD AS YOU THINK 05
Om oss Vi på Binz är glada att du är intresserad av vårt support-system för begravningsbilar. Sedan mer än 75 år tillverkar vi specialfordon i Lorch för de flesta olika användningsändamål, och detta enligt
TAKE A CLOSER LOOK AT COPAXONE (glatiramer acetate)
TAKE A CLOSER LOOK AT COPAXONE (glatiramer acetate) A TREATMENT WITH HIDDEN COMPLEXITY COPAXONE is a complex mixture of several million distinct polypeptides. 2 State-of-the-art analytics cannot distinguish
Immunteknologi, en introduktion. Hur man använder antikroppar för att mäta eller detektera biologiska händelser.
Immunteknologi, en introduktion Hur man använder antikroppar för att mäta eller detektera biologiska händelser. Antikroppar genereras av b-lymphocyter, som är en del av de vita blodkropparna Varje ursprunglig
Conversational Pedagogical Agents and Gender Annika Silvervarg, Agneta Gulz, Magnus Haake Linköping and Lund University
Forskningsmetoder Utveckling av pedagogisk programvara Empiriska undersökningar i skolor Enkäter Intervjuer Observationer Beteendeloggar Dialogloggar Teorier om lärande och teknikanvändingi pedagogiska
Maria Fransson. Handledare: Daniel Jönsson, Odont. Dr
Klassificering av allvarlig kronisk parodontit: En jämförelse av fem olika klassificeringar utifrån prevalensen av allvarlig kronisk parodontit i en population från Kalmar län Maria Fransson Handledare:
KPMG Stockholm, 2 juni 2016
KPMG Stockholm, 2 juni 2016 Inställningen till skatt förändras fundamentalt ses inte längre bara som en kostnad som behöver hanteras Förväntningarna på transparens kring skatt ökar Skatt framförallt rättviseaspekter
Studenters erfarenheter av våld en studie om sambandet mellan erfarenheter av våld under uppväxten och i den vuxna relationen
Studenters erfarenheter av våld en studie om sambandet mellan erfarenheter av våld under uppväxten och i den vuxna relationen Silva Bolu, Roxana Espinoza, Sandra Lindqvist Handledare Christian Kullberg
Dokumentnamn Order and safety regulations for Hässleholms Kretsloppscenter. Godkänd/ansvarig Gunilla Holmberg. Kretsloppscenter
1(5) The speed through the entire area is 30 km/h, unless otherwise indicated. Beware of crossing vehicles! Traffic signs, guardrails and exclusions shall be observed and followed. Smoking is prohibited
Sara Skärhem Martin Jansson Dalarna Science Park
Sara Skärhem Martin Jansson Dalarna Science Park Sara Skärhem Martin Jansson Vad är innovation? På Wikipedia hittar man: En innovation är en ny idé, till exempel i form av en produkt, lösning, affärsidé,
Item 6 - Resolution for preferential rights issue.
Item 6 - Resolution for preferential rights issue. The board of directors in Tobii AB (publ), reg. no. 556613-9654, (the Company ) has on November 5, 2016, resolved to issue shares in the Company, subject
6 th Grade English October 6-10, 2014
6 th Grade English October 6-10, 2014 Understand the content and structure of a short story. Imagine an important event or challenge in the future. Plan, draft, revise and edit a short story. Writing Focus
Introduktion till vetenskaplig metodik. Johan Åberg
Introduktion till vetenskaplig metodik Johan Åberg Innehåll Forskarvärlden Viktiga begrepp Referenshantering Den vetenskapliga rapporten Vetenskaplig diskussion Forskarvärlden Forskare mäts i antal publikationer
Signatursida följer/signature page follows
Styrelsens i Flexenclosure AB (publ) redogörelse enligt 13 kap. 6 och 14 kap. 8 aktiebolagslagen över förslaget till beslut om ökning av aktiekapitalet genom emission av aktier och emission av teckningsoptioner
EASA Standardiseringsrapport 2014
EASA Standardiseringsrapport 2014 Inför EASA Standardiseringsinspektion hösten 2016 Presentatör Johan Brunnberg, Flygteknisk Inspektör & Del-M Koordinator Sjö- och luftfartsavdelningen Enheten för operatörer,
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
PORTSECURITY IN SÖLVESBORG
PORTSECURITY IN SÖLVESBORG Kontaktlista i skyddsfrågor / List of contacts in security matters Skyddschef/PFSO Tord Berg Phone: +46 456 422 44. Mobile: +46 705 82 32 11 Fax: +46 456 104 37. E-mail: tord.berg@sbgport.com
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
Användarhandbok. MHL to HDMI Adapter IM750
Användarhandbok MHL to HDMI Adapter IM750 Innehåll Inledning...3 MHL to HDMI Adapter-översikt...3 Komma igång...4 Smart Connect...4 Uppgradera Smart Connect...4 Använda MHL to HDMI Adapter...5 Ansluta
D-RAIL AB. All Rights Reserved.
2 3 4 5 6 Photo: Svante Fält 7 8 9 ägare ägare /förvaltare huvudman mätning operatör DATA underhållare underhållare 9 The hardware 10 SENSORS: Cutting edge technology designed for minimum maintenance and
Typografi, text & designperspektiv
Typografi, text & designperspektiv Serif Hårstreck Stapel Heplx x-höjd Baslinje Grundstreck Serif Underhäng Inre form I dag Lite bakgrund Övergripande grunder inom typografi Text hantering Elva Synlig
Komponenter Removed Serviceable
Komponenter Removed Serviceable Presentatör Jonas Gränge, Flygteknisk Inspektör Sjö- och luftfartsavdelningen Fartygs- och luftfartygsenheten Sektionen för Underhållsorganisationer 1 145.A.50(d): När en
Cytotoxicitet och blodsjukdomar
Cytotoxicitet och blodsjukdomar DAPI Perforin Actin From Stephanie Wood Hemofagocyterande Lymfohistiocytos (HLH) Okontrollerad hyperinflammation på basen av olika ärftliga eller förvärvade störningar i
Make a speech. How to make the perfect speech. söndag 6 oktober 13
Make a speech How to make the perfect speech FOPPA FOPPA Finding FOPPA Finding Organizing FOPPA Finding Organizing Phrasing FOPPA Finding Organizing Phrasing Preparing FOPPA Finding Organizing Phrasing
Love og regler i Sverige Richard Harlid Narkos- och Intensivvårdsläkare Aleris FysiologLab Stockholm
Love og regler i Sverige Richard Harlid Narkos- och Intensivvårdsläkare Aleris FysiologLab Stockholm Driving in the USA Driving is the lifeblood of the United States. It fosters commerce, recreation and
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik Kurs: MA152G Matematisk Analys MA123G Matematisk analys för ingenjörer Tentamensdag: 2012-03-24 kl 14.30-19.30 Hjälpmedel : Inga hjälpmedel
The Swedish National Patient Overview (NPO)
The Swedish National Patient Overview (NPO) Background and status 2009 Tieto Corporation Christer Bergh Manager of Healthcare Sweden Tieto, Healthcare & Welfare christer.bergh@tieto.com Agenda Background
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
SVENSK STANDARD SS :2010
SVENSK STANDARD SS 8760009:2010 Fastställd/Approved: 2010-03-22 Publicerad/Published: 2010-04-27 Utgåva/Edition: 2 Språk/Language: svenska/swedish ICS: 11.140 Sjukvårdstextil Sortering av undertrikå vid
Kursplan. AB1029 Introduktion till Professionell kommunikation - mer än bara samtal. 7,5 högskolepoäng, Grundnivå 1
Kursplan AB1029 Introduktion till Professionell kommunikation - mer än bara samtal 7,5 högskolepoäng, Grundnivå 1 Introduction to Professional Communication - more than just conversation 7.5 Higher Education