Tentamen i Immunteknologi 29 maj 2006, 8-13

Save this PDF as:
 WORD  PNG  TXT  JPG

Storlek: px
Starta visningen från sidan:

Download "Tentamen i Immunteknologi 29 maj 2006, 8-13"

Transkript

1 Tentamen i Immunteknologi 29 maj 2006, Varje fråga ger maximalt 5 p, totalt 10 frågor. 2 SKRIV NAMN OCH PERSONNUMMER PÅ ALLA SIDOR! (inklusive tentamensomslaget) 3 Använd ett NYTT papper för varje fråga! 4 Glöm inte att fylla i och lämna in KURSUTVÄRDERINGEN! (2 separata blad)

2 Tentamen i Immunteknologi 29 maj 2006, 8-13 Varje fråga ger maximalt 5 p. (<25 p = underkänd, >25p = godkänd) OBS! Använd ett nytt papper för varje fråga OBS! SKRIV NAMN OCH PERSONNUMMER PÅ ALLA SIDOR! (inklusive tentamensomslaget) Glöm inte att lämna in KURSUTVÄRDERINGEN! (2 papper) FRÅGA 1 Vårt immunförsvar innefattar både molekyler, celler och organ. A) Ge exempel på både centrala och perifera/sekundära lymfoida organ? (2p) B) Vilket/vilka lymfoida organ bekämpar blodburna infektioner? (1p) C) Ge exempel på 3 olika granulocyter och deras funktion i immunförsvaret? (2p) FRÅGA 2 En av de viktigaste egenskaperna hos komponenterna i vårt immunförsvar är att specifikt kunna känna igen ett visst ämne A) Beskriv hur immunförsvaret gör för att skapa MHC klass I och MHC klass II molekyler med alla de specificiteter som behövs? (2p) B) Motivera kort varför det behövs både MHC klass I och klass II molekyler? (1p) C) Förklara kortfattat varför just MHC molekylen är viktig vid transplantation? (1p) FRÅGA 3 T cellen har en central och viktig roll i immunförsvaret. A) T cellen bildas i benmärgen, men var mognar den? (0.5p) B) Vilka möjligheter har en CD4-positiv respektive CD8-positiv T cell för att se till att B celler producerar antikroppar mot ett visst främmande antigen? (1.5p) C) T celler kan bidra med immunologiskt minne. Vad är det? (1p) D) När blir en T cell anergisk och vad fyller detta för funktion i immunförsvaret? (2p) FRÅGA 4 Du sitter med i panelen Fråga Lund i egenskap av din expertis inom området antikroppar och immunologi. Av moderatorn får du följande frågor och påstående att klargöra; A) Termerna immunogen och antigen missförstås ofta. Förklara vad de betyder så att skillnaden i innebörd blir tydlig. (1p) B) Ett kännetecken för antikroppar är att de sägs vara specifika, men trots detta sägs de kunna uppvisa korsreaktivitet. Vad betyder / innebär denna korsreaktivitet? (1p) C) När väl antikropparna har bundit till det främmande ämnet som initierade immunsvaret så kan antikroppar utöva sina effektorfunktioner med målet att eliminera det bildade immunkomplexet. Beskriv tre effektorfunktioner som antikroppar kan utöva samt beskriv den strukturella basen för varför olika antikroppar kan utöva olika effektorfunktioner (2p) D) HAMA är en term som ofta hörs i sammanhang med antikroppar. Förklara vad termen betyder (1p).

3 FRÅGA 5 Du har nyligen varit ute och rest i obebodda marker. När du kommer hem så insjuknar du och din personliga läkare säger att du har drabbats av en virusinfektion. A) Beskriv kortfatta hur det medfödda immunförsvaret gör för att hjälpa dig att slå ut viruset. (2p) B) Viruset uttrycker ett protein, V-33, på ytan. V-33 har en immunodominant epitop som endast visas upp på en viss MHC-I molekyl. Vad innebär detta för immunförsvarets möjligheter att bekämpa viruset? Motivera ditt svar. (2p) C) Du har även infekterats av ett bakterie antigen. Din läkare ska nu på ett enkelt ta reda på om det är första gången du har infekterats av bakterien, eller om du redan har utsatts för det flera gånger. Beskriv en enkel analys man skulle kunna utföra för att ge svar på läkarens fråga. (1p) FRÅGA 6 Du är specialist på antikroppar och arbetar som gruppledare på bioteknik företaget AbFix. En av dina kollegor har precis genererat en grupp av hybridom, 2 stycken IgM och 2 stycken IgA. Antikropparna, specifika för antigenet AG-13, är baserade på samma ursprungliga variabla gen, men använder olika D och J gener. A) Din kollega har nu sekvenserat en del av den tunga kedjans variable region (figure 1). Ange vilka av sekvenserna som är dina 2 IgM hybridom respektive 2 IgA hybridom och motivera varför. (2p) 1 ASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKRHY TYDYWGQGT 2...GHWYTS----SSVMSV DG...S...H...T...GDHK------WVF V...V...G...ALLRY----GYGF.V... ***************** Figur 1. Sekvenser av den tunga kedjans variabelregion hos de 4 hybridomen. CDR3 (den tredje hypervariable regionen) är utmärkt med stjärnor. Aminosyrorna uttrycks i form av den standardiserade enbokstavskoden. I de fall aminosyran är identisk med den som finns på översta raden illustreras detta med en punkt. Om en aminosyra inte finns så indikeras detta med ett streck. B) Din kollega har även immobiliserat ett IgM respektive ett IgA hybridom på ett biacore chip. När du flödar samma antigen, AG-13, över ytorna så erhåller du följande två kromatogram (Figure 2). Vilket kromatogram hör rimligen till vilket hybridom och varför är det så? (2p) A B Figur 2. Sensorgram från Biacorekörningar. Uppåtriktad pil avser tillfället när injektionen av komponenten i den lösliga fasen påbörjas och nedåtriktad pil avser när denna injektion upphör och enbart buffert flödar i systemet. C) Beskriv kortfattad en annan teknik som du skulle kunna använda för att studera affiniteten hos en antikropp. (1p)

4 FRÅGA 7 Du arbetar som forskningschef på ABbiotech. Du är nu ansvarig för att designa två antikroppsbaserade analysmetoder for att kunna detektera och kvantifiera två nya, farliga antigen, AG1 och AG2. AG1 är en mycket liten molekyl medan AG2 är ett mycket stort protein. A) Beskriv kortfattad för hur du skulle kunna generera specifika antikroppar mot AG1 respektive AG2. Du måste välja två olika metoder, en för varje antigen. (2p) B) Du funderar på att sätta upp kompetitiva och/eller non-kompetitiva analysmetoder för att kvantifiera antigenen. Beskriv kortfattat den principiella basen för dessa metoder och motivera vilken metod du skulle kunna använda för respektive antigen (förutsättningen är sådana att du har fri tillgång till de reagenser som du själv anger). (2p) C) Vidare så får du i uppdrag att framställa ett vaccin mot AG2. Vad är ett vaccin? (1p) FRÅGA 8 En ny farlig sjukdom håller på att sprida sig på den europeiska kontinenten. Forskare har identifierat antigenet, SARS, och du har precis lyckats tillverka antikroppar mot antigenet, dels efter immunisering av getter dels genom att etablera ett IgG-producerande hybridom efter immunisering av möss. A) Din kollega Olle har gjutit in den monoklonala IgG antikroppen i en gel för att köra raketimmunelektrofores. Eftersom han inte får några precipitat (raketer) trots att han har provat en stor mängd olika koncentrationer av både mängden ingjuten antikropp och mängden antigen så kommer han till för att få hjälp med att tolka data. Vilken är den mest troliga förklaringen till den misslyckade analysen och vad rekommenderar du att han skall testa för att få precipitat i denna typ av test? (2p) B) Du ska nu utvärdera den terapeutiska potentialen hos den framställda mus IgG antikroppen. Beskriv kortfattat två vägar som du kan gå för att omvandla din mus antikropp till en human antikropp. (2p) C) Antikroppar kan ibland vara inblandade i ett fenomen som heter ADCC. Vad är det? (1p) FRÅGA 9 Födescytometri är en vanligt förekommande teknik som används för att analysera celler. A) Vilken typ av kunskap om cellerna i ett prov kan man få ut av en flödescytometri analys (ge 4 exempel)? (2p) B) Du har tillgång till 3 antikroppar. Ab-1 är specifik för en markör på cancer celler, ab-2 är specifik för en markör på friska celler, medan ab-3 är specifik för en markör som finns på båda cell typerna. Du analyserar nu antikropparna reaktivitet mha FACS analys. Hur kommer dina FACS data att se ut? (tips använd diagrammen nedan för att visa tänkbara FACS data kan se ut) (3p) Friska celler uts la g Negativ Ab-1 Ab-2 Ab-3 kontroll Cancer celler uts la g Negativ Ab-1 Ab-2 Ab-3 kontroll [bunden ab] [bunden ab] [bunden ab] [bunden ab]

5 Fråga 10 Allergi är en vanlig sjukdom i Sverige idag som i någon form drabbar upp till 30% av befolkningen. Det är därför viktigt att förstå vilka immunologiska processer som ligger bakom de allergiska symptomen, för att kunna hitta passande terapeutiska angreppssätt. A) Vilken antikropps isotyp är speciellt viktiga vid allergi och vilken roll spelar dessa antikroppar? (1p) B) Man försöker numera använda sig av vaccinering för att behandla allergi. Hur är det tänkt att denna vaccinering ska skydda mot allergi? (2p) C) Namnge två effektorceller som är involverade vi en allergisk immunoreaktion samt minst en aktiv substans var som de producerar och som ger symtomen. (2p) Lycka till!

6 Minneslista: Christer kommer och svarar på eventuella frågor under tentan. Tentamen äger rum i Eden 26 (bakom Gamla Kirurgen) måndagen den 29 maj kl Ingen akademisk kvart. Ta med tejp och en lapp för att markera på dörren vilken verksamhet som äger rum där. Lägg före tentans början ut tentamensomslag och papper (minst 10/student) på de bänkar där eleverna (ca 25) skall sitta. Ta med papper och tentamensomslag till alla eleverna. Observera att det behövs minst 30 tentamensomslag och ca 400 papper (minst ett per elev och fråga) För en lista (namn och personnummer) på vilka som deltagit i tentamen. Alla som deltagit i tentamen skall lämna in ett ifyllt tentamensomslag, även om de inte svarat på någon fråga. Kontrollera att eleverna har betalt terminsräkning senast när de lämnar in tentan. För en lista på att detta skett. Om detta inte kan ske för att terminsräkningen inte tagits med så skall eleverna komma upp på avdelningen och visa denna vid ett senare tillfälle. Det är alltså tillåtet att skriva tentan även om man inte har med sig terminsräkningen men resultatet kommer bara att registreras när de väl visat upp sin terminsräkning. Ingen får lämna in sin tenta före Ingen får komma och börja tentera sedan någon lämnat in tentan och gått ifrån lokalen. Inga hjälpmedel utöver papper och penna är tillåtna. Ta med extra kursutvärderingar om någon elev glömt sina exemplar. Samla in kursutvärderingar. Be studenterna skriva ner sin e-post adress till vilken tenta resultatet kan skickas till!

Tentamen i Immunteknologi 28 maj 2005, 8-13

Tentamen i Immunteknologi 28 maj 2005, 8-13 Tentamen i Immunteknologi 28 maj 2005, 8-13 1 Varje fråga ger maximalt 5 p 2 SKRIV NAMN OCH PERSONNUMMER PÅ ALLA SIDOR! (inklusive tentamensomslaget) 3 Glöm inte att fylla i och lämna in KURSUTVÄRDERINGEN!

Läs mer

Tentamen i Immunteknologi 23 maj 2007, 8-13

Tentamen i Immunteknologi 23 maj 2007, 8-13 Tentamen i Immunteknologi 23 maj 2007, 8-13 1 Varje fråga ger maximalt 5 p, totalt 10 frågor. 2 SKRIV NMN OCH PERSONNUMMER PÅ LL SIDOR! (inklusive tentamensomslaget) 3 nvänd ett NYTT papper för varje fråga!

Läs mer

Tentamen i Immunteknologi 29 maj 2002, 8-13

Tentamen i Immunteknologi 29 maj 2002, 8-13 Tentamen i Immunteknologi 29 maj 2002, 8-13 1 Varje fråga ger maximalt 5 p. 2 SKRIV NAMN OCH PERSONNUMMER PÅ ALLA SIDOR! 3 Glöm inte att lämna in KURSUTVÄRDERINGEN! Observera att i kursutvärderingen för

Läs mer

Tentamen i Immunteknologi 28 maj 2003, 8-13

Tentamen i Immunteknologi 28 maj 2003, 8-13 Tentamen i Immunteknologi 28 maj 2003, 8-13 1 Varje fråga ger maximalt 5 p. 2 SKRIV NAMN OCH PERSONNUMMER PÅ ALLA SIDOR! 3 Glöm inte att lämna in KURSUTVÄRDERINGEN! Observera att i kursutvärderingen för

Läs mer

Antikroppar; struktur och diversitet. Kursbok: The immune system Peter Parham

Antikroppar; struktur och diversitet. Kursbok: The immune system Peter Parham Antikroppar; struktur och diversitet. Kursbok: The immune system Peter Parham Kapitel 2.1-2.5 Antikroppar = Immunoglobuliner (Ig): Ig presenteras på B-cellsytan samt finns i löslig form i blodet och lymf.

Läs mer

Medicin, Immunologi 7,5hp Kurskod: MC018G. Kursansvarig: Birgitta Olsen. Totalpoäng: 57 p Del 1, 16 p Del 2, 23 p del 3, 18 p

Medicin, Immunologi 7,5hp Kurskod: MC018G. Kursansvarig: Birgitta Olsen. Totalpoäng: 57 p Del 1, 16 p Del 2, 23 p del 3, 18 p Medicin, Immunologi 7,5hp Kurskod: MC018G Kursansvarig: Birgitta Olsen Datum: 2017 01 16 Skrivtid: 4 timmar Totalpoäng: 57 p Del 1, 16 p Del 2, 23 p del 3, 18 p Godkänd: 60 % av totala poängen Väl godkänd:

Läs mer

Medicin, Immunologi 7,5hp Kurskod: MC018G. Kursansvarig: Birgitta Olsen. Totalpoäng: 62 p Del 1, 15 p Del 2, 23 p del 3, 24 p

Medicin, Immunologi 7,5hp Kurskod: MC018G. Kursansvarig: Birgitta Olsen. Totalpoäng: 62 p Del 1, 15 p Del 2, 23 p del 3, 24 p Medicin, Immunologi 7,5hp Kurskod: MC018G Kursansvarig: Birgitta Olsen Datum: 2017 03 11 Skrivtid: 4 timmar Totalpoäng: 62 p Del 1, 15 p Del 2, 23 p del 3, 24 p Godkänd: 60 % av totala poängen Väl godkänd:

Läs mer

OBS! Ange svaren till respektive lärare på separata skrivningspapper

OBS! Ange svaren till respektive lärare på separata skrivningspapper Tentamen Kurs: Immunologi, 7,5 högskolepoäng Kurskod: MC1702 Kursansvarig: Birgitta Olsen Datum: 2013-01-18 Skrivtid: 4 tim Totalpoäng: 53 poäng Poängfördelning: Birgitta Olsen 21 poäng Kristina Elgbratt

Läs mer

Immunoglobulin. Funktion och Struktur. Projektarbete skrivet av: Linnéa Ahlin, Louise Andersson, Elsa Björn och Karin Thellenberg

Immunoglobulin. Funktion och Struktur. Projektarbete skrivet av: Linnéa Ahlin, Louise Andersson, Elsa Björn och Karin Thellenberg Immunoglobulin Funktion och Struktur Projektarbete skrivet av: Linnéa Ahlin, Louise Andersson, Elsa Björn och Karin Thellenberg Handledare: Hans Eklund Bke1 (KE0026) 2004-06-02 Sammanfattning Immunsystemet

Läs mer

Antikroppar:Från gen till protein skapande av diversitet. Kursbok: The immune system Peter Parham

Antikroppar:Från gen till protein skapande av diversitet. Kursbok: The immune system Peter Parham Antikroppar:Från gen till protein skapande av diversitet. Kursbok: The immune system Peter Parham Kapitel 2.6-2.15 Vilken substans som helst kan ge upphov till ett antikroppssvar. Som svar på närvaron

Läs mer

Immunteknologi, en introduktion. Hur man använder antikroppar för att mäta eller detektera biologiska händelser.

Immunteknologi, en introduktion. Hur man använder antikroppar för att mäta eller detektera biologiska händelser. Immunteknologi, en introduktion Hur man använder antikroppar för att mäta eller detektera biologiska händelser. Antikroppar genereras av b-lymphocyter, som är en del av de vita blodkropparna Varje ursprunglig

Läs mer

Lymfoida organ och immunsystemet. Innehåll. Leukocyter 11/14/2014. Människan: biologi och hälsa SJSE11. Ospecifika immunförsvaret

Lymfoida organ och immunsystemet. Innehåll. Leukocyter 11/14/2014. Människan: biologi och hälsa SJSE11. Ospecifika immunförsvaret Lymfoida organ och immunsystemet Människan: biologi och hälsa SJSE11 2014-11-18 Annelie Augustinsson Innehåll Ospecifika immunförsvaret Barriärer Kemiskt försvar Cellulärt försvar Specifika immunförsvaret

Läs mer

Immunsystemet. Kursmål. Innehåll 4/25/2016. Människan: biologi och hälsa SJSF11

Immunsystemet. Kursmål. Innehåll 4/25/2016. Människan: biologi och hälsa SJSF11 Immunsystemet Människan: biologi och hälsa SJSF11 2016-04-29 Annelie Augustinsson Kursmål Kunna identifiera grundläggande anatomiska strukturer samt redogöra för fysiologiska processer i kroppens organsystem

Läs mer

Immunologi CORE Vad har immunsystemet för funktioner? Bra och dåliga? Immunsystemet - två funktionella grenar. Immunsystemets organ

Immunologi CORE Vad har immunsystemet för funktioner? Bra och dåliga? Immunsystemet - två funktionella grenar. Immunsystemets organ Immunologi CORE 2018 Vad har immunsystemet för funktioner? Bra och dåliga? Skydda oss mot infektioner Naturliga vägen och via vaccinationer Förhindra uppkomst av tumörer Hinder för transplantationer Känner

Läs mer

Medicin B, Sjukdomslära med farmakologi, 15hp Tentamen del I, provkod 0101. (För studenter registrerade V15) Kurskod: MC1402.

Medicin B, Sjukdomslära med farmakologi, 15hp Tentamen del I, provkod 0101. (För studenter registrerade V15) Kurskod: MC1402. Medicin B, Sjukdomslära med farmakologi, 15hp Tentamen del I, provkod 0101. (För studenter registrerade V15) Kurskod: MC1402. Kursansvarig: Per Odencrants Datum: 2015 06 13 Skrivtid: 4 timmar Totalpoäng:

Läs mer

Deepti vill flytta fokus från huden

Deepti vill flytta fokus från huden Deepti vill flytta fokus från huden Idag vet vi att den som har psoriasis löper större risk än andra att drabbas av hjärtkärlsjukdomar. Men vi vet inte varför det är så. Det vill forskaren Deepti Verma

Läs mer

TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp kl Plats: Ekonomikum A:153

TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp kl Plats: Ekonomikum A:153 Namn:... Personnummer: Kod:... TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp 2011-02-19 kl 09.00 13.00 Plats: Ekonomikum A:153 Skrivningen omfattar 28 frågor. Totalt ger skrivningen 77 poäng.

Läs mer

Tentamen, del 1. Makroekonomi NA augusti 2014 Skrivtid 90 minuter.

Tentamen, del 1. Makroekonomi NA augusti 2014 Skrivtid 90 minuter. Jag har svarat på följande två frågor: 1 2 3 Min kod: Institutionen för ekonomi Rob Hart Tentamen, del 1 Makroekonomi NA0133 25 augusti 2014 Skrivtid 90 minuter. Regler Svara på 2 frågor. (Vid svar på

Läs mer

TENTAMEN Mikrobiologi

TENTAMEN Mikrobiologi TENTAMEN Mikrobiologi Vårdvetenskap med inriktning mot omvårdnad A Medicinsk mikrobiologi och farmakologi, 7,5 hp Termin 1, Sjuksköterskeprogrammet Datum: 2013-04-25 Skrivtid: 5 timmar Hjälpmedel: Inget

Läs mer

Vad är MHC? MHC och TCR struktur. Antigen processering och presentation. Kursbok: The immune system Peter Parham

Vad är MHC? MHC och TCR struktur. Antigen processering och presentation. Kursbok: The immune system Peter Parham Vad är MHC? MHC och TCR struktur. Antigen processering och presentation. Kursbok: The immune system Peter Parham Kapitel 3; hela Lite Historia: 1953: George Snell upptäcker en grupp av gener som bestämmer

Läs mer

Arv + miljö = diabetes?

Arv + miljö = diabetes? Arv + miljö = diabetes? Kristina Lejon universitetslektor, immunologi, Institutionen för klinisk mikrobiologi Vad är det som gör att vi får diabetes? Anna Möllsten var nyss inne på den frågan och visade

Läs mer

Huntingtons sjukdom - en hjärnsjukdom

Huntingtons sjukdom - en hjärnsjukdom Huntingtons sjukdom forsknings nyheter. I klartext Skriven av forskare För de globala HS medlemmarna. Benmärgstransplantation vid Huntingtons sjukdom Benmärgstransplantation skyddar HS-möss från vissa

Läs mer

Till dig som har fått vaccin mot lunginflammation

Till dig som har fått vaccin mot lunginflammation Till dig som har fått vaccin mot lunginflammation polysackaridvaccin mot pneumokockinfektioner, konjugerat, adsorberat, 13-valent Kort om lunginflammation Du har fått den här broschyren av din läkare eller

Läs mer

TENTAMEN. 18 januari 2006. APEX och BVLP, ht 05

TENTAMEN. 18 januari 2006. APEX och BVLP, ht 05 TENTAMEN 18 januari 2006 APEX och BVLP, ht 05 Block III: Integrativ biomedicin med farmakologisk inriktning Delkurs 5: Immunologi, infektion, tumörbiologi, och hematologi Kod: Max poäng: 77 Gränser (G/VG):

Läs mer

Tentamen. Makroekonomi NA juni 2013 Skrivtid 4 timmar.

Tentamen. Makroekonomi NA juni 2013 Skrivtid 4 timmar. Jag har svarat på följande fyra frågor: 1 2 3 4 5 6 Min kod: Institutionen för ekonomi Rob Hart Tentamen Makroekonomi NA0133 5 juni 2013 Skrivtid 4 timmar. Regler Svara på 4 frågor. (Vid svar på fler än

Läs mer

OBS! Tentan innehåller frågor från två provmoment. Svara bara på de frågor vars provmoment ni inte har godkänt på.

OBS! Tentan innehåller frågor från två provmoment. Svara bara på de frågor vars provmoment ni inte har godkänt på. Medicinska fakulteten Institutionen för hälsa, vård och samhälle Avdelningen för omvårdnad Anna Ekwall Tentamen, SJSE15 Omtentamen I Datum: 2014-04-05 Tid: kl. 09.00-13.00 Tillåtet hjälpmedel: Häftet med

Läs mer

Namn:... Årskurs... Personnummer... Glöm inte skriva namn på immunologidelen också

Namn:... Årskurs... Personnummer... Glöm inte skriva namn på immunologidelen också 1 Tentamen i Cellbiologi med Immunologi KTH 4 april 2002 kl 14-18 Skriv svaren direkt i tentan. Vid behov använd extra blad Namn:... Årskurs... Personnummer... Glöm inte skriva namn på immunologidelen

Läs mer

Resultat:... (Cellbiologi:... Immunologi...) Betyg...

Resultat:... (Cellbiologi:... Immunologi...) Betyg... Tentamen i Cellbiologi med Immunologi KTH 7 Mars 2005 kl 14-18 Skriv svaren direkt i tentan. Vid behov använd extra blad Namn:... Årskurs/årgång... (typ bio04) Personnummer... Glöm inte skriva namn och

Läs mer

Tentamen. Makroekonomi NA0133. November 2015 Skrivtid 3 timmar.

Tentamen. Makroekonomi NA0133. November 2015 Skrivtid 3 timmar. Jag har svarat på följande fyra frågor: 1 2 3 4 5 6 Min kod: Institutionen för ekonomi Rob Hart Tentamen Makroekonomi NA0133 November 2015 Skrivtid 3 timmar. Regler Svara på 4 frågor. (Vid svar på fler

Läs mer

Försättsblad Tentamen

Försättsblad Tentamen Försättsblad Tentamen (Används även till tentamenslådan.) Måste alltid lämnas in. OBS! Eventuella lösblad måste alltid fästas ihop med tentamen. Institution Ekonomihögskolan Skriftligt prov i delkurs Makro

Läs mer

Kliniskt forskningscentrum. Laborativ verksamhet

Kliniskt forskningscentrum. Laborativ verksamhet Kliniskt forskningscentrum Laborativ verksamhet Vid Kliniskt forskningscentrum (KFC) finns möjlighet att få laborativ hjälp i olika forskningsprojekt samt möjlighet för egen laborativ verksamhet. Laboratoriet

Läs mer

Virusinfektioner. Stephan Stenmark Infektionskliniken NUS Umeå

Virusinfektioner. Stephan Stenmark Infektionskliniken NUS Umeå Virusinfektioner Stephan Stenmark Infektionskliniken NUS Umeå Disposition Allmänt om virus Herpesvirusgruppen Behandlingsindikationer Aktuella läkemedel Allmänt Virus är mycket små och vanliga Alla virus

Läs mer

Tentamen, del 1. Makroekonomi NA juni 2014 Skrivtid 90 minuter.

Tentamen, del 1. Makroekonomi NA juni 2014 Skrivtid 90 minuter. Jag har svarat på följande två frågor: 1 2 3 Min kod: Institutionen för ekonomi Rob Hart Tentamen, del 1 Makroekonomi NA0133 5 juni 2014 Skrivtid 90 minuter. Regler Svara på 2 frågor. (Vid svar på fler

Läs mer

Tema Försvar. Ordinarie tentamen termin 2 VT 2013

Tema Försvar. Ordinarie tentamen termin 2 VT 2013 1 Tema Försvar. Ordinarie tentamen termin 2 VT 2013 Totalt antal poäng: 61 p Godkänt nedre gräns: 39 p 1) Skriv din kod längst upp till höger på SAMTLIGA papper i detta häfte samt på eventuella extrablad

Läs mer

Nej, i förhållande till den beräknade besparing som Bioptron ger, innebär den en avsevärd vård och kostnadseffektivisering.

Nej, i förhållande till den beräknade besparing som Bioptron ger, innebär den en avsevärd vård och kostnadseffektivisering. Hur hjälper behandling med Bioptron immunsystemet? Ljusbehandling har visat sig minska smärta på flera olika sätt. Activerar celler som gör bakterierna till sitt byte. Aktiverar celler som bryter ner mikrober.

Läs mer

Immunologi en introduktion. Vad har immunsystemet för funktioner? Bra och dåliga? Immunsystemet

Immunologi en introduktion. Vad har immunsystemet för funktioner? Bra och dåliga? Immunsystemet Immunologi - en introduktion Annica Lindkvist Avd för Klinisk Immunologi och Transfusionsmedicin, KI Annica.Lindkvist@ki.se 1 Vad har immunsystemet för funktioner? Bra och dåliga? Skydda oss mot infektioner

Läs mer

Lunginflammation och vaccinering

Lunginflammation och vaccinering Se till att du inte tappar andan när du verkligen behöver den! Lunginflammation och vaccinering Om lunginflammation Lunginflammation (pneumoni) innebär att de små luftfyllda blåsorna i det inre av lungorna

Läs mer

TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp kl Plats: BMC B:10

TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp kl Plats: BMC B:10 Kod:... TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp 2012-03-31 kl 09.00 14.00 Plats: BMC B:10 Skrivningen omfattar 23 frågor. Totalt ger skrivningen 86 poäng. Godkändgränsen är 60 % (51 poäng).

Läs mer

Tentamen. Makroekonomi NA0133. Juni 2015 Skrivtid 3 timmar.

Tentamen. Makroekonomi NA0133. Juni 2015 Skrivtid 3 timmar. Jag har svarat på följande fyra frågor: 1 2 3 4 5 6 Min kod: Institutionen för ekonomi Rob Hart Tentamen Makroekonomi NA0133 Juni 2015 Skrivtid 3 timmar. Regler Svara på 4 frågor. (Vid svar på fler än

Läs mer

6.5 Så försvarar sig din kropp

6.5 Så försvarar sig din kropp 6.5 Så försvarar sig din kropp Kroppen skyddar sig på många sätt: - Huden - Skelett - Saliv, tårvätska, magsaft - Luftvägar med slemhinna med flimmerhår - Inre immunförsvar Avancerat immunförsvar Kroppens

Läs mer

OBS! Vi har nya rutiner.

OBS! Vi har nya rutiner. KOD: Kurskod: PM1609 Kursnamn: Biologisk psykologi Provmoment: Kognitiv neurovetenskap, 9 hp Ansvarig lärare: Stefan Hansen Tentamensdatum: 12 januari 2013 Tillåtna hjälpmedel: Inga ***************************************************************************

Läs mer

Tentamen i Matematisk statistik Kurskod S0001M

Tentamen i Matematisk statistik Kurskod S0001M Tentamen i Matematisk statistik Kurskod S0001M Poäng totalt för del 1: 25 (10 uppgifter) Tentamensdatum 2017-08-22 Poäng totalt för del 2: 30 (3 uppgifter) Skrivtid 9.00 14.00 Jourhavande lärare: Mykola

Läs mer

Bilaga 1 Förslag på kursämnen för klinisk immunologi och transfusionsmedicin

Bilaga 1 Förslag på kursämnen för klinisk immunologi och transfusionsmedicin Bilaga 1 Förslag på kursämnen för klinisk immunologi och transfusionsmedicin Detta dokument är en sammanställning av de kursämnen som arbetats fram i två workshoppar under hösten 2013 med en expertgrupp

Läs mer

Kursbok: The immune system Peter Parham

Kursbok: The immune system Peter Parham B-cellsutveckling. Kursbok: The immune system Peter Parham Kapitel 4 Hela skall läsas och kunnas utom: Fig. 4.6 och motsvarande i texten. Fig. 4.8 och motsvarande i texten. Kapitel 4.5-4.6; Fig. 4.12 Kapitel

Läs mer

Lunginflammation och vaccinering

Lunginflammation och vaccinering Låt inte lunginflammation komma som en blixt från klar himmel. Lunginflammation och vaccinering Om lunginflammation Lunginflammation (pneumoni) innebär att de små luftfyllda blåsorna i det inre av lungorna

Läs mer

Att gå vidare är viktigt när man forskar, men också att backa och titta på vad som gjorts tidigare, säger Maria Lampinen.

Att gå vidare är viktigt när man forskar, men också att backa och titta på vad som gjorts tidigare, säger Maria Lampinen. Att gå vidare är viktigt när man forskar, men också att backa och titta på vad som gjorts tidigare, säger Maria Lampinen. FORSKNING På spaning bland tarmludd & vita blodkroppar Tarmen, dess bakterier och

Läs mer

Tentamen i kursen Naturvetenskap och teknik F-3, 22,5 hp

Tentamen i kursen Naturvetenskap och teknik F-3, 22,5 hp Tentamen i kursen Naturvetenskap och teknik F-3, 22,5 hp Kurskoder: LPGG14 Delkurs: 1 Ämnen: Biologi, Kemi Datum: fredagen den 4 november 2016 Tid: 8.15 12.15 (distans 9.00-13.00) Ansvariga lärare: Hjälpmedel:

Läs mer

Studiehandledning. IBM240 Infektion, immunologi, tumörbiologi och hematologi med egenvård, 7.5 hp

Studiehandledning. IBM240 Infektion, immunologi, tumörbiologi och hematologi med egenvård, 7.5 hp Sahlgrenska akademin Institutionen för biomedicin Studiehandledning IBM240 Infektion, immunologi, tumörbiologi och hematologi med egenvård, 7.5 hp Kursen ingår i receptarieprogrammet Göteborgs universitet

Läs mer

Individuell inlämningsuppgift TEK210

Individuell inlämningsuppgift TEK210 Individuell inlämningsuppgift TEK210 Den individuella inlämningsuppgiften består av två delar. Del 1 Kognitiv design är obligatorisk och för att bli godkänd på kursen krävs att denna, tillsammans med skriftlig

Läs mer

HLA matchade trombocyter. Torsten Eich Klinisk immunologi och transfusionsmedicin Uppsala. Regionmöte Transfusionsmedicin Uppsala

HLA matchade trombocyter. Torsten Eich Klinisk immunologi och transfusionsmedicin Uppsala. Regionmöte Transfusionsmedicin Uppsala HLA matchade trombocyter Torsten Eich Klinisk immunologi och transfusionsmedicin Uppsala Regionmöte Transfusionsmedicin Uppsala 170315 1 HLA matchade trombocyter Vad kommer vi att ta upp idag? Varför behöver

Läs mer

Giltig legitimation/pass är obligatoriskt att ha med sig. Tentamensvakt kontrollerar detta.

Giltig legitimation/pass är obligatoriskt att ha med sig. Tentamensvakt kontrollerar detta. KOD: Kurskod: PC1245 Kursnamn: Personlighet, hälsa och socialpsykologi Provmoment: Skriftlig tentamen 1a och skriftlig tentamen 1b (metod) Ansvarig lärare: Cecilia J Bergstad Tentamensdatum: 17 december

Läs mer

Klipp-och-klistra DNA: fixa mutationen med gen editering DNA, RNA och Protein

Klipp-och-klistra DNA: fixa mutationen med gen editering DNA, RNA och Protein Huntingtons sjukdom forsknings nyheter. I klartext Skriven av forskare För de globala HS medlemmarna. Klipp-och-klistra DNA: fixa mutationen med gen editering Forskare gör exakta ändringar av DNA i ett

Läs mer

Tentamen i Fysiologi och anatomi, avancerad nivå, mc2016, 7,5p. 2014-03-01

Tentamen i Fysiologi och anatomi, avancerad nivå, mc2016, 7,5p. 2014-03-01 Tentamen i Fysiologi och anatomi, avancerad nivå, mc2016, 7,5p. 2014-03-01 Lärare; Eva Oskarsson, fråga:1-6, 15p. Olle Henriksson, fråga:7-10, 12p. Birgitta Olsen, fråga 11-13, 5p Per Odencrants, fråga:

Läs mer

Tentamen i Grundläggande programmering STS, åk 1 2005-01-13

Tentamen i Grundläggande programmering STS, åk 1 2005-01-13 Tentamen i Grundläggande programmering STS, åk 1 2005-01-13 Skrivtid: 14.00-19.00 Lokal: Polacksbacken Hjälpmedel: Inga Lärare: Anders Berglund. Anders besöker tentan cirka kl. 15.30. Observera: Programkod

Läs mer

Analys av D-dimer på patient med misstänkt HAMA

Analys av D-dimer på patient med misstänkt HAMA Analys av D-dimer på patient med misstänkt HAMA Susanne Samuelsson Legitimerad Biomedicinsk analytiker, Sektionsledare Klinisk Kemi, Koagulationslaboratoriet Sahlgrenska Universitetssjukhuset, Sahlgrenska,

Läs mer

Försättsblad Tentamen

Försättsblad Tentamen Försättsblad Tentamen (Används även till tentamenslådan.) Måste alltid lämnas in. OBS! Eventuella lösblad måste alltid fästas ihop med tentamen. Institution Ekonomihögskolan Skriftligt prov i delkurs Tentamen

Läs mer

Till dig som ska behandlas med TECENTRIQ

Till dig som ska behandlas med TECENTRIQ Till dig som ska behandlas med TECENTRIQ Detta läkemedel är föremål för utökad övervakning. Detta kommer att göra det möjligt att snabbt identifiera ny säkerhetsinformation. Du kan hjälpa till genom att

Läs mer

Att studera med primär immunbrist - för gymnasier och högskolor

Att studera med primär immunbrist - för gymnasier och högskolor Att studera med primär immunbrist - för gymnasier och högskolor Information till personal vid gymnasier och högskolor om primär immunbrist och om hur studiesituationen påverkas för en student med en primär

Läs mer

Försättsblad Tentamen

Försättsblad Tentamen Försättsblad Tentamen (Används även till tentamenslådan.) Måste alltid lämnas in. OBS! Eventuella lösblad måste alltid fästas ihop med tentamen. Institution Ekonomihögskolan Skriftligt prov i delkurs Makro

Läs mer

TENTAMEN för KMB056 - Molekylär Bioteknik

TENTAMEN för KMB056 - Molekylär Bioteknik TENTAMEN för KMB056 - Molekylär Bioteknik 2011-10-22 em (V-salar) Totalt 60 poäng (Frågor 1-8: Joakim Norbeck, totalt 45 poäng; Frågor 9-12: Lisbeth Olsson, totalt 15 poäng). Betygsgränser: 30 poäng =

Läs mer

Detektion av Borrelia burgdorferi IgG. med hjälp av ELISA

Detektion av Borrelia burgdorferi IgG. med hjälp av ELISA Umeå Universitet Biomedicinska analytikerprogrammet Detektion av Borrelia burgdorferi IgG med hjälp av ELISA Årskull: Laborationsrapport i immunologi termin 3 Laborationsdatum: Inlämnad: Godkänd: Handledare:

Läs mer

Den gåtfulla kopplingen mellan vaccin och narkolepsi

Den gåtfulla kopplingen mellan vaccin och narkolepsi Den gåtfulla kopplingen mellan vaccin och narkolepsi Vaccinet Pandemrix ökar risken för att barn ska drabbas av sömnsjukan narkolepsi. Men forskarna förstår inte varför. Just nu undersöks tre huvudspår.

Läs mer

Tentamen i Matematisk statistik Kurskod S0001M

Tentamen i Matematisk statistik Kurskod S0001M Tentamen i Matematisk statistik Kurskod S0001M Poäng totalt för del 1: 25 (10 uppgifter) Tentamensdatum 2014-01-17 Poäng totalt för del 2: 30 (3 uppgifter) Skrivtid 15.00 20.00 Lärare: Adam Jonsson, Mykola

Läs mer

Tentamen i Allmän farmakologi, 2 hp

Tentamen i Allmän farmakologi, 2 hp Institutionen för omvårdnad Ansvarig lärare: Stig Jacobsson Avdelningen för farmakologi TENTAMEN KOD NR Tentamen i Allmän farmakologi, 2 hp Kurs: Biomedicin och allmän farmakologi, 7,5 hp inom Sjuksköterske-/Röntgensjuksköterskeprogrammet

Läs mer

Grundläggande immunologi PDF EPUB LÄSA ladda ner LADDA NER LÄSA. Författare: Henrik Brändén.

Grundläggande immunologi PDF EPUB LÄSA ladda ner LADDA NER LÄSA. Författare: Henrik Brändén. Grundläggande immunologi PDF EPUB LÄSA ladda ner LADDA NER LÄSA Författare: Henrik Brändén. Annan Information Vi erkänner och betalar respekt för äldste och traditionella ägare av det land där våra fem

Läs mer

TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp kl Plats: Skrivsalen Polacksbacken

TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp kl Plats: Skrivsalen Polacksbacken Namn:... Personnummer: Kod:... TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp 2011-01-13 kl 09.00 13.00 Plats: Skrivsalen Polacksbacken Skrivningen omfattar 23 frågor. Totalt ger skrivningen 72

Läs mer

Tentamen i Biomedicinsk laboratoriemetodik 2, 7 hp (kod 0800)

Tentamen i Biomedicinsk laboratoriemetodik 2, 7 hp (kod 0800) Tentamen i Biomedicinsk laboratoriemetodik 2, 7 hp (kod 0800) Kursens namn: BMLVA II 22,5 högskolepoäng Kurskod: BL1004 Kursansvarig: Rolf Pettersson, Charlotte Sahlberg Bang Datum: 2/5-2011 Skrivtid:

Läs mer

Tentamen i Klinisk kemisk diagnostik

Tentamen i Klinisk kemisk diagnostik Tentamen i Klinisk kemisk diagnostik 16 december 2013 Skrivtid: 8:00-12:00 Personnummer: Läs detta först: 1. Skriv ditt namn på varje blad! 2. Mobiltelefoner (avstängda), väskor och ytterkläder ska förvaras

Läs mer

Caroline Zakrisson [Kurs] [Datum]

Caroline Zakrisson [Kurs] [Datum] Mål att uppnå För stå hur männniskans kropp är uppbyggd i stora drag. Förstå sambandet mellan maten du äter och hur din kropp fungerar. Förstå hjärnans och nervernas betydelse för att vi minns, lär oss

Läs mer

Tentamen i Matematisk statistik Kurskod S0001M

Tentamen i Matematisk statistik Kurskod S0001M Tentamen i Matematisk statistik Kurskod S0001M Poäng totalt för del 1: 25 (10 uppgifter) Tentamensdatum 2017-06-02 Poäng totalt för del 2: 30 (3 uppgifter) Skrivtid 9.00 14.00 Lärare: Mikael Stenlund Examinator:

Läs mer

Bioteknik och patent. Skydda dina idéer

Bioteknik och patent. Skydda dina idéer Bioteknik och patent Skydda dina idéer Bioteknik och patent Med bioteknik menas tekniska tillämpningar av kunskap om biologiska processer, till exempel i mikroorganismer, växter eller djur. Bioteknik har

Läs mer

BAKTERIERNA, VÅRA VÄNNER

BAKTERIERNA, VÅRA VÄNNER För forskarutbildningskursen Aktuell klinisk forskning Referat av Susanne Lindgren från Göteborgs läkaresällskaps seminarium 09-05-06 Föredragshållare: Professor Agnes Wold BAKTERIERNA, VÅRA VÄNNER Sammanfattning

Läs mer

Försättsblad Tentamen (Används även till tentamenslådan.) Måste alltid lämnas in. OBS! Eventuella lösblad måste alltid fästas ihop med tentamen.

Försättsblad Tentamen (Används även till tentamenslådan.) Måste alltid lämnas in. OBS! Eventuella lösblad måste alltid fästas ihop med tentamen. Försättsblad Tentamen (Används även till tentamenslådan.) Måste alltid lämnas in. OBS! Eventuella lösblad måste alltid fästas ihop med tentamen. Institution Ekonomihögskolan Skriftligt prov i delkurs Branschrelaterad

Läs mer

Biosimilarer Vad är det?

Biosimilarer Vad är det? Biosimilarer Vad är det? Biosimilarer Vad är det? Introduktion Läkemedel är en viktig del av en god hälso- och sjukvård. Traditionellt har läkemedel tillverkats på kemisk väg men under de senaste decennierna

Läs mer

TENTAMEN MEDICIN, MEDICINSK MIKROBIOLOGI 7,5 HP. Kurskod: MC1401. Kursansvarig: Nikolaos Venizelos (tfn: 070-255 85 20) Totalpoäng: 63,5

TENTAMEN MEDICIN, MEDICINSK MIKROBIOLOGI 7,5 HP. Kurskod: MC1401. Kursansvarig: Nikolaos Venizelos (tfn: 070-255 85 20) Totalpoäng: 63,5 TENTAMEN MEDICIN, MEDICINSK MIKROBIOLOGI 7,5 HP Kurskod: MC1401 Kursansvarig: Nikolaos Venizelos (tfn: 070-255 85 20) Datum: 2012-08-14 Skrivtid: 4 tim. Totalpoäng: 63,5 Poängfördelning: Nikolaos Venizelos

Läs mer

Skriv tydligt. Besvara inte frågor med lösryckta ord, utan sammanhängande och tydligt. Visa även dina beräkningar.

Skriv tydligt. Besvara inte frågor med lösryckta ord, utan sammanhängande och tydligt. Visa även dina beräkningar. KOD: Kurskod: PM1303 Kursnamn: Vetenskapsteori och grundläggande forskningsmetod Provmoment: Vetenskapsteori och forskningsmetod Ansvarig lärare: Anders Biel Tentamensdatum: 2014-11-14 kl. 09.00 13.00

Läs mer

Transfusionsmedicin. Anna Willman

Transfusionsmedicin. Anna Willman Transfusionsmedicin Anna Willman Blod En vuxen människa har mellan fyra till sex liter blod Blodkroppar bildas i benmärgen Blodet består av: Röda blodkroppar (erytrocyter) Vita blodkroppar (leucocyter)

Läs mer

LYMFSYSTEMETS ANATOMI OCH FUNKTION

LYMFSYSTEMETS ANATOMI OCH FUNKTION LYMFSYSTEMETS ANATOMI OCH FUNKTION Ann-Christin Olsson Specialist i allmän internmedicin och hematologi Medicinkliniken Länssjukhuset Ryhov, JÖNKÖPING 2016-05-23 ACO 1 LYMFSYSTEMET KLINISK ÖVERSIKT 2016-05-23

Läs mer

SJSG(E,F)11 Människan: Biologi och hälsa Allmän farmakologi (Farmakologi) 3.0 hp

SJSG(E,F)11 Människan: Biologi och hälsa Allmän farmakologi (Farmakologi) 3.0 hp Institutionen för hälsovetenskaper Programnämnden för omvårdnad, radiografi samt reproduktiv, perinatal och sexuell hälsa Sjuksköterskeprogrammet 180 hp Kodnummer.. SJSG(E,F)11 Människan: Biologi och hälsa

Läs mer

Delprov l, fredag 11/11,

Delprov l, fredag 11/11, Delprov l, fredag 11/11, 14.00-17.00 Fråga 1 (5 p). Ringa in ett av alternativen (endast ett): A. Vilket påstående är falskt? l. Aminosyror är byggstenar till proteiner 2. Membraner består av peptidoglykan

Läs mer

Appendix 1 - Vad som ska ingå i de olika delmålen

Appendix 1 - Vad som ska ingå i de olika delmålen Appendix 1 - Vad som ska ingå i de olika delmålen Delmål 1 ligger under v3 för kamratgranskning (17/11) och slutlig inlämning v4 (24/11). Det är lämpligt om innehållet i vecka 1 och 2 är skrivet till vecka

Läs mer

Medicin, Medicinsk mikrobiologi 7,5hp Kurskod: MC016G Kursansvarig: Birgitta Olsen

Medicin, Medicinsk mikrobiologi 7,5hp Kurskod: MC016G Kursansvarig: Birgitta Olsen Medicin, Medicinsk mikrobiologi 7,5hp Kurskod: MC016G Kursansvarig: Birgitta Olsen Datum: 2016 11 12 Skrivtid: 4 timmar Totalpoäng: 56,5 p Parasitologi,5 p Mykologi,6 p Virologi, 21,5 p p Bakteriologi,

Läs mer

Tentamen på kurs Nationalekonomi (1-20 poäng), delkurs 1, Mikroekonomisk teori med tillämpningar, 7 poäng, måndagen den 15 augusti 2005, kl 9-14.

Tentamen på kurs Nationalekonomi (1-20 poäng), delkurs 1, Mikroekonomisk teori med tillämpningar, 7 poäng, måndagen den 15 augusti 2005, kl 9-14. HÖGSKOLAN I HALMSTAD INSTITUTIONEN FÖR EKONOMI OCH TEKNIK Tentamen på kurs Nationalekonomi (1-20 poäng), delkurs 1, Mikroekonomisk teori med tillämpningar, 7 poäng, måndagen den 15 augusti 2005, kl 9-14.

Läs mer

TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp kl Plats: BMC B:10

TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp kl Plats: BMC B:10 Namn:... Personnummer: Kod:... TENTAMEN Kandidatprogrammet i Biomedicin Anatomi 7,5 hp 2011-02-17 kl 08.00 13.00 Plats: BMC B:10 Skrivningen omfattar 23 frågor. Totalt ger skrivningen 90 poäng. Godkändgränsen

Läs mer

Individuell inlämningsuppgift del 1: Kognitiv design.

Individuell inlämningsuppgift del 1: Kognitiv design. Individuell inlämningsuppgift del 1: Kognitiv design. Den individuella inlämningsuppgiften består av två delar. Del 1 Kognitiv design är obligatorisk och för att bli godkänd på kursen krävs att denna,

Läs mer

CHALMERS TEKNISKA HÖGSKOLA IMA 044 Avdelningen för Industriell marknadsföring INDUSTRIELL MARKNADSFÖRING IMA 044

CHALMERS TEKNISKA HÖGSKOLA IMA 044 Avdelningen för Industriell marknadsföring INDUSTRIELL MARKNADSFÖRING IMA 044 CHALMERS TEKNISKA HÖGSKOLA IMA 044 Avdelningen för Industriell marknadsföring TENTAMEN: INDUSTRIELL MARKNADSFÖRING IMA 044 Måndag 16/12 2013 Tid: 14.00-18.00 HJÄLPMEDEL: INSTRUKTIONER: Inga Före rättning

Läs mer

Tentamensmoment: Rättningspoäng:...av max 25 p. Namn:. Pnr:. Betyg:... Distanskurs. Lärare: Malte Hermansson

Tentamensmoment: Rättningspoäng:...av max 25 p. Namn:. Pnr:. Betyg:... Distanskurs. Lärare: Malte Hermansson INSTITUTIONEN FÖR CELL- OCH MOLEKYLÄRBIOLOGI Tentamensmoment: Rättningspoäng:...av max 25 p. Kurs, linje etc: Cellbiologi del 2 Baskurs Biologi, 40 p Tentamensdatum: Namn:. Pnr:. Betyg:... Termin då kursen

Läs mer

Tentamen Biologi BI1112 Termin och år: Klockan:

Tentamen Biologi BI1112 Termin och år: Klockan: Tentamen Biologi BI1112 Termin och år: 120312 Klockan: 0800-13.15 Betygsgränser:!!! 50-66%! Betyg 3!!!!! 67-83%! Betyg 4!!!!! 84-100%! Betyg 5 Fråga 1-4 Cellbiologi Fråga 5-7 Genetik Fråga 8-10 Växtfysiologi!!!!

Läs mer

Tentamen. Makroekonomi NA0133. Augusti 2015 Skrivtid 3 timmar.

Tentamen. Makroekonomi NA0133. Augusti 2015 Skrivtid 3 timmar. Jag har svarat på följande fyra frågor: 1 2 3 4 5 6 Min kod: Institutionen för ekonomi Rob Hart Tentamen Makroekonomi NA0133 Augusti 2015 Skrivtid 3 timmar. Regler Svara på 4 frågor. (Vid svar på fler

Läs mer

MabThera (rituximab) patientinformation

MabThera (rituximab) patientinformation MabThera (rituximab) patientinformation Du som lever med reumatoid artrit, RA, har antagligen redan genomgått en hel del olika behandlingsformer. Nu har din läkare ordinerat MabThera (rituximab) för din

Läs mer

Basal Immunologi Homira Behbahani PhD 27/11 2009 Kl: 12:30-15 p.m Homira.behbahani@ki.se

Basal Immunologi Homira Behbahani PhD 27/11 2009 Kl: 12:30-15 p.m Homira.behbahani@ki.se Basal Immunologi Homira Behbahani PhD 27/11 2009 Kl: 12:30-15 p.m Homira.behbahani@ki.se Institutionen för neurobiologi, vårdvetenskap och samhälle (NVS) Innehålla Allmänna begrepp och immunsystemets uppbyggnad

Läs mer

Institutionen för laboratoriemedicin Bilaga 2 Biomedicinska analytikerprogrammet Analytisk Kemi och Biokemisk metodik Ht 2010, Termin 3

Institutionen för laboratoriemedicin Bilaga 2 Biomedicinska analytikerprogrammet Analytisk Kemi och Biokemisk metodik Ht 2010, Termin 3 Institutionen för laboratoriemedicin Bilaga 2 Biomedicinska analytikerprogrammet Analytisk Kemi och Biokemisk metodik Ht 2010, Termin 3 Laborationsdatum: 17 22 november 2010 Grupp: 2 Projekt: Rening och

Läs mer

Examination. Diagnostiska metoder (2 hp, provkod 0300) Örebro universitet/hv MC069A. Datum:

Examination. Diagnostiska metoder (2 hp, provkod 0300) Örebro universitet/hv MC069A. Datum: Examination Diagnostiska metoder (2 hp, provkod 0300) Datum: 2017 01 11 Tid: 1,5 timmar (summa 3 tim för farmakologi (0200) samt diagnostiska metoder (0300)) Tentamens form: Salstentamen Kursansvarig:

Läs mer

Tentamen i Sannolikhetslära och statistik Kurskod S0008M

Tentamen i Sannolikhetslära och statistik Kurskod S0008M Tentamen i Sannolikhetslära och statistik Kurskod S0008M Poäng totalt för del 1: 25 (10 uppgifter) Tentamensdatum 2017-10-27 Poäng totalt för del 2: 30 (3 uppgifter) Skrivtid 9.00 14.00 Lärare: Mykola

Läs mer

STOCKHOLMS UNIVERSITET. Institutionen för biologisk grundutbildning. Tentamen i Molekylär cellbiologi 10 p Namn: _.. Personnummer:.

STOCKHOLMS UNIVERSITET. Institutionen för biologisk grundutbildning. Tentamen i Molekylär cellbiologi 10 p Namn: _.. Personnummer:. STOCKHOLMS UNIVERSITET Institutionen för biologisk grundutbildning Tentamen i Molekylär cellbiologi 10 p. 2002-04-24 Namn: _.. Personnummer:. Plats nr: Poäng: Skrivtiden är fem timmar. Tänk på att skriva

Läs mer

Tentamen. Kurskod: MC1004. Medicin A, Molekylär cellbiologi. Kursansvarig: Christina Karlsson. Datum 130814 Skrivtid 4h

Tentamen. Kurskod: MC1004. Medicin A, Molekylär cellbiologi. Kursansvarig: Christina Karlsson. Datum 130814 Skrivtid 4h Tentamen Medicin A, Molekylär cellbiologi Kurskod: MC1004 Kursansvarig: Christina Karlsson Datum 130814 Skrivtid 4h Totalpoäng: 86p Poängfördelning Johanna Sundin (fråga 1 8): 18p Ignacio Rangel (fråga

Läs mer

Individuell inlämningsuppgift del 1: Kognitiv design.

Individuell inlämningsuppgift del 1: Kognitiv design. Individuell inlämningsuppgift del 1: Kognitiv design. Den individuella inlämningsuppgiften består av två delar. Del 1 Kognitiv design är obligatorisk och för att bli godkänd på kursen krävs att denna,

Läs mer

Autoimmuna sjukdomar är sjukdomar som uppkommer p.g.a. av att hundens egna immunförsvar ger upphov till sjukdom.

Autoimmuna sjukdomar är sjukdomar som uppkommer p.g.a. av att hundens egna immunförsvar ger upphov till sjukdom. Autoimmuna sjukdomar är sjukdomar som uppkommer p.g.a. av att hundens egna immunförsvar ger upphov till sjukdom. Kroppen bildar antikroppar mot sig själv. Kan vara antingen ANA - antinukleära antikroppar.

Läs mer

BIOSTATISTISK GRUNDKURS, MASB11, VT-16, VT2 ÖVNING 1, OCH ÖVNING 2, SAMT INFÖR ÖVNING 3

BIOSTATISTISK GRUNDKURS, MASB11, VT-16, VT2 ÖVNING 1, OCH ÖVNING 2, SAMT INFÖR ÖVNING 3 LUNDS UNIVERSITET, MATEMATIKCENTRUM, MATEMATISK STATISTIK BIOSTATISTISK GRUNDKURS, MASB11, VT-16, VT2 ÖVNING 1, 2016-04-01 OCH ÖVNING 2, 2016-04-04 SAMT INFÖR ÖVNING 3 Övningarnas mål: Du ska förstå grundläggande

Läs mer