Underhållsplan Underhållsplan,2014,, Brf,Sippan,i,Solna,,769605;1155,

Storlek: px
Starta visningen från sidan:

Download "Underhållsplan 2014. Underhållsplan,2014,, Brf,Sippan,i,Solna,,769605;1155,"

Transkript

1 Underhållsplan 2014 Underhållsplan2014 BrfSippaniSolna769605;1155

2 Innehållsförteckning NULÄGESANALYS* 3 INSPEKTERADE*FASTIGHETER* 3 STATUSBESIKTNING* 4 RAPPORT* 15 FÖRKORTNINGAR* 15 RÅGEN*9*HUS*13* 16 RÅGEN*4*HUS*17* 17 RÅGEN*7*HUS*19* KOSTNADSUPPSKATTNING/INTERVALLER* 19 TVÄTTSTUGOR* 19 FASADER* 19 TAK* 19 HISSAR* 19 BALKONGER* 20 FÖNSTER* 20 SPILLVATTENSTAMMAR* 20 TRAPPHUS* 20 VENTILATIONSAGGREGAT* 20 EL* 20 FJÄRRVÄRMECENTRAL* 20 ÖVRIGT* 20 Underhållsplan2014 BrfSippaniSolna769605;1155

3 Nulägesanalys AvBrfSippanharEffektkonsult&fastighetsförvaltningABfåttuppdraget attutföraentekniskundersökningavbyggnadernapårubricerade fastigheterförattskapaenunderhållsplan.utlåtandetinnehålleren bedömningavbehovetdenärmsta30årenavplanerade underhållsåtgärderibyggnadernasamtengrovkostnadsbedömningav varjeåtgärd.besiktningenutfördes22januari2014ochärenokulär översyn.underhållsplanenäruppdateradochrevideradavsittande styrelse. Inspekterade fastigheter BostadsrättsföreningensfastigheterliggerpåÅbergssonsväg1317och19 samt21;45.fastigheternaärbyggdaochuppförda1989;90ochbestårav totaltfyrabyggnader: Åbergssonsväg1317och19somärhögbyggnader. Åbergssonsväg21;45somärenlågbyggnad. Samtligafastigheterharfasaderitegelochtakenbeståravbetongpannor samtplåtbekläddadelariövrigt.balkongerigjutnaplattormedfronterav Underhållsplan2014 BrfSippaniSolna769605;1155

4 stenskivorochplåt.föreningenhartrestörretvättstugormedolikaårpå maskinerna.detfinnsenkrypvindsamtkällareihus19medplåtförråd. Värmecentralenärengemensamhetsanläggningförhelaområdetdådet ärsolnabostädersomägtochdrivitområdettidigare.detfinnstrehissari fastigheternasomidagharskötselavtal.fastigheternaharkabel;tv.husen ärbeskaffademedfrånluftviaventilationsaggregatpåvinden. Statusbesiktning Vidgenomgångavfastigheternaladesstörstviktpåfasadertaktrapphus samttvättstugor.ingenbesiktningharskettinneilägenhetersåingakök ellerbadrumäranalyserade.dådetärenbostadsrättsföreningkommer detmestainneilägenheternaändåattfallapåbostadsinnehavaren.taken äridagbetongpannordubbelkupigaochdessaharenlivslängdom40;50 år.takpappoläkthåller20;30år.vidbesiktningstillfälletkunde konstaterasattpannornaserutattvaraibraskickmenmedvisspåväxt frånväderovind.utbyggnaderärplåtbeklädda. Underhållsplan2014 BrfSippaniSolna769605;1155

5 Fasadernapåfastigheternabeståridagavtegelvilketäriprincip underhållsfritt.tegletkankommabehovavtvättiframtiden. Underhållsplan2014 BrfSippaniSolna769605;1155

6 Balkongernahargjutnaplattorochharbekläddafrontermedbådeplåt ochmineritskivorsamträckenavaluminium.vissaärkraftigt nedsmutsademeniövrigtintakta. Fönsterochbalkongdörrarärbekläddamedplåt.Härfinnsalltidriskmed kondensbakomplåtarnasomkangeupphovtillröta.vissaav fönsterbleckenflagnarochäravplåt. Underhållsplan2014 BrfSippaniSolna769605;1155

7 Entréportarärgjordaavaluminium. Trapphusbekläddamedstengolvsamtmåladeväggar.Ihusnr17har manrenoveratentrénochlagtnyttklinkergolvsamtmålatmålningäven Underhållsplan2014 BrfSippaniSolna769605;1155

8 utfördihusnr13.manharävenbyttlägenhetsdörrarifastigheternatill säkerhetsdörrargällerihusnr13;17.ihusnr19;45kvarstårbytetill säkerhetsdörrar Tvättstugorfinnsihusnr1317&19bestyckademedMieleo Wascatormaskinerhus13&17avnyaredatumochhus19avdenäldre typen.ihusnr13ärtvättstugansytskiktrenoveratnyttkakelklinkerspå golvet.ihusnr17ärdetmåladeväggarochklinkerspågolvetgolvet. Underhållsplan2014 BrfSippaniSolna769605;1155

9 Bildavdenäldretvättstuganihusnr19. Källaremeddessinstallationerochförråddettagällerhusnr19hus13 och17harkrypgrund. Underhållsplan2014 BrfSippaniSolna769605;1155

10 Källarförrådochsynligadelaravspillvattenledningarigjutjärn. Lågbyggnadenmedsinaplåtbekläddatak. Underhållsplan2014 BrfSippaniSolna769605;1155

11 Cykelförrådsomäribehovavrenovering. Underhållsplan2014 BrfSippaniSolna769605;1155

12 Cykelgarageutanförhus17. Altandel. Dörrpåvåningsplantilltrapphus. Underhållsplan2014 BrfSippaniSolna769605;1155

13 Omgjordentrémedpostboxar. Låghusdelen. Underhållsplan2014 BrfSippaniSolna769605;1155

14 Hus19 Renoveradhisskorgihusnr17. Underhållsplan2014 BrfSippaniSolna769605;1155

15 Befintlighisskorgihusnr13 Rapport Fastigheternaärtotaltsettiettbraskickdemskötesochunderhållesi föreningensmeningattförädla.detsomtittatspåvidbesiktningarnaär meraenligtdetönskemålföreningenharattvetaframtida reparationer/renoveringar.itabellernanedanärframräknatintervallmed ca.kostnaderräknadeidagensprisintervaller.vissaärprissattaikroch andrakrperm2.priserexkluderarmoms. Ingetakutbehovavrenoveringföreliggerutanattmankanfölja intervallerna.finnsliteytskiktsunderhållsåsomträfasadenpåförråden (enligtbild)samtdenedsmutsadebalkongdelarnasombehövertidigare tillsyn. Tvättstugani19ärorenoveradidagslägetmenskicketärändågott. Badrumsomärrenoverade2002och2007börhanästaintervallomca40; 50årfördetfallmananväntsigavporslinpåväggarochgolv. Byteavtakpappochläktbörinplanerasinomnärmstaårenpå fastigheternamedtegeltaken. Förkortningar TV=Tvättmaskin TS=Torkskåp Underhållsplan2014 BrfSippaniSolna769605;1155

16 TT=Torktumlare Rågen 9 hus 13 Åtgärder Senast Intervall Kostnad per st/m2 kr Totalrenovering av hiss st Totalrenovering tvättstuga ca 30 m m2 * golvytan kr golv vägg tak snick. Totalrenovering av samtliga badrum st Renovering entré trapphus st Ytskiktsrenoverin g. Renovering samtliga våningsplan Ingår ovan Ny el belysning ca kr Installation av säkerhetsdörrar st Ny torktumlare/tvättstuga Tak: byte av takpannor ca 780 m2 Tak: byte papp och läkt Plåttak dela av yttertak ca 78 m2 Balkonger Fönster/balkongdörrar Ventilationsaggregat vind Fasader tegel tvättning ca m st TV kr TS kr TT kr Avfukt kr mangel kr 650 m2 ca m2 ca m2 ca kr st st st m2 ca kr ca kr Underhållsplan2014 BrfSippaniSolna769605;1155

17 Rågen 4 hus 17 Åtgärder Senast Intervall Kostnad per st/m2 kr Totalrenovering av hiss st Totalrenovering tvättstuga ca 30 m m2 * golvytan ca kr golv vägg tak snick. Totalrenovering av samtliga badrum st Renovering entrè trapphus st Ytskiktsrenoverin g. Renovering samtliga våningsplan Ingår ovan Ny el belysning ca kr Installation av säkerhetsdörrar st Ny torktumlare/tvättstuga st Tak: byte av takpannor ca 910 m2 Tak: byte papp och läkt Plåttak del av yttertak ca 91 m2 Balkonger Fönster/balkongdörrar Ventilationsaggregat vind Fasader tegel tvättning ca m m m m st st st m2 TV kr TS kr TT kr Avfukt kr mangel kr ca ca ca ca kr ca kr Rågen 7 hus 19 Åtgärder Senast Intervall Kostnad per st/m2 kr Underhållsplan2014 BrfSippaniSolna769605;1155

18 Totalrenovering av hiss Totalrenovering tvättstuga ca 30 m2 Totalrenovering av samtliga badrum Renovering entré trapphus Renovering samtliga våningsplan Ny el belysning Installation av säkerhetsdörrar Ny torktumlare/tvättstuga st m2 * golvytan st st 2015 Ingår ovan st st Tak: byte av takpannor ca 506 m2 650 m2 ca Tak: byte papp och läkt Plåttak del av yttertak ca 506 m2 Balkonger Fönster/balkongdörrar Ventilationsaggregat vind Fasader tegel tvättning ca m2 750 m2 ca m2 ca kr st st st ca kr ca kr kr golv vägg tak snick. Ytskiktsrenoverin g. finns offert kr TV kr TS kr TT kr Avfukt kr mangel kr 650 m2 750 m m st st st Lågdel Åtgärder Senast Intervall Kostnad per st/m2 kr Fasader tegel tvättning ca 396 m %m2 ca%396%000%kr% Underhållsplan2014 BrfSippaniSolna769605;1155

19 Plåttak ca 252 m2 yttertak Fönster %m %000%st ca%252%000%kr% ca%46%000%kr% Låghus Åtgärder Senast Intervall Kostnad per st/m2 kr Fasader tegel tvättning ca 576 m2 Plåttak ca 432 m2 yttertak Fönster %m %m %000%st ca%576%000%kr% ca%432%000%kr% ca%48%000%kr% Kostnadsuppskattning/intervaller Tvättstugor Maskinerharenlivslängdpåca15;20årberoendepåanvändning. Kostnad:tvättmaskinca35000kr/sttorkskåpca20000kr/sttumlareca 17000kr/sttork/avfuktareca24000kr/stsamtmangelca15000kr/st. PrisernabaseradepåMieleellerWascatorsproffsmaskiner. Fasader Tvättningavtegelfasaderinnanmantarbeslutomtvättningbör sakkunnigförstsäkerställabehovet.kanvarasåattbehovinteföreligger alls.kostnadca1000krkvm.dettaväldigtgrovtuppskattat. Tak Pappochläktlivslängdca20;30årkostnadca750krm2samttegelpannor (betongpannor)livslängdca40;50årkostnadca650krm2.plåtdelar målningharenlivslängdpåca15;18årkostnadca1000krm2. Hissar Livslängdca30år.Kostnaduppskattadtill400000krperhiss. Underhållsplan2014 BrfSippaniSolna769605;1155

20 Balkonger Livslängdca40årkostnadca45000kr/st. Fönster Renoveringavbefintligafönsterutföresmed10;30årsintervallerkostnad ca2000kr/st. Spillvattenstammar Stambyteutförsvart40;50:deår.Kostnadberäknadca150000perbadrum inklusivekällaremedövrigautrymmen.kökexklusivesnickerierca 35000kr/stseparatatoaletterca25000kr/st.Stambyteytskiktutförs samtidigtavekonomiskaskäl. Trapphus Tidsintervall15;20årtillenuppskattadkostnadomca250000kr/st. Ventilationsaggregat Livslängd25;30år.Kostnadca350000kr/st. EL El;stammarochstigarelivslängdca50år.Kostnadca krper fastighet. Fjärrvärmecentral Livslängd20;25årdelavca250000kr. Övrigt Läggningklinkergolv800krm2t.extvättstuga. Målningtakväggarochsnickerierit.extvättstugauppskattaskostnaden tillca650krm2*rummetsyta. (Ettrummedgolvyta30m2beräkningär30*650=19500kr) Underhållsplan2014 BrfSippaniSolna769605;1155

Brf Flygplansfabriken 130619. (för en person) 2 Rum 39 m 2 plan 2. storlek: yta: våning: Symbolförklaring: frys + kyl. diskmaskin.

Brf Flygplansfabriken 130619. (för en person) 2 Rum 39 m 2 plan 2. storlek: yta: våning: Symbolförklaring: frys + kyl. diskmaskin. 1201 39 m 2 LH 1201 fönster () TRAPPHUS 1202 38 m 2 LH 1202 fönster () 1203 43 m 2 LH 1203 LH 1204 fönster () 1204 47 m 2 ITILLIADE HUS 1,5 fönster () LH 1204 1205 39 m 2 1,5 LH 1204 LH 1205 fönster ()

Läs mer

Brf Flygplansfabriken 130619. (för en person) 2 Rum 39 m 2 plan 3. storlek: yta: våning: Symbolförklaring: frys + kyl. diskmaskin.

Brf Flygplansfabriken 130619. (för en person) 2 Rum 39 m 2 plan 3. storlek: yta: våning: Symbolförklaring: frys + kyl. diskmaskin. 1301 39 m 2 LH 1301 TRAPPHUS 1302 38 m 2 LH 1302 1303 43 m 2 LH 1303 LH 1304 1304 47 m 2 ITILLIADE HUS 1,5 LH 1304 1305 39 m 2 1,5 LH 1304 LH 1305 1306 43 m 2 1,5 LH 1306 ELC 1307 43 m 2 1,5 ELC LH 1307

Läs mer

Bostadsrättsföreningen Solstrålen

Bostadsrättsföreningen Solstrålen Underhållsplan 20 Bostadsrättsföreningen Solstrålen Innehållsförteckning. 2. 3. 4.. Allmänna uppgifter Fastighetsfakta Besiktningsutlåtande Grunddata Sammanställning Sida 3 Sida 4 Sida -0 Sida -3 Sida

Läs mer

Underhållsplan för Brf Månstenen 18/11 2014. Innehåll. 1. Objekt 2. 2. Syfte och omfattning 3. 3. Underlag 3. 4. Tidigare renoveringar 4

Underhållsplan för Brf Månstenen 18/11 2014. Innehåll. 1. Objekt 2. 2. Syfte och omfattning 3. 3. Underlag 3. 4. Tidigare renoveringar 4 Underhållsplan för Brf Månstenen 18/11 2014 Innehåll. 1. Objekt 2 2. Syfte och omfattning 3 3. Underlag 3 4. Tidigare renoveringar 4 5. Kortfattad byggnadsbeskrivning 4 6. Underhållsbehov och avsättning

Läs mer

Underhållsplan. Brf Körsbäret 19-21. Annedal 23:19, 23:20, 23:21. Datum för utskrift: 2015-03-05

Underhållsplan. Brf Körsbäret 19-21. Annedal 23:19, 23:20, 23:21. Datum för utskrift: 2015-03-05 Underhållsplan Brf Körsbäret 19-21 Datum för utskrift: 2015-03-05 Översikt Grundläggande information om underhållsplanen. Adress Nilssonsberg 411 43 GÖTEBORG Boarea (BOA) 30232 m2 Lokalarea (LOA) 2459

Läs mer

KRISTIANSTADS KOMMUN VITTSKÖVLE 21:4 VITTSKÖVLE HEMMET VITTSKÖVLEVÄGEN 104 297 91 VITTSKÖVLE

KRISTIANSTADS KOMMUN VITTSKÖVLE 21:4 VITTSKÖVLE HEMMET VITTSKÖVLEVÄGEN 104 297 91 VITTSKÖVLE BILAGA 3 KRISTIANSTADS KOMMUN VITTSKÖVLE 21:4 VITTSKÖVLE HEMMET VITTSKÖVLEVÄGEN 104 297 91 VITTSKÖVLE STATUSBESIKTNING UT- OCH IN- VÄNDIGT AV FASTIGHET MED BYGGNADER Kristianstad 2004-08-19 FB Engineering

Läs mer

Maratonvägen Ombyggnation i Halmstad

Maratonvägen Ombyggnation i Halmstad Maratonvägen Ombyggnation i Halmstad Maratonvägen 579 lgh Den nya tidens hyresrätt 1 Byggmöte 18 november i Göteborg Maratonvägen Ett miljonprogramsområde i Halmstad 21 huskroppar med totalt 579 lägenheter

Läs mer

Underhållsplan 2011. Bostadsrättsföreningen Inland 3

Underhållsplan 2011. Bostadsrättsföreningen Inland 3 Underhållsplan 20 Bostadsrättsföreningen Inland 3 Innehållsförteckning. 2. 3. 4. 5. Allmänna uppgifter Fastighetsfakta Besiktningsutlåtande Grunddata Ekonomisk sammanställning Sida 3 Sida 4 Sida 5-9 Sida

Läs mer

Nu bygger vi om i Husby

Nu bygger vi om i Husby Nu bygger vi om i Husby Nu startar vi ombyggnaden av våra hus och lägenheter på Järva. Vi bygger om för dig som bor i Svenska Bostäder Så här planerar vi att bygga om i Husby Hus för hus Det tar upp till

Läs mer

Enkel Energikartläggning. Start av inventeringen. Allmänt/Energiledning. Anläggningens namn: När uppfördes byggnaden?

Enkel Energikartläggning. Start av inventeringen. Allmänt/Energiledning. Anläggningens namn: När uppfördes byggnaden? Enkel Energikartläggning Start av inventeringen Inled processen med att lista vilka byggnader som anläggningen innefattar. Gå sedan igenom varje byggnad med ett eget inventeringsprotokoll. Anläggningens

Läs mer

UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-09-04

UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-09-04 Fastighet Postbonden 1 Brf Timmerhögen Timmermansgatan 44, i Stockholm UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-09-04 Brf Timmerhögen Fgh Postbonden 1 Timmerhögen 44 118 55 Stockholm Fastighetsägarna Stockholm

Läs mer

Underhållsplan Brf. Ulrika

Underhållsplan Brf. Ulrika Underhållsplan Brf. Ulrika Innehållsförteckning 1. Tidigare underhållsplan... 1-3 2. Fastighetsfakta... 6 3. Byggnadstekniska uppgifter... 6 4. Plan 2013 2020... 6-10 1 1. Tidigare underhållsplan Underhållsplan

Läs mer

Inventeringsprotokoll Statusbedömning

Inventeringsprotokoll Statusbedömning Inventeringsprotokoll Statusbedömning TRAPPHUS, HISSKORG Fastighet Kv Dykaren Inventeringsdatum 2012-06-20 Byggnad 1 Omg Adress Alströmergatan 45 Egenkontroll Besiktningsman Oskar Rudbeck Granskning 2012-09-28

Läs mer

Energirenovering av miljonprogrammet

Energirenovering av miljonprogrammet Energirenovering av miljonprogrammet Hur lönsam är energirenovering? Charlie Timmermann 2014-06-10 1 Bakgrundsfakta Byggdes 886 000 st lgh under miljonprogramsåren Ca 560 000 st av dessa behöver renoveras

Läs mer

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail. Brf Reveljen 1 & 11 Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.com Mäklarinformation version 150110 På föreningens hemsida

Läs mer

Handling 06.56 PU-plan Trelleborgs lasarett

Handling 06.56 PU-plan Trelleborgs lasarett Handling 6.56 -plan rt T2 871 871 N UTVÄNIGT MRK 2-1-1 16 17 18 19 2 21 22 23.1 sfaltering av ytor utanför lastkaj samt upp mot Frans Malmr T46 Malmrosgatan Värmesystem i byggnad 2-1-1 3 T4241.1 Upprätta

Läs mer

KV RISET 10. Illustration Barnängsgatan / Tengdahlsgatan KV RISET 10 2014-05-08

KV RISET 10. Illustration Barnängsgatan / Tengdahlsgatan KV RISET 10 2014-05-08 Illustration Barnängsgatan / Tengdahlsgatan Kontur arkitektkontor ab Triewaldsgränd 1 111 29 Stockholm telefon +46 8 411 54 10 kontor@kontur.se www.kontur.se INNEHÅLL Försättsblad Innehåll Byggnaden, förändring,

Läs mer

Byggnadsdel Skick Anmärkning Bör Uppskattad åtgärdas kostnad exklusive moms

Byggnadsdel Skick Anmärkning Bör Uppskattad åtgärdas kostnad exklusive moms 1 (8) Tak Se separat besiktningsprotokoll på taken avser samtliga tak. 2013 Akuta lagningar 12 000 2014 Bättringsmålning 20 000 gård och gata 63-65 Tak Lilla huset Inga synliga skador Separat syn i samband

Läs mer

På mötet kommer vi att rösta om vi ska måla eller byta fönster baserat på det underlag som bifogas i kallelsen.

På mötet kommer vi att rösta om vi ska måla eller byta fönster baserat på det underlag som bifogas i kallelsen. Malmö 2009-12-01 Till medlemmarna i Brf. Krabban Härmed kommer kallelsen till extra föreningsstämma den 8:e december. Det som mötet huvudsakligen kretsar kring är huruvida vi ska byta eller måla om/reparera

Läs mer

Brf Kilian 9, Malmö. Underhållsplan 2015-2040

Brf Kilian 9, Malmö. Underhållsplan 2015-2040 Brf Kilian 9, Malmö Underhållsplan 2015-2040 Upprättad av styrelsen 2015 1 Innehåll: 1. Objekt 3 2. Arbetssätt 4 3. Tidigare utförda renoveringar 5 4. Kortfattad byggnadsbeskrivning 6 5. Åtgärdsplan 26

Läs mer

Kv. Oden, Höganäs. Vad är en ägarlägenhet?

Kv. Oden, Höganäs. Vad är en ägarlägenhet? Kv. Oden Kv. Oden, Höganäs Våren 2014 påbörjade vi vårt bostadsprojekt Kv. Oden i Höganäs och vi planerar för inflyttning i juni 2015. Projektet omfattar fyra huskroppar med totalt femtiofem lägenheter.

Läs mer

Brf Stadsträdgården. Skönt modernt boende för ett aktivt liv. Bofakta

Brf Stadsträdgården. Skönt modernt boende för ett aktivt liv. Bofakta Brf Stadsträdgården Skönt modernt boende för ett aktivt liv Bofakta Innehåll Situationsplan... 3 Våningsplan Vindsvåning och våning 2 5... 4 Våning 1 och källarplan... 5 Planritningar 2 rum och kök...

Läs mer

UNDERHÅLLSPLAN. Underhållsplanen sträcker sig fram till 2050. Perioden är vald med tanke på att denna period täcker in husens renoveringscykel.

UNDERHÅLLSPLAN. Underhållsplanen sträcker sig fram till 2050. Perioden är vald med tanke på att denna period täcker in husens renoveringscykel. UNDERHÅLLSPLAN för HSB:s Brf Berglandet Underhållsplanen är utarbetad av styrelsen i brf Berglandet. Syftet med underhållsplanen är i första hand att visa när i tiden det är dags för föreningen att påbörja

Läs mer

Centralt och tillgängligt. boende i Karlaskolan

Centralt och tillgängligt. boende i Karlaskolan Centralt och tillgängligt boende i Karlaskolan Vad är kooperativ hyresrätt? Kungsörs kommun har i samarbete med ett lokalt byggföretag, BroWest Bygg AB, byggt om före detta Karlaskolan till 15 lättillgängliga

Läs mer

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail. Brf Reveljen 1 & 11 Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.com Mäklarinformation version 150701 På föreningens hemsida

Läs mer

FF1 Drift- och Underhållsplanering

FF1 Drift- och Underhållsplanering FF1 Drift- och Underhållsplanering Drift- och underhållsplaner utgör en viktig del av den fastighetsekonomiska analysen. Denna uppgift syftar till att göra en detaljerad plan för drift- och underhåll för

Läs mer

Underhållsplan för Brf Djursborg 2

Underhållsplan för Brf Djursborg 2 Underhållsplan för Brf Djursborg 2 Underhållsplanen har utförts av projektledare från SBC Sveriges BostadsrättsCentrum Projekt-och byggledning. Underhållsplanen kan uppdateras varje år vad avser index

Läs mer

Underhållsplan för Brf Veterinären 5 & 6

Underhållsplan för Brf Veterinären 5 & 6 Underhållsplan för Brf Veterinären 5 & 6 Underhållsplanen har utförts av projektledare från SBC Sveriges BostadsrättsCentrum AB Byggnadsteknisk förvaltning. Underhållsplanen kan uppdateras varje år vad

Läs mer

Nybohovsbacken 73. Nybohovsbacken 73. www.hemverket.se - Sida 1 av 13

Nybohovsbacken 73. Nybohovsbacken 73. www.hemverket.se - Sida 1 av 13 Län Stockholm Gatuadress Kommun Stockholm Storlek 3 rum (2 sovrum) / 71 m² Område Nybohov Tillträde tidigast Enligt överenskommelse " Optimalt läge med nära till allt! Gångavstånd till flera badsjöar.

Läs mer

Sundsbro PASSIVHUS. Välkommen till ett av Sveriges energisnålaste och miljövänligaste flerfamiljshus. 24 lägenheter med guldvittring

Sundsbro PASSIVHUS. Välkommen till ett av Sveriges energisnålaste och miljövänligaste flerfamiljshus. 24 lägenheter med guldvittring Sundsbro PASSIVHUS 24 lägenheter med guldvittring Välkommen till ett av Sveriges energisnålaste och miljövänligaste flerfamiljshus SUNDSBRO Välkommen till vårt första passivhus. Ett sju våningar högt hus

Läs mer

Lägenhet N4-1001 N5-1001. Storlek Placering. 4 rok, 106 kvm Hus N4, N5, våning 1

Lägenhet N4-1001 N5-1001. Storlek Placering. 4 rok, 106 kvm Hus N4, N5, våning 1 4-1001 5-1001 4 rok, 106 kvm Hus 4, 5, våning 1 Lägenhet i markplan med fönster i tre väderstreck som ger utblickar mot gården och Drottninggatan Stor uteplats på 22 kvm i förlängning av vardagsrum Balkong

Läs mer

Underhållsplan 2015 Bostadsrättsföreningen Slottshörnet

Underhållsplan 2015 Bostadsrättsföreningen Slottshörnet Underhållsplan 2015 Bostadsrättsföreningen Slottshörnet 2 Innehållsförteckning Innehåll Innehållsförteckning... 2 1. Allmänna uppgifter... 3 Uppgifter... 3 Allmän information... 3 Beskrivning underhållsplan...

Läs mer

UNDERHÅLLSPLAN 2008-2028

UNDERHÅLLSPLAN 2008-2028 UNDERHÅLLSPLAN 2008-2028 1993-03-30 SBC Väst Tekn. Avd., Conny Johansson Rev. 1993-04-20 SBC Väst Tekn. Avd., Conny Johansson Rev. 1996-11-04 Brf. Höjdena, Peter Kling Rev. 2000-04-16 Brf. Höjdena, Peter

Läs mer

Centralt belägen aktielägenhet om 1 R+Kv 37 m 2 på Köpmansgatan 12 Mariehamn

Centralt belägen aktielägenhet om 1 R+Kv 37 m 2 på Köpmansgatan 12 Mariehamn Centralt belägen aktielägenhet om 1 R+Kv 37 m 2 på Köpmansgatan 12 Mariehamn Presentation Trevlig och välplanerad etta i centralt och lugnt kvarter på Köpmansgatan 12 i Mariehamn. Bostaden inrymmer hall/entré

Läs mer

Län Södermanland Gatuadress Pilos väg 3 Kommun Nyköping Storlek 2 rum (1 sovrum) / 57 m² Område Nyköping Tillträde tidigast Enligt överenskommelse

Län Södermanland Gatuadress Pilos väg 3 Kommun Nyköping Storlek 2 rum (1 sovrum) / 57 m² Område Nyköping Tillträde tidigast Enligt överenskommelse Län Södermanland Gatuadress Kommun Nyköping Storlek 2 rum (1 sovrum) / 57 m² Område Nyköping Tillträde tidigast Enligt överenskommelse " Praktisk planlösning och gott om förvaringsmöjligheter i fasta garderober.

Läs mer

UNDERHÅLLSPLAN 2008-2028

UNDERHÅLLSPLAN 2008-2028 UNDERHÅLLSPLAN 2008-2028 1993-03-30 SBC Väst Tekn. Avd., Conny Johansson Rev. 1993-04-20 SBC Väst Tekn. Avd., Conny Johansson Rev. 1996-11-04 Brf. Höjdena, Peter Kling Rev. 2000-04-16 Brf. Höjdena, Peter

Läs mer

Minnet bästa läget centralt på Väster

Minnet bästa läget centralt på Väster Minnet bästa läget centralt på Väster Stadsdelen Väster från ovan. Från Minnet tar du dig snabbt in till city. Lummigt och lugnt på Regementsgatan. Nytt boende i gammal stadsdel I utkanten av Väster, med

Läs mer

Hyresgästsamråd. Storholmen 3 och 5 Storholmsbackarna 2-44 Projekt-ID: 6001. Datum 2015-02-02 Tid 18.00-20.00 Plats Storholmsbackarna 10

Hyresgästsamråd. Storholmen 3 och 5 Storholmsbackarna 2-44 Projekt-ID: 6001. Datum 2015-02-02 Tid 18.00-20.00 Plats Storholmsbackarna 10 Fastighetsutveckling Distrikt Söderort Hyresgästsamråd Storholmen 3 och 5 Storholmsbackarna 2-44 Projekt-ID: 6001 Datum 2015-02-02 Tid 18.00-20.00 Plats Storholmsbackarna 10 Närvarande Anita Sundh Hyresgäst

Läs mer

BRF ISPRINSESSAN VASTERTORP * STOCKHOLM

BRF ISPRINSESSAN VASTERTORP * STOCKHOLM BRF ISPRINSESSAN VASTERTORP * STOCKHOLM u ~ HÄGERSTENS- BADET. Bo centralt i Västertorp Vid Västertorpsvägen och Skridskovägen byggs nu denna kompletterande bebyggelse på tomt mitt i en uppvuxen miljö

Läs mer

Alingsås. Brf Hasseln, Sörhaga. Nya bostäder vid Säveån i Sörhaga RÄTT TILL ÄNDRINGAR FÖRBEHÅLLES, ANGIVNA YTOR ÄR PRELIMINÄRA 120113

Alingsås. Brf Hasseln, Sörhaga. Nya bostäder vid Säveån i Sörhaga RÄTT TILL ÄNDRINGAR FÖRBEHÅLLES, ANGIVNA YTOR ÄR PRELIMINÄRA 120113 Nya bostäder vid Säveån i Sörhaga RÄTT TILL ÄNDRINGAR FÖRBEHÅLLES, ANGIVNA YTOR ÄR PRELIMINÄRA 120113 fasadskiss, hustyp A Här erbjuds lägenheter med exklusivt läge vid Sävån. Närhet till bad och sandstrand

Läs mer

INFORMATIONSMÖTE BRF TINGVALLEN

INFORMATIONSMÖTE BRF TINGVALLEN VÄLKOMNA TILL INFORMATIONSMÖTE BRF TINGVALLEN 28 JANUARI 2015 LQE-AVTAL MED HSB SKÅNE LQE utvidgat ekonomiskt avtal LQE Långsiktig Qvalitets Ekonomi VERKSAMHETSÅRET Årsstämma Leveransplan Kallelser Årlig

Läs mer

GODA GRANNAR ORDNINGS- OCH TRIVSELREGLER FÖR BOSTADSRÄTTSFÖRENINGEN ÄPPELGÅRDEN

GODA GRANNAR ORDNINGS- OCH TRIVSELREGLER FÖR BOSTADSRÄTTSFÖRENINGEN ÄPPELGÅRDEN GODA GRANNAR ORDNINGS- OCH TRIVSELREGLER FÖR BOSTADSRÄTTSFÖRENINGEN ÄPPELGÅRDEN FÖR DEN GEMENSAMMA TREVNADEN gäller några allmänna regler för alla som bor i bostadsrättsföreningen Äppelgården. Att visa

Läs mer

Information till mäklare som förmedlar bostadsrätter inom Bostadsrättsföreningen Svea artilleri4.

Information till mäklare som förmedlar bostadsrätter inom Bostadsrättsföreningen Svea artilleri4. Mäklar information 2010 www.sveaartilleri4.se Information till mäklare som förmedlar bostadsrätter inom Bostadsrättsföreningen Svea artilleri4. Denna information riktar sig enbart till mäklare som förmedlar

Läs mer

Riskinventering av fastigheter

Riskinventering av fastigheter Malmö stad Miljöförvaltningen er HÄR ÄR ETT EXEMPEL på hur en riskinventering av en fastighet kan genomföras. Notera att detta bara är ett exempel, och inte skall ses som ett komplett underlag för hur

Läs mer

Övergripande Teknisk Beskrivning. Bilaga till kostnadsberäkning Östersund Arena, dat. 2011-08-15

Övergripande Teknisk Beskrivning. Bilaga till kostnadsberäkning Östersund Arena, dat. 2011-08-15 Övergripande Teknisk Beskrivning Bilaga till kostnadsberäkning Östersund Arena, dat. 2011-08-15 Lokalprogram Alternativ 3, dat. 2011-08-15 1(5) ÖVERGRIPANDE TEKNISK BESKRIVNING Utvändiga mark- och installationsarbeten

Läs mer

Uppgifter för mäklare etc angående Brf Ekeby i Ekerö

Uppgifter för mäklare etc angående Brf Ekeby i Ekerö Uppgifter för mäklare etc angående Brf Ekeby i Ekerö Kontaktperson: Sven-Olof Nilsson, ordf Organisationsnummer: 716418-0635 1. Hus Allmänt 1.1 Byggår 1985/1986 1.2 Föreningens adress: Brf Ekeby i Ekerö,

Läs mer

Välkommen till Sigfridsvägen 21

Välkommen till Sigfridsvägen 21 Välkommen till Sigfridsvägen 21 Ett modernt boende med klassisk Ta chansen att bo i det vackra Q-märkta huset från 1935 på Sigfridsområdet. De klassiska detaljerna är väl bevarade, samtidigt som lägenheterna

Läs mer

ÖVERLÅTELSEBESIKTNING

ÖVERLÅTELSEBESIKTNING ÖVERLÅTELSEBESIKTNING Östersund Törnrosen 4 Hårdängegatan 7, 831 47 Östersund Datum 15 05 27 Oktopal AB Samuel Permans gata 2, 831 30 Östersund Tel: 06312 35 30 Organisation Nummer: 5566690144, Fskattesedel

Läs mer

Styrelsen får härmed avge årsredovisning för verksamhetsåret 2012.01.01-2012.12.31

Styrelsen får härmed avge årsredovisning för verksamhetsåret 2012.01.01-2012.12.31 Sidan 1 av 9 Org nr 716444-1615 ÅRSREDOVISNING för Bostadsrättsföreningen Höjdena Styrelsen får härmed avge årsredovisning för verksamhetsåret 2012.01.01-2012.12.31 FÖRVALTNINGSBERÄTTELSE Fastighet Inom

Läs mer

Ovanpå. Inledning. 60 talshuset. Ett examensarbete av Jens Enflo. Arkitekturskolan KTH 2013

Ovanpå. Inledning. 60 talshuset. Ett examensarbete av Jens Enflo. Arkitekturskolan KTH 2013 Ovanpå Ett examensarbete av Jens Enflo Arkitekturskolan KTH 2013 Inledning Att bygga på tak är ett allt vanligare sätt att förtäta befintliga bostadsområden i både inner och ytterstaden. Bristen på mark

Läs mer

Bostadsföreningen Norrbacka u.p.a. Organisationsnummer: 702001,5439

Bostadsföreningen Norrbacka u.p.a. Organisationsnummer: 702001,5439 2009,10,06 Bostadsföreningen Norrbacka u.p.a. Organisationsnummer: 702001,5439 Postadress: Tomtebogatan 26 A, 113 38 STOCKHOLM Om fastigheten Fastighetsbeteckning: Smältan 12, med tre trappuppgångar: Tomtebogatan

Läs mer

AB Helsingborgshem. Agenda

AB Helsingborgshem. Agenda AB Helsingborgshem AB Helsingborgshem Agenda 1. Våra åtaganden 2. Generella implementeringspunkter 3. Kv Turkiet (Portalen) 4. Parkkvarteret 5. Björka/Ödåkra 6. Individuellt Mätsystem 7. Fotokollage över

Läs mer

ÅTGÄRDER, SAMT KOSTNADSSAMMANSTÄLLNING, GÄLLANDE VILLA SUSSEBO

ÅTGÄRDER, SAMT KOSTNADSSAMMANSTÄLLNING, GÄLLANDE VILLA SUSSEBO Kontoret för samhällsbyggnad Torgny Fredling Datum: 2014-07-28 Projekt nr. Dnr: ÅTGÄRDER, SAMT KOSTNADSSAMMANSTÄLLNING, GÄLLANDE VILLA SUSSEBO Upplands Väsby Vilunda 1:580 INNEHÅLL INLEDNING 3. Byggtekniskt

Läs mer

BESIKTNINGSOBJEKTET. Tisdag 2014-10-14 / 2014-0210. Ca 9 º C, solsken. Beskrivning Huvudbyggnad

BESIKTNINGSOBJEKTET. Tisdag 2014-10-14 / 2014-0210. Ca 9 º C, solsken. Beskrivning Huvudbyggnad 5 BESIKTNINGSOBJEKTET Fastighet Fjalar 60, Frejavägen 18 A, Djursholm, Danderyds Kommun Lagfaren ägare Agneta Blom Uppdragsgivare Agneta Blom Närvarande vid besiktningen Agneta Blom Lennart Blom Eva-Karin

Läs mer

Boendeinformation. HSB Brf Ektorpshöjden. Styrelsen Brf Ektorpshöjden. Information avseende fasad, balkong, fönster, mm. 1 (5)

Boendeinformation. HSB Brf Ektorpshöjden. Styrelsen Brf Ektorpshöjden. Information avseende fasad, balkong, fönster, mm. 1 (5) Boendeinformation HSB Brf Ektorpshöjden Information avseende fasad, balkong, fönster, mm. Styrelsen Brf Ektorpshöjden 1 (5) BAKGRUND Rotpartner har under våren 2014 erhållit i uppdrag av styrelsen att

Läs mer

Planskisser och tekniska beskrivningar

Planskisser och tekniska beskrivningar Livskvalitet i Tylöskogen Planskisser och tekniska beskrivningar Bekvämt och exklusivt boende för dig som är 55+ Lägenhetsfakta I hela lägenheten ligger ett Kährs Verona 2-stavs ekparkettgolv, utom i hallen

Läs mer

Mätningar har utförts i ca 22 lägenheter och låga värden 40 90 Bq/m3 har uppmätts i lägenheterna Källarförråd

Mätningar har utförts i ca 22 lägenheter och låga värden 40 90 Bq/m3 har uppmätts i lägenheterna Källarförråd Senast reviderad: 2010 09 02 Ämne Beskrivning Allmänt & tekniskt Fastighetens byggnadsår 1949 Förvärvsdatum 09 nov 09 Uppvärmning Fjärrvärme, en UC per huskropp Antal lägenheter 119 Antal Lokaler 7 (3

Läs mer

Att renovera och energieffektivisera ett miljonprogramsområde

Att renovera och energieffektivisera ett miljonprogramsområde Att renovera och energieffektivisera ett miljonprogramsområde Halmstads Fastighets AB Engagemang Respekt Ansvar Affärsmässighet Energieffektivisering HFAB 1995 2000 2010 2020 2030 2040 2050 150 kwh/m2

Läs mer

UTVÄNDIG MATERIAL- OCH FÄRGBESKRIVNING

UTVÄNDIG MATERIAL- OCH FÄRGBESKRIVNING UPPDRAG Stockholm Lighthouse SH UPPDRAGSNUMMER 3410387300 STATUS BYGGLOVHANDLING UPPDRAGSLEDARE Christina Turesson KUND JM AB TEKNIKOMRÅDE Arkitektur DATUM REVDATUM 2014-11-04 DEL 4, 5 (STORA RADEN) BYGGNADSDEL

Läs mer

Trapphus ( 2 st ) 1 ggr/vecka Sopning och fuktmoppning av golv. Inredningstvättning. Tvättning av fönster entrépartier.

Trapphus ( 2 st ) 1 ggr/vecka Sopning och fuktmoppning av golv. Inredningstvättning. Tvättning av fönster entrépartier. Städfrekvens och arbetsmoment Kungälvs kommun Kärna Kärna Torg 3 A - B Tvättstuga ( 1 st ) och toalett 2 ggr/månad Sopning och fuktmoppning av golv, rengörning av Tvättstuga ( 1 st ) 3 ggr/år Fönstertvätt

Läs mer

EKONOMISK PLAN FÖR BOSTADSRÄTTSFÖRENINGEN FLYGVÄRDINNAN 1. Organisationsnummer 76 96 19 3346. Upprättad den 2010-01-30

EKONOMISK PLAN FÖR BOSTADSRÄTTSFÖRENINGEN FLYGVÄRDINNAN 1. Organisationsnummer 76 96 19 3346. Upprättad den 2010-01-30 EKONOMISK PLAN FÖR BOSTADSRÄTTSFÖRENINGEN FLYGVÄRDINNAN 1 Organisationsnummer 76 96 19 3346 Upprättad den 2010-01-30 Som registrerats ursprungligen 2008-09-23 Denna ekonomiska plan har upprättats med följande

Läs mer

Dalgången. Nockebyhov

Dalgången. Nockebyhov Dalgången Nockebyhov Trivsamt i Nockebyhov Nockebyhov är en trivsam stadsdel i Bromma. Området ligger attraktivt beläget mellan Mälarens strand och Judarskogen vilket ger närhet till såväl naturreservat

Läs mer

Län Västernorrland Gatuadress Flemminggatan 6 Kommun Sollefteå Storlek 5 rum (3 sovrum) / 158 m² Tillträde tidigast

Län Västernorrland Gatuadress Flemminggatan 6 Kommun Sollefteå Storlek 5 rum (3 sovrum) / 158 m² Tillträde tidigast Län Västernorrland Gatuadress Kommun Sollefteå Storlek 5 rum (3 sovrum) / 158 m² Tillträde tidigast Enligt överenskommelse " Huset har en fantastisk själ och ett ljus utöver det vanliga. Alla gamla bevarade

Läs mer

Län Skåne Gatuadress Aktrisgatan 16 Kommun Malmö Storlek 2 rum (1 sovrum) / 62 m² Område Lindeborg Tillträde tidigast Enligt överenskommelse

Län Skåne Gatuadress Aktrisgatan 16 Kommun Malmö Storlek 2 rum (1 sovrum) / 62 m² Område Lindeborg Tillträde tidigast Enligt överenskommelse Län Skåne Gatuadress Kommun Malmö Storlek 2 rum (1 sovrum) / 62 m² Område Lindeborg Tillträde tidigast Enligt överenskommelse " Välskött förening med fin gård och med närhet till bland annat Emporia, Svågertorp

Läs mer

Checklista för flerbostadshus

Checklista för flerbostadshus 1 (8) Checklista för flerbostadshus Övergripande frågor om egenkontroll 1 Långsiktlig planering och underhåll av fastigheterna Del A När byggdes fastigheten? Hur länge har ni ägt fastigheten? Har ni fastigheter

Läs mer

Björngårdsgatan 3. Län Stockholm Gatuadress Björngårdsgatan 3 Kommun Stockholm Storlek 1 rum / 24 m² Område Södermalm - Maria. Enligt överenskommelse

Björngårdsgatan 3. Län Stockholm Gatuadress Björngårdsgatan 3 Kommun Stockholm Storlek 1 rum / 24 m² Område Södermalm - Maria. Enligt överenskommelse Län Stockholm Gatuadress Kommun Stockholm Storlek 1 rum / 24 m² Område Södermalm - Maria Tillträde tidigast Enligt överenskommelse www.hemverket.se - Sida 1 av 10 Interiör Hall med klinkergolv, klädhängare

Läs mer

Bostadsrättsföreningen/ApartHotel/Attaché/

Bostadsrättsföreningen/ApartHotel/Attaché/ Kostnadskalkylför BostadsrättsföreningenApartHotelAttaché 76962761993 Stockholmsstad 113 Innehållsförteckning Sid 1. Allmännaförutsättningar 3 2. Beskrivningavtomträtten 3 3. Beräknadkostnadförföreningensfastighetsförvärv

Läs mer

Innehållsförteckning

Innehållsförteckning Innehållsförteckning 1 Huset. Från ord till bild. 2 Huset. Vilket ord passar in? 3 I vardagsrummet. Från ord till bild. 4 I vardagsrummet. Vilket ord passar in? 5 I köket. Från ord till bild. 6 I köket.

Läs mer

Län Stockholm Gatuadress Karl Martins väg 4 Kommun Vaxholm Storlek 1 rum / 21 m² Område Alfågeln Tillträde tidigast Enligt överenskommelse

Län Stockholm Gatuadress Karl Martins väg 4 Kommun Vaxholm Storlek 1 rum / 21 m² Område Alfågeln Tillträde tidigast Enligt överenskommelse Län Stockholm Gatuadress Kommun Vaxholm Storlek 1 rum / 21 m² Område Alfågeln Tillträde tidigast Enligt överenskommelse " Fräsch och attraktivt belägen bostad - bara att flytta in! Bekvämt läge med entréplan.

Läs mer

Bygganmälan Brf Flamingo

Bygganmälan Brf Flamingo Datum: Bygganmälan Brf Flamingo Medlem: Centrumslingan nr: Upplåtelseavtalsnr: I fälten nedan följer ni anvisningarna och fyller i vilka renoveringsåtgärder ni avser att genomföra. För att tydliggöra vad

Läs mer

Helrenoverat BOSTADSHUS i 1 ¾ plan med källare på Valborgsvägen 9 Söderby, Lemland

Helrenoverat BOSTADSHUS i 1 ¾ plan med källare på Valborgsvägen 9 Söderby, Lemland Helrenoverat BOSTADSHUS i 1 ¾ plan med källare på Valborgsvägen 9 Söderby, Lemland Presentation Moderniserat och helrenoverat bostadshus med något av Villa Villekullakänsla, tillhörande dubbelgarage och

Läs mer

ENERGIDEKLARATION BRF Friheten

ENERGIDEKLARATION BRF Friheten 2010 ENERGIDEKLARATION BRF Friheten Årsta 2010-02-10 Lars-Johan Lindberg Energiexpert Vad är en energideklaration? Energideklarationen beskriver en byggnads energianvändning. Lagen om energideklarationer

Läs mer

Götaland Kommun Göteborg Storlek 2 rum (1 sovrum) / 45 m² Tillträde tidigast

Götaland Kommun Göteborg Storlek 2 rum (1 sovrum) / 45 m² Tillträde tidigast Län Västra Gatuadress Götaland Kommun Göteborg Storlek 2 rum (1 sovrum) / 45 m² Tillträde tidigast Enligt överenskommelse " Charmig och ljus funkistvåa. Ett stenkast till Slottskogen och Linné med natur

Läs mer

Upprustning av. kvarteret Drakenberg

Upprustning av. kvarteret Drakenberg Upprustning av kvarteret Drakenberg Fakta om ditt hus och ditt kvarter HISTORIK På 1870-talet startades snickerifabriken Ligna i området. Området runtom Ligna utvecklades till ett industri- och hantverksområde,

Läs mer

Bostadsrättsföreningen Torsdammen Fastighetsåtgärder 2015

Bostadsrättsföreningen Torsdammen Fastighetsåtgärder 2015 Bostadsrättsföreningen Torsdammen Fastighetsåtgärder 2015 Inbokade arbeten: Datum: Plan Status Övrigt: Faktura har fler arbeten så som justering/slipning/behandling av entrédörrar, montering av portdörrshållare,

Läs mer

Stilfullt inredd AKTIELÄGENHET om 3 R+K, 70 m 2 med balkong på Scheffersgränd 4 B i Mariehamn

Stilfullt inredd AKTIELÄGENHET om 3 R+K, 70 m 2 med balkong på Scheffersgränd 4 B i Mariehamn Stilfullt inredd AKTIELÄGENHET om 3 R+K, 70 m 2 med balkong på Scheffersgränd 4 B i Mariehamn Presentation Fint och smakfullt renoverad trerumslägenhet med stilfull inredning på våning III Scheffersgränd

Läs mer

Fredriksbergsgatan 2. 4 300 kr/månad Gatuadress Fredriksbergsgatan 2

Fredriksbergsgatan 2. 4 300 kr/månad Gatuadress Fredriksbergsgatan 2 Utgångspris 1 495 000 kr Avgift 4 300 kr/månad Gatuadress Kommun Malmö Storlek 3 rum och kök / 80 m² Område Slussen/Rörsjöparken Tillträde tidigast Enligt överenskommelse Rymlig sekelskifteslägenhet med

Läs mer

GRON-FRI ENKEL LÖSNING PÅ VÄXANDE PROBLEM GARANTERAD EFFEKT

GRON-FRI ENKEL LÖSNING PÅ VÄXANDE PROBLEM GARANTERAD EFFEKT ENKEL LÖSNING PÅ VÄXANDE PROBLEM GRON-FRI Effektivt mot alger och lav. För alla ytor utomhus. Fasader, tak, staket, marksten, trätrall, murar, markiser m.m. GARANTERAD EFFEKT Upptäck fördelarna med Grön-Fri.

Läs mer

Vi levererar helhetslösningar

Vi levererar helhetslösningar R TM Vi levererar helhetslösningar Ett badrum är en helhet. Vi levererar den. Ett nytt badrum ska du leva med under lång som vi alla tycker oss ha för lite av. Men tar du dig att läsa vår broschyr, får

Läs mer

BOSTADSRÄTT - BREVIK - ACCEPTPRIS: 2 250 000:-

BOSTADSRÄTT - BREVIK - ACCEPTPRIS: 2 250 000:- BOSTADSRÄTT - BREVIK - ACCEPTPRIS: 2 250 000:- Bekvämt boende! Lägenhet med ljust och generöst vardagsrum med utgång till inglasad balkong med sjöglimt. Ljust kök med rejäl plats för matbord. Ett sovrum

Läs mer

R ONNEBY Ä NGSKNARREN 4 Södra Höggatan 2, 372 36 Ronneby

R ONNEBY Ä NGSKNARREN 4 Södra Höggatan 2, 372 36 Ronneby www.sandelinab.se R ONNEBY Ä NGSKNARREN 4 Södra Höggatan 2, 372 36 Ronneby Överlåtelsebesiktning för säljare 2015-01-13 2010 SBR Byggingenjörerna Version 2010:1 Adress Telefon Org nr Internet E-post Nissestigen

Läs mer

Riskinventering av fastigheter

Riskinventering av fastigheter er HÄR ÄR ETT EXEMPEL på hur en riskinventering av en fastighet kan genomföras. Notera att detta bara är ett exempel, och inte skall ses som ett komplett underlag för hur en inventering skall utföras.

Läs mer

SELWO ESTEPONA - MALAGA FANTASTISKA LÄGENHETER REDUCERAT MED UPP TILL 52%

SELWO ESTEPONA - MALAGA FANTASTISKA LÄGENHETER REDUCERAT MED UPP TILL 52% FANTASTISKA LÄGENHETER REDUCERAT MED UPP TILL 52% Beläget inom ett privat gemensamt område med en 9-håls golfbana, ligger bara en kort bit från Estepona centrum och stranden. Dessa stora och rymliga lägenheter

Läs mer

Ansökan om godkännande av större ombyggnation / renovering av lägenhet i Brf Högborgen. Definition av större ombyggnation och renovering

Ansökan om godkännande av större ombyggnation / renovering av lägenhet i Brf Högborgen. Definition av större ombyggnation och renovering Ansökan om godkännande av större ombyggnation / renovering av lägenhet i Brf Högborgen Introduktion På förekommen anledning och för att undvika problem och störningar vid större ombyggnation och/eller

Läs mer

Användning av energi medför en miljöpåverkan! Energi & egenkontroll för fastighetsägare. Infoträff - Energieffektivisering i fastigheter

Användning av energi medför en miljöpåverkan! Energi & egenkontroll för fastighetsägare. Infoträff - Energieffektivisering i fastigheter Infoträff - Energieffektivisering i fastigheter Energi & egenkontroll för fastighetsägare Treårigt projekt, drivs av Miljöförvaltningen i Stockholm Ulrika Persson projektledare Fastighetsägare till flerfamiljshus

Läs mer

SALEMS KOMMUN FASAD FASAD RITNGEN GÄLLER I PRINCIP S1, S2 OCH S3 HUSTYP S1, S2 OCH S3 FASTIGHET: ADRESS: PLAN, FASADER SKALA 1:100 DATUM: K3 BAD KÖK

SALEMS KOMMUN FASAD FASAD RITNGEN GÄLLER I PRINCIP S1, S2 OCH S3 HUSTYP S1, S2 OCH S3 FASTIGHET: ADRESS: PLAN, FASADER SKALA 1:100 DATUM: K3 BAD KÖK BAD KÖK MAX 140 S1 OCH S2 MAX 250 15 SEKTION/ 10 RITNGEN GÄLLER I PRINCIP S1, S2 OCH S1 S2 HUSTYP S1, S2 OCH ENTRETAK, SADEL/ PULPET SKALA 1:100 DATUM: K3 BAD VARDAGSRUM UTFÖRES VÄGG I MIN BRAND-KLASS

Läs mer

Vi gillar den inglasade balkongen, den känns nästan som ett extra rum och man kan sitta ute även när det regnar. -- Rickard Lundblad, säljare

Vi gillar den inglasade balkongen, den känns nästan som ett extra rum och man kan sitta ute även när det regnar. -- Rickard Lundblad, säljare Län Skåne Gatuadress Kommun Kristianstad Storlek 3 rum (2 sovrum) / 87 m² Område Vilan Tillträde tidigast Enligt överenskommelse " Vi gillar den inglasade balkongen, den känns nästan som ett extra rum

Läs mer

Willa Nordic ONV BOLIG. Modern dansk design. www.willanordic.se

Willa Nordic ONV BOLIG. Modern dansk design. www.willanordic.se Willa Nordic ONV BOLIG Modern dansk design www.willanordic.se ETT HUS SOM STICKER UT & SAMTIDIGT SMÄLTER IN, LIKT EN KAMELEONT MED INTEGRITET DET HÄR ÄR ETT HEM FÖR FAMILJEN SOM VILL BO I ETT ARKITEKTRITAT

Läs mer

Brf. Stohagen. Bostadsrätter på gamla bageritomten Kvarteret Masten i Västerås. Prisvärt. Nära. Ombonat. Genomtänkt. brf.stohagen.

Brf. Stohagen. Bostadsrätter på gamla bageritomten Kvarteret Masten i Västerås. Prisvärt. Nära. Ombonat. Genomtänkt. brf.stohagen. Brf. Stohagen Bostadsrätter på gamla bageritomten Kvarteret Masten i Västerås brf.stohagen.se Prisvärt. Nära. Ombonat. Genomtänkt Brf. Stohagen Nu ger vi fler människor möjligheten att bo i sin egen bostadsrätt

Läs mer

Miljon program su ppru s tnin g ger attrak tiv a m iljöv änliga boen den och 6 000 n y a jobb

Miljon program su ppru s tnin g ger attrak tiv a m iljöv änliga boen den och 6 000 n y a jobb Miljon program su ppru s tnin g ger attrak tiv a m iljöv änliga boen den och 6 000 n y a jobb 2010-09-02 V i satsar på y tterstaden Vi lovar 6 000 nya jobb Satsningen möjliggör ett tillskott på 70 miljoner

Läs mer

Information om Ro-Ru

Information om Ro-Ru Bröderna bygg & plattsättning AB bygg och plattsättning AB Innehåll...1 Inledande information om...3 Bakgrund...3...3 Vad vi kan erbjuda...3 Helentreprenad...3 Köksrenoveringar...4 Badrum...4 Bastu...4

Läs mer

UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-06-20

UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-06-20 Fastighet Dykaren Brf Dykaren 12 Alströmergatan 45, i Stockholm UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-06-20 Brf Dykaren 12 Kv Dykaren Alströmergatan 45 112 46 Stockholm Fastighetsägarna Stockholm AB Box

Läs mer

BRF Hvitfeldtsgatan 13 UNDERHÅLLSPLAN 2012 2042

BRF Hvitfeldtsgatan 13 UNDERHÅLLSPLAN 2012 2042 BRF Hvitfeldtsgatan 13 UNDERHÅLLSPLAN 2012 2042 1 Objekt... 2 2 Syfte och omfattning... 2 3 Underlag... 2 4 Tidigare renoveringar... 3 5 Kortfattad byggnadsbeskrivning... 3 6 Sammanfattning av underhållsbehov

Läs mer

Karmansbo 1. Län Västmanland Typ Gård Kommun Skinnskatteberg Storlek 125 m2 Område Karmansbo Tillträde tidigast Gatuadress Karmansbo 1

Karmansbo 1. Län Västmanland Typ Gård Kommun Skinnskatteberg Storlek 125 m2 Område Karmansbo Tillträde tidigast Gatuadress Karmansbo 1 Karmansbo 1 Län Västmanland Typ Gård Kommun Skinnskatteberg Storlek 125 m2 Område Karmansbo Tillträde tidigast Gatuadress Karmansbo 1 enligt överenskommelse Hästgård med boningshus från 1929 som genomgått

Läs mer

TRIVSELREGLER Ansvar för ordningen För vem gäller reglerna Vad händer om ordningsreglerna inte följs Har Du frågor

TRIVSELREGLER Ansvar för ordningen För vem gäller reglerna Vad händer om ordningsreglerna inte följs Har Du frågor TRIVSELREGLER Ansvar för ordningen Styrelsens uppgift är att ta hand om den löpande förvaltningen av föreningen och verkställa de beslut som föreningsstämman fattar. I den löpande förvaltningen ingår också

Läs mer

Krukmakaren, Enköping

Krukmakaren, Enköping OMBYAD TILL UDOMSBOÄDER EMESAMMA FÖRUTSÄTTIAR FÖR SAMTLIA LÄEHETER! emensam tvättstuga i plan 1! Lägenhetsförråd på plan 1! Alla lägenheter har bredbandsanslutning för data, tele och tv! Cykelparkering

Läs mer

Vänliga, tillmötesgående och korrekta

Vänliga, tillmötesgående och korrekta Det skulle vara bra med en grillplats Vänliga, tillmötesgående och korrekta Vi hör tydligt hissen Under hösten 2013 genomfördes en undersökning för att ta reda på hur du som hyresgäst uppfattar Saxborn

Läs mer

Kommun Göteborg Storlek 2,5 rum (2 sovrum) / 57,5 m² Område. Tillträde tidigast

Kommun Göteborg Storlek 2,5 rum (2 sovrum) / 57,5 m² Område. Tillträde tidigast Län Västra Gatuadress Götaland Kommun Göteborg Storlek 2,5 rum (2 sovrum) / 57,5 m² Område Norra Guldheden Tillträde tidigast Enligt överenskommelse " Trevlig och lugnt område med närhet till både city

Läs mer

UNDERHÅLLSPLAN. Planerat underhåll. X Rensning av brunnsgaller (JM) X Renhållning i anslutning till avfallsbehållare (KEAB)

UNDERHÅLLSPLAN. Planerat underhåll. X Rensning av brunnsgaller (JM) X Renhållning i anslutning till avfallsbehållare (KEAB) Bostadsrättsförening, namn Fastighetsbeteckning Datum BRF Älvsjö Centrum1 Armborstet 2 2011 0617 Adress Älvsjövägen 12 Postadress 12545 Älvsjö UNDERHÅLLSPLAN Syftet med underhållsplanen är att skapa förutsättningar

Läs mer

STOBY ERBJUDER DIG IDÉ, KUNSKAP & KVALITET

STOBY ERBJUDER DIG IDÉ, KUNSKAP & KVALITET ENTREPRENAD LEVERANS AV INDUSTRIFÄRG BALLINGSLÖV STOBY FLYGAREGATAN12GATA ATANAN STOBY VÄXJÖ STOBY HALMSTAD BUTIK & ENTREPRENAD BUTIK, ENTREPRENAD, INDUSTRI & HUVUDKONTOR OKVÄGEN 6 BALLINGSLÖV STOBY NÄSSELVÄGEN

Läs mer