Underhållsplan Underhållsplan,2014,, Brf,Sippan,i,Solna,,769605;1155,

Storlek: px
Starta visningen från sidan:

Download "Underhållsplan 2014. Underhållsplan,2014,, Brf,Sippan,i,Solna,,769605;1155,"

Transkript

1 Underhållsplan 2014 Underhållsplan2014 BrfSippaniSolna769605;1155

2 Innehållsförteckning NULÄGESANALYS* 3 INSPEKTERADE*FASTIGHETER* 3 STATUSBESIKTNING* 4 RAPPORT* 15 FÖRKORTNINGAR* 15 RÅGEN*9*HUS*13* 16 RÅGEN*4*HUS*17* 17 RÅGEN*7*HUS*19* KOSTNADSUPPSKATTNING/INTERVALLER* 19 TVÄTTSTUGOR* 19 FASADER* 19 TAK* 19 HISSAR* 19 BALKONGER* 20 FÖNSTER* 20 SPILLVATTENSTAMMAR* 20 TRAPPHUS* 20 VENTILATIONSAGGREGAT* 20 EL* 20 FJÄRRVÄRMECENTRAL* 20 ÖVRIGT* 20 Underhållsplan2014 BrfSippaniSolna769605;1155

3 Nulägesanalys AvBrfSippanharEffektkonsult&fastighetsförvaltningABfåttuppdraget attutföraentekniskundersökningavbyggnadernapårubricerade fastigheterförattskapaenunderhållsplan.utlåtandetinnehålleren bedömningavbehovetdenärmsta30årenavplanerade underhållsåtgärderibyggnadernasamtengrovkostnadsbedömningav varjeåtgärd.besiktningenutfördes22januari2014ochärenokulär översyn.underhållsplanenäruppdateradochrevideradavsittande styrelse. Inspekterade fastigheter BostadsrättsföreningensfastigheterliggerpåÅbergssonsväg1317och19 samt21;45.fastigheternaärbyggdaochuppförda1989;90ochbestårav totaltfyrabyggnader: Åbergssonsväg1317och19somärhögbyggnader. Åbergssonsväg21;45somärenlågbyggnad. Samtligafastigheterharfasaderitegelochtakenbeståravbetongpannor samtplåtbekläddadelariövrigt.balkongerigjutnaplattormedfronterav Underhållsplan2014 BrfSippaniSolna769605;1155

4 stenskivorochplåt.föreningenhartrestörretvättstugormedolikaårpå maskinerna.detfinnsenkrypvindsamtkällareihus19medplåtförråd. Värmecentralenärengemensamhetsanläggningförhelaområdetdådet ärsolnabostädersomägtochdrivitområdettidigare.detfinnstrehissari fastigheternasomidagharskötselavtal.fastigheternaharkabel;tv.husen ärbeskaffademedfrånluftviaventilationsaggregatpåvinden. Statusbesiktning Vidgenomgångavfastigheternaladesstörstviktpåfasadertaktrapphus samttvättstugor.ingenbesiktningharskettinneilägenhetersåingakök ellerbadrumäranalyserade.dådetärenbostadsrättsföreningkommer detmestainneilägenheternaändåattfallapåbostadsinnehavaren.taken äridagbetongpannordubbelkupigaochdessaharenlivslängdom40;50 år.takpappoläkthåller20;30år.vidbesiktningstillfälletkunde konstaterasattpannornaserutattvaraibraskickmenmedvisspåväxt frånväderovind.utbyggnaderärplåtbeklädda. Underhållsplan2014 BrfSippaniSolna769605;1155

5 Fasadernapåfastigheternabeståridagavtegelvilketäriprincip underhållsfritt.tegletkankommabehovavtvättiframtiden. Underhållsplan2014 BrfSippaniSolna769605;1155

6 Balkongernahargjutnaplattorochharbekläddafrontermedbådeplåt ochmineritskivorsamträckenavaluminium.vissaärkraftigt nedsmutsademeniövrigtintakta. Fönsterochbalkongdörrarärbekläddamedplåt.Härfinnsalltidriskmed kondensbakomplåtarnasomkangeupphovtillröta.vissaav fönsterbleckenflagnarochäravplåt. Underhållsplan2014 BrfSippaniSolna769605;1155

7 Entréportarärgjordaavaluminium. Trapphusbekläddamedstengolvsamtmåladeväggar.Ihusnr17har manrenoveratentrénochlagtnyttklinkergolvsamtmålatmålningäven Underhållsplan2014 BrfSippaniSolna769605;1155

8 utfördihusnr13.manharävenbyttlägenhetsdörrarifastigheternatill säkerhetsdörrargällerihusnr13;17.ihusnr19;45kvarstårbytetill säkerhetsdörrar Tvättstugorfinnsihusnr1317&19bestyckademedMieleo Wascatormaskinerhus13&17avnyaredatumochhus19avdenäldre typen.ihusnr13ärtvättstugansytskiktrenoveratnyttkakelklinkerspå golvet.ihusnr17ärdetmåladeväggarochklinkerspågolvetgolvet. Underhållsplan2014 BrfSippaniSolna769605;1155

9 Bildavdenäldretvättstuganihusnr19. Källaremeddessinstallationerochförråddettagällerhusnr19hus13 och17harkrypgrund. Underhållsplan2014 BrfSippaniSolna769605;1155

10 Källarförrådochsynligadelaravspillvattenledningarigjutjärn. Lågbyggnadenmedsinaplåtbekläddatak. Underhållsplan2014 BrfSippaniSolna769605;1155

11 Cykelförrådsomäribehovavrenovering. Underhållsplan2014 BrfSippaniSolna769605;1155

12 Cykelgarageutanförhus17. Altandel. Dörrpåvåningsplantilltrapphus. Underhållsplan2014 BrfSippaniSolna769605;1155

13 Omgjordentrémedpostboxar. Låghusdelen. Underhållsplan2014 BrfSippaniSolna769605;1155

14 Hus19 Renoveradhisskorgihusnr17. Underhållsplan2014 BrfSippaniSolna769605;1155

15 Befintlighisskorgihusnr13 Rapport Fastigheternaärtotaltsettiettbraskickdemskötesochunderhållesi föreningensmeningattförädla.detsomtittatspåvidbesiktningarnaär meraenligtdetönskemålföreningenharattvetaframtida reparationer/renoveringar.itabellernanedanärframräknatintervallmed ca.kostnaderräknadeidagensprisintervaller.vissaärprissattaikroch andrakrperm2.priserexkluderarmoms. Ingetakutbehovavrenoveringföreliggerutanattmankanfölja intervallerna.finnsliteytskiktsunderhållsåsomträfasadenpåförråden (enligtbild)samtdenedsmutsadebalkongdelarnasombehövertidigare tillsyn. Tvättstugani19ärorenoveradidagslägetmenskicketärändågott. Badrumsomärrenoverade2002och2007börhanästaintervallomca40; 50årfördetfallmananväntsigavporslinpåväggarochgolv. Byteavtakpappochläktbörinplanerasinomnärmstaårenpå fastigheternamedtegeltaken. Förkortningar TV=Tvättmaskin TS=Torkskåp Underhållsplan2014 BrfSippaniSolna769605;1155

16 TT=Torktumlare Rågen 9 hus 13 Åtgärder Senast Intervall Kostnad per st/m2 kr Totalrenovering av hiss st Totalrenovering tvättstuga ca 30 m m2 * golvytan kr golv vägg tak snick. Totalrenovering av samtliga badrum st Renovering entré trapphus st Ytskiktsrenoverin g. Renovering samtliga våningsplan Ingår ovan Ny el belysning ca kr Installation av säkerhetsdörrar st Ny torktumlare/tvättstuga Tak: byte av takpannor ca 780 m2 Tak: byte papp och läkt Plåttak dela av yttertak ca 78 m2 Balkonger Fönster/balkongdörrar Ventilationsaggregat vind Fasader tegel tvättning ca m st TV kr TS kr TT kr Avfukt kr mangel kr 650 m2 ca m2 ca m2 ca kr st st st m2 ca kr ca kr Underhållsplan2014 BrfSippaniSolna769605;1155

17 Rågen 4 hus 17 Åtgärder Senast Intervall Kostnad per st/m2 kr Totalrenovering av hiss st Totalrenovering tvättstuga ca 30 m m2 * golvytan ca kr golv vägg tak snick. Totalrenovering av samtliga badrum st Renovering entrè trapphus st Ytskiktsrenoverin g. Renovering samtliga våningsplan Ingår ovan Ny el belysning ca kr Installation av säkerhetsdörrar st Ny torktumlare/tvättstuga st Tak: byte av takpannor ca 910 m2 Tak: byte papp och läkt Plåttak del av yttertak ca 91 m2 Balkonger Fönster/balkongdörrar Ventilationsaggregat vind Fasader tegel tvättning ca m m m m st st st m2 TV kr TS kr TT kr Avfukt kr mangel kr ca ca ca ca kr ca kr Rågen 7 hus 19 Åtgärder Senast Intervall Kostnad per st/m2 kr Underhållsplan2014 BrfSippaniSolna769605;1155

18 Totalrenovering av hiss Totalrenovering tvättstuga ca 30 m2 Totalrenovering av samtliga badrum Renovering entré trapphus Renovering samtliga våningsplan Ny el belysning Installation av säkerhetsdörrar Ny torktumlare/tvättstuga st m2 * golvytan st st 2015 Ingår ovan st st Tak: byte av takpannor ca 506 m2 650 m2 ca Tak: byte papp och läkt Plåttak del av yttertak ca 506 m2 Balkonger Fönster/balkongdörrar Ventilationsaggregat vind Fasader tegel tvättning ca m2 750 m2 ca m2 ca kr st st st ca kr ca kr kr golv vägg tak snick. Ytskiktsrenoverin g. finns offert kr TV kr TS kr TT kr Avfukt kr mangel kr 650 m2 750 m m st st st Lågdel Åtgärder Senast Intervall Kostnad per st/m2 kr Fasader tegel tvättning ca 396 m %m2 ca%396%000%kr% Underhållsplan2014 BrfSippaniSolna769605;1155

19 Plåttak ca 252 m2 yttertak Fönster %m %000%st ca%252%000%kr% ca%46%000%kr% Låghus Åtgärder Senast Intervall Kostnad per st/m2 kr Fasader tegel tvättning ca 576 m2 Plåttak ca 432 m2 yttertak Fönster %m %m %000%st ca%576%000%kr% ca%432%000%kr% ca%48%000%kr% Kostnadsuppskattning/intervaller Tvättstugor Maskinerharenlivslängdpåca15;20årberoendepåanvändning. Kostnad:tvättmaskinca35000kr/sttorkskåpca20000kr/sttumlareca 17000kr/sttork/avfuktareca24000kr/stsamtmangelca15000kr/st. PrisernabaseradepåMieleellerWascatorsproffsmaskiner. Fasader Tvättningavtegelfasaderinnanmantarbeslutomtvättningbör sakkunnigförstsäkerställabehovet.kanvarasåattbehovinteföreligger alls.kostnadca1000krkvm.dettaväldigtgrovtuppskattat. Tak Pappochläktlivslängdca20;30årkostnadca750krm2samttegelpannor (betongpannor)livslängdca40;50årkostnadca650krm2.plåtdelar målningharenlivslängdpåca15;18årkostnadca1000krm2. Hissar Livslängdca30år.Kostnaduppskattadtill400000krperhiss. Underhållsplan2014 BrfSippaniSolna769605;1155

20 Balkonger Livslängdca40årkostnadca45000kr/st. Fönster Renoveringavbefintligafönsterutföresmed10;30årsintervallerkostnad ca2000kr/st. Spillvattenstammar Stambyteutförsvart40;50:deår.Kostnadberäknadca150000perbadrum inklusivekällaremedövrigautrymmen.kökexklusivesnickerierca 35000kr/stseparatatoaletterca25000kr/st.Stambyteytskiktutförs samtidigtavekonomiskaskäl. Trapphus Tidsintervall15;20årtillenuppskattadkostnadomca250000kr/st. Ventilationsaggregat Livslängd25;30år.Kostnadca350000kr/st. EL El;stammarochstigarelivslängdca50år.Kostnadca krper fastighet. Fjärrvärmecentral Livslängd20;25årdelavca250000kr. Övrigt Läggningklinkergolv800krm2t.extvättstuga. Målningtakväggarochsnickerierit.extvättstugauppskattaskostnaden tillca650krm2*rummetsyta. (Ettrummedgolvyta30m2beräkningär30*650=19500kr) Underhållsplan2014 BrfSippaniSolna769605;1155

Brf Flygplansfabriken 130619. (för en person) 2 Rum 39 m 2 plan 2. storlek: yta: våning: Symbolförklaring: frys + kyl. diskmaskin.

Brf Flygplansfabriken 130619. (för en person) 2 Rum 39 m 2 plan 2. storlek: yta: våning: Symbolförklaring: frys + kyl. diskmaskin. 1201 39 m 2 LH 1201 fönster () TRAPPHUS 1202 38 m 2 LH 1202 fönster () 1203 43 m 2 LH 1203 LH 1204 fönster () 1204 47 m 2 ITILLIADE HUS 1,5 fönster () LH 1204 1205 39 m 2 1,5 LH 1204 LH 1205 fönster ()

Läs mer

Brf Flygplansfabriken 130619. (för en person) 2 Rum 39 m 2 plan 3. storlek: yta: våning: Symbolförklaring: frys + kyl. diskmaskin.

Brf Flygplansfabriken 130619. (för en person) 2 Rum 39 m 2 plan 3. storlek: yta: våning: Symbolförklaring: frys + kyl. diskmaskin. 1301 39 m 2 LH 1301 TRAPPHUS 1302 38 m 2 LH 1302 1303 43 m 2 LH 1303 LH 1304 1304 47 m 2 ITILLIADE HUS 1,5 LH 1304 1305 39 m 2 1,5 LH 1304 LH 1305 1306 43 m 2 1,5 LH 1306 ELC 1307 43 m 2 1,5 ELC LH 1307

Läs mer

Här kommer din MEDGIVANDEBLANKETT

Här kommer din MEDGIVANDEBLANKETT Hej! Här kommer en medgivandeblankett för renoveringen i ditt hus. Genom att skriva under blanketten godkänner du att vi genomför renoveringen och de åtgärder som ingår. Själva hyresnivån förhandlas fram

Läs mer

Underhållsplan för Brf Månstenen 18/11 2014. Innehåll. 1. Objekt 2. 2. Syfte och omfattning 3. 3. Underlag 3. 4. Tidigare renoveringar 4

Underhållsplan för Brf Månstenen 18/11 2014. Innehåll. 1. Objekt 2. 2. Syfte och omfattning 3. 3. Underlag 3. 4. Tidigare renoveringar 4 Underhållsplan för Brf Månstenen 18/11 2014 Innehåll. 1. Objekt 2 2. Syfte och omfattning 3 3. Underlag 3 4. Tidigare renoveringar 4 5. Kortfattad byggnadsbeskrivning 4 6. Underhållsbehov och avsättning

Läs mer

KRISTIANSTADS KOMMUN VITTSKÖVLE 21:4 VITTSKÖVLE HEMMET VITTSKÖVLEVÄGEN 104 297 91 VITTSKÖVLE

KRISTIANSTADS KOMMUN VITTSKÖVLE 21:4 VITTSKÖVLE HEMMET VITTSKÖVLEVÄGEN 104 297 91 VITTSKÖVLE BILAGA 3 KRISTIANSTADS KOMMUN VITTSKÖVLE 21:4 VITTSKÖVLE HEMMET VITTSKÖVLEVÄGEN 104 297 91 VITTSKÖVLE STATUSBESIKTNING UT- OCH IN- VÄNDIGT AV FASTIGHET MED BYGGNADER Kristianstad 2004-08-19 FB Engineering

Läs mer

Maratonvägen Ombyggnation i Halmstad

Maratonvägen Ombyggnation i Halmstad Maratonvägen Ombyggnation i Halmstad Maratonvägen 579 lgh Den nya tidens hyresrätt 1 Byggmöte 18 november i Göteborg Maratonvägen Ett miljonprogramsområde i Halmstad 21 huskroppar med totalt 579 lägenheter

Läs mer

Brf Flygplansfabriken 130619. (för en person) 2 Rum 56 m 2 plan 6. storlek: yta: våning: Symbolförklaring: BR 0,75. frys + kyl. diskmaskin.

Brf Flygplansfabriken 130619. (för en person) 2 Rum 56 m 2 plan 6. storlek: yta: våning: Symbolförklaring: BR 0,75. frys + kyl. diskmaskin. 1601 56 m 2 ITILLIADE HUS 0,75 ITILLIADE 0,75 LH 1601 LH 1602 1,5 1,5 ETRÉ 1602 36 m 2 ITILLIADE 0,75 0,75 0,75 0,75 LH 1602 LH 1603 1,5 1,5 ETRÉ 1603 36 m 2 ITILLIADE ITILLIADE 0,75 0,75 0,75 0,75 0,75

Läs mer

Underhållsplan. Brf Körsbäret 19-21. Annedal 23:19, 23:20, 23:21. Datum för utskrift: 2015-03-05

Underhållsplan. Brf Körsbäret 19-21. Annedal 23:19, 23:20, 23:21. Datum för utskrift: 2015-03-05 Underhållsplan Brf Körsbäret 19-21 Datum för utskrift: 2015-03-05 Översikt Grundläggande information om underhållsplanen. Adress Nilssonsberg 411 43 GÖTEBORG Boarea (BOA) 30232 m2 Lokalarea (LOA) 2459

Läs mer

Centralt och tillgängligt. boende i Karlaskolan

Centralt och tillgängligt. boende i Karlaskolan Centralt och tillgängligt boende i Karlaskolan Vad är kooperativ hyresrätt? Kungsörs kommun bygger i samarbete med ett lokalt byggföretag, BroWest Bygg AB, om före detta Karlaskolan till 15 lättillgängliga

Läs mer

Om BRF Citymunken. Ort: Malmö. E-Mail: Kontaktpersoner. Namn: Torbjörn Bodin Telefon: 0768558960. Ansvarsområde i föreningen: Ordförande.

Om BRF Citymunken. Ort: Malmö. E-Mail: Kontaktpersoner. Namn: Torbjörn Bodin Telefon: 0768558960. Ansvarsområde i föreningen: Ordförande. Om BRF Citymunken Föreningens juridiska namn: Brf Citymunken Organisationsform: Bostadsrättsförening Organisationsnummer: 7696110217 Föreningens adress: Munkgatan 3 Postnummer: 21147 Hemsida: www.citymunken.se

Läs mer

Underhållsplan 2015 Bostadsrättsföreningen Ankarparken

Underhållsplan 2015 Bostadsrättsföreningen Ankarparken Underhållsplan 2015 Bostadsrättsföreningen Ankarparken 2 Innehållsförteckning Innehåll Innehållsförteckning... 2 1. Allmänna uppgifter... 3 Uppgifter... 3 Allmän information... 3 Beskrivning underhållsplan...

Läs mer

Åtgärdsår AFF-kod Objekt Beskrivning skick Åtgärd Kostnad totalt

Åtgärdsår AFF-kod Objekt Beskrivning skick Åtgärd Kostnad totalt Åtgärdsår AFF-kod Objekt Beskrivning skick Åtgärd Kostnad totalt Totalkostnad per år inkl. löpande kostnad 2016 T2.11 Takbeläggningar och tätskikt. Hus A. 2016 T2.11 Takbeläggningar och tätskikt. Hus B

Läs mer

Bostadsrättsföreningen Solstrålen

Bostadsrättsföreningen Solstrålen Underhållsplan 20 Bostadsrättsföreningen Solstrålen Innehållsförteckning. 2. 3. 4.. Allmänna uppgifter Fastighetsfakta Besiktningsutlåtande Grunddata Sammanställning Sida 3 Sida 4 Sida -0 Sida -3 Sida

Läs mer

Energirenovering av miljonprogrammet

Energirenovering av miljonprogrammet Energirenovering av miljonprogrammet Hur lönsam är energirenovering? Charlie Timmermann 2014-06-10 1 Bakgrundsfakta Byggdes 886 000 st lgh under miljonprogramsåren Ca 560 000 st av dessa behöver renoveras

Läs mer

Enkel Energikartläggning. Start av inventeringen. Allmänt/Energiledning. Anläggningens namn: När uppfördes byggnaden?

Enkel Energikartläggning. Start av inventeringen. Allmänt/Energiledning. Anläggningens namn: När uppfördes byggnaden? Enkel Energikartläggning Start av inventeringen Inled processen med att lista vilka byggnader som anläggningen innefattar. Gå sedan igenom varje byggnad med ett eget inventeringsprotokoll. Anläggningens

Läs mer

Handling 06.56 PU-plan Trelleborgs lasarett

Handling 06.56 PU-plan Trelleborgs lasarett Handling 6.56 -plan rt T2 871 871 N UTVÄNIGT MRK 2-1-1 16 17 18 19 2 21 22 23.1 sfaltering av ytor utanför lastkaj samt upp mot Frans Malmr T46 Malmrosgatan Värmesystem i byggnad 2-1-1 3 T4241.1 Upprätta

Läs mer

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail. Brf Reveljen 1 & 11 Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.com Mäklarinformation version 150110 På föreningens hemsida

Läs mer

UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-06-19

UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-06-19 Fastighet Veken 5 Brf Bondegatan 51 Bondegatan 51, i Stockholm UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-06-19 Brf Bondegatan 51 Kv Veken 5 Bondegatan 51 116 33 Stockholm Fastighetsägarna Stockholm AB Box

Läs mer

Nu bygger vi om i Husby

Nu bygger vi om i Husby Nu bygger vi om i Husby Nu startar vi ombyggnaden av våra hus och lägenheter på Järva. Vi bygger om för dig som bor i Svenska Bostäder Så här planerar vi att bygga om i Husby Hus för hus Det tar upp till

Läs mer

Underhållsplan för Brf Saltsjöhöjden

Underhållsplan för Brf Saltsjöhöjden Underhållsplan för Brf Saltsjöhöjden ALLMÄN BESKRIVNING Här följer några fakta om fastigheterna Rösunda 31:1 och Rösunda 33:2. Byggnadsår: 1964 Undergrund: Berg/morän Grundläggning: Byggnaderna är grundlagda

Läs mer

Underhållsplan Axet 2

Underhållsplan Axet 2 2004-09-07 A 2 Sid 1 Underhållsplan 2004-2005 Axet 2 Planerade åtgärder Objekt Intervall Status 04/05 05/06(2 år) 06/07 (3 år) 07/08 (4 år) 08/09 (5år) Övrigt Utvändigt Tak Matr 30 Ren 92 Färg 10 Äldre

Läs mer

BYGGNADSVERK Besiktningsadag: 2006- Kostnader är exklusive mervärdeskatt och YTTERTAK Utförd av: Wilhelm Apor och Rune Enquist

BYGGNADSVERK Besiktningsadag: 2006- Kostnader är exklusive mervärdeskatt och YTTERTAK Utförd av: Wilhelm Apor och Rune Enquist PLANERAT UNDERHÅLL/ KOSTNADER FASTIGHETSUNDERHÅLL 1(6) Byggnadsår:1897 UTVÄNDIGA BYGGNADSVERK Besiktningsadag: 2006- Kostnader är exklusive mervärdeskatt och YTTERTAK Utförd av: Wilhelm Apor och Rune Enquist

Läs mer

Nu bygger vi om i Akalla

Nu bygger vi om i Akalla Nu bygger vi om i Akalla Nu startar vi ombyggnaden av våra hus och lägenheter på Järva. Vi bygger om för dig som bor i Svenska Bostäder Så här planerar vi att bygga om i Akalla Hus för hus Det tar omkring

Läs mer

Underhållsplan 2011. Bostadsrättsföreningen Inland 3

Underhållsplan 2011. Bostadsrättsföreningen Inland 3 Underhållsplan 20 Bostadsrättsföreningen Inland 3 Innehållsförteckning. 2. 3. 4. 5. Allmänna uppgifter Fastighetsfakta Besiktningsutlåtande Grunddata Ekonomisk sammanställning Sida 3 Sida 4 Sida 5-9 Sida

Läs mer

Axets planerade underhåll 09/10, Sammanfattning för perioden 1 sep aug 2010

Axets planerade underhåll 09/10, Sammanfattning för perioden 1 sep aug 2010 Axets planerade underhåll 09/10, Sammanfattning för perioden 1 sep 2009 31 aug 2010 Axet 3 :: 100 000:- Ränndalar mot gatan åtgärdas Buskage ersätts med cykelställ/gräsmatta 30 000:- A 80 000:- A Axet

Läs mer

Underhållsplan för Brf Jasminen 9 & 10

Underhållsplan för Brf Jasminen 9 & 10 Underhållsplan för Brf Jasminen 9 & 10 Underhållsplanen har utförts av projektledare från SBC Sveriges BostadsrättsCentrum Projekt-och byggledning. Underhållsplanen kan uppdateras varje år vad avser index

Läs mer

Byggnadsdel Skick Anmärkning Bör Uppskattad åtgärdas kostnad exklusive moms

Byggnadsdel Skick Anmärkning Bör Uppskattad åtgärdas kostnad exklusive moms 1 (8) Tak Se separat besiktningsprotokoll på taken avser samtliga tak. 2013 Akuta lagningar 12 000 2014 Bättringsmålning 20 000 gård och gata 63-65 Tak Lilla huset Inga synliga skador Separat syn i samband

Läs mer

Inventeringsprotokoll Statusbedömning

Inventeringsprotokoll Statusbedömning Inventeringsprotokoll Statusbedömning TRAPPHUS, HISSKORG Fastighet Kv Dykaren Inventeringsdatum 2012-06-20 Byggnad 1 Omg Adress Alströmergatan 45 Egenkontroll Besiktningsman Oskar Rudbeck Granskning 2012-09-28

Läs mer

Underhållsplan Brf. Ulrika

Underhållsplan Brf. Ulrika Underhållsplan Brf. Ulrika Innehållsförteckning 1. Tidigare underhållsplan... 1-3 2. Fastighetsfakta... 6 3. Byggnadstekniska uppgifter... 6 4. Plan 2013 2020... 6-10 1 1. Tidigare underhållsplan Underhållsplan

Läs mer

Upprättad: 2007-06-14 Underhållsplan för perioden 2007 --- 2026

Upprättad: 2007-06-14 Underhållsplan för perioden 2007 --- 2026 Bf Håkan Underhållsplan 2007 - version 2007-08-02 AG Kalkylsidor 1/(5) 0 ALLMÄNNA UPPGIFTER Namn: Bf Håkan i Malmö Kontaktperson: Jan & Annika Kluge Moms: 25% Byggår: 1901 Gatuadress: Slussgatan 12 I Lägenheter:

Läs mer

UNDERHÅLLSPLAN OCH PLANERAT UNDERHÅLL (PU) Mjölby kommun

UNDERHÅLLSPLAN OCH PLANERAT UNDERHÅLL (PU) Mjölby kommun UNDERHÅLLSPLAN OCH PLANERAT UNDERHÅLL (PU) Mjölby kommun Efter ett långt uppehåll med PU har man beslutat att upprätta en PU-plan. Man kan konstatera att K behöver 62 miljoner första året. Realistisk är

Läs mer

På mötet kommer vi att rösta om vi ska måla eller byta fönster baserat på det underlag som bifogas i kallelsen.

På mötet kommer vi att rösta om vi ska måla eller byta fönster baserat på det underlag som bifogas i kallelsen. Malmö 2009-12-01 Till medlemmarna i Brf. Krabban Härmed kommer kallelsen till extra föreningsstämma den 8:e december. Det som mötet huvudsakligen kretsar kring är huruvida vi ska byta eller måla om/reparera

Läs mer

Energirenovering av miljonprogrammet

Energirenovering av miljonprogrammet Energirenovering av miljonprogrammet Rikard Westerlund 2014-11-11 1 Bakgrundsfakta Byggdes 886 000 st lgh under miljonprogramsåren Ca 560 000 st av dessa behöver renoveras inom 10 åren Schneider Electric

Läs mer

Brf Punktsnurran Uppsala

Brf Punktsnurran Uppsala Brf Punktsnurran Uppsala Protokoll från konditionsbesiktning och underhållsplan Upprättad 2016-03-20 Byggkonsult Urban Nilsson Tångvägen 15, 744 51 Morgongåva Tel 0707-56 77 25 E-post: urban.byggkonsult@gmail.com

Läs mer

Brf Sjöviksskogen. Underhållsplan. Kv Årstaberg 4. ÅF-Infrastructure AB Projektledning. Johan Widell. Datum 2013-01-09

Brf Sjöviksskogen. Underhållsplan. Kv Årstaberg 4. ÅF-Infrastructure AB Projektledning. Johan Widell. Datum 2013-01-09 Handläggare Johan Widell Tel +46 (0)10 505 12 44 Mobil +46 (0)76 770 88 43 Fax +46 10 505 00 10 johan.widell@afconsult.com Datum 2013-01-09 Brf Sjöviksskogen Kv Årstaberg 4 Underhållsplan ÅF-Infrastructure

Läs mer

Underhållsplan 2016-2026. Projektnummer: 201601. Stockholm 2016-02-29 Uppdragsansvarig: Mikael Andersson

Underhållsplan 2016-2026. Projektnummer: 201601. Stockholm 2016-02-29 Uppdragsansvarig: Mikael Andersson Underhållsplan 20162026 Projektnummer: 201601 Stockholm 20160229 Uppdragsansvarig: Mikael Andersson Sida 1 av 19 Innehållsförteckning 1.UPPDRAG OCH BAKGRUND... 3 2.BESIKTNINGEN... 3 3.TIDIGARE UTFÖRDA

Läs mer

KV RISET 10. Illustration Barnängsgatan / Tengdahlsgatan KV RISET 10 2014-05-08

KV RISET 10. Illustration Barnängsgatan / Tengdahlsgatan KV RISET 10 2014-05-08 Illustration Barnängsgatan / Tengdahlsgatan Kontur arkitektkontor ab Triewaldsgränd 1 111 29 Stockholm telefon +46 8 411 54 10 kontor@kontur.se www.kontur.se INNEHÅLL Försättsblad Innehåll Byggnaden, förändring,

Läs mer

1101 2 Rum 39 m2 plan 1 LGH 1101 Brf Flygplansfabriken 130619

1101 2 Rum 39 m2 plan 1 LGH 1101 Brf Flygplansfabriken 130619 1101 39 m 2 LH 1101 TRAPPHUS 1102 38 m 2 LH 1102 1103 43 m 2 LH 1103 1104 47 m 2 ITILLIADE HUS 1,5 fransk balkong LH 1104 1105 39 m 2 1,5 UPPHÖJD UTEPLATS/ MARKÄRA BALKO LH 1104 LH 1105 1106 43 m 2 UPPHÖJD

Läs mer

Vi gör inte som alla andra

Vi gör inte som alla andra Vi gör inte som alla andra D. Carnegie & Co gör inte som alla andra istället för att evakuera och renovera hela trapphus eller fastigheter, renoveras lägenhet för lägenhet i takt med den naturliga omflyttningen.

Läs mer

UNDERHÅLLSPLAN. Underhållsplanen sträcker sig fram till 2050. Perioden är vald med tanke på att denna period täcker in husens renoveringscykel.

UNDERHÅLLSPLAN. Underhållsplanen sträcker sig fram till 2050. Perioden är vald med tanke på att denna period täcker in husens renoveringscykel. UNDERHÅLLSPLAN för HSB:s Brf Berglandet Underhållsplanen är utarbetad av styrelsen i brf Berglandet. Syftet med underhållsplanen är i första hand att visa när i tiden det är dags för föreningen att påbörja

Läs mer

Centralt och tillgängligt. boende i Karlaskolan

Centralt och tillgängligt. boende i Karlaskolan Centralt och tillgängligt boende i Karlaskolan Vad är kooperativ hyresrätt? Kungsörs kommun har i samarbete med ett lokalt byggföretag, BroWest Bygg AB, byggt om före detta Karlaskolan till 15 lättillgängliga

Läs mer

Järnvägsgatan 13. Län Jönköping Gatuadress Järnvägsgatan 13 Kommun Värnamo Storlek 6 rum (4 sovrum) / 125 m² Tillträde tidigast Enligt överenskommelse

Järnvägsgatan 13. Län Jönköping Gatuadress Järnvägsgatan 13 Kommun Värnamo Storlek 6 rum (4 sovrum) / 125 m² Tillträde tidigast Enligt överenskommelse Län Jönköping Gatuadress Kommun Värnamo Storlek 6 rum (4 sovrum) / 125 m² Tillträde tidigast Enligt överenskommelse www.hemverket.se - Sida 1 av 16 www.hemverket.se - Sida 2 av 16 Entré Entré med plats

Läs mer

Allmän information och trivselregler för boende i Bostadsrättsföreningen Ångpannan 16

Allmän information och trivselregler för boende i Bostadsrättsföreningen Ångpannan 16 Allmän information och trivselregler för boende i Bostadsrättsföreningen Ångpannan 16 1 Vår gemensamma egendom omfattar - förutom de individuella lägenheterna med tillhörande vindsförråd - trapphus, gemensam

Läs mer

Brf Stadsträdgården. Skönt modernt boende för ett aktivt liv. Bofakta

Brf Stadsträdgården. Skönt modernt boende för ett aktivt liv. Bofakta Brf Stadsträdgården Skönt modernt boende för ett aktivt liv Bofakta Innehåll Situationsplan... 3 Våningsplan Vindsvåning och våning 2 5... 4 Våning 1 och källarplan... 5 Planritningar 2 rum och kök...

Läs mer

UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-09-04

UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-09-04 Fastighet Postbonden 1 Brf Timmerhögen Timmermansgatan 44, i Stockholm UNDERHÅLLSPLAN / STATUSBEDÖMNING 2012-09-04 Brf Timmerhögen Fgh Postbonden 1 Timmerhögen 44 118 55 Stockholm Fastighetsägarna Stockholm

Läs mer

Kv. Oden, Höganäs. Vad är en ägarlägenhet?

Kv. Oden, Höganäs. Vad är en ägarlägenhet? Kv. Oden Kv. Oden, Höganäs Våren 2014 påbörjade vi vårt bostadsprojekt Kv. Oden i Höganäs och vi planerar för inflyttning i juni 2015. Projektet omfattar fyra huskroppar med totalt femtiofem lägenheter.

Läs mer

Brf Kilian 9, Malmö. Underhållsplan 2015-2040

Brf Kilian 9, Malmö. Underhållsplan 2015-2040 Brf Kilian 9, Malmö Underhållsplan 2015-2040 Upprättad av styrelsen 2015 1 Innehåll: 1. Objekt 3 2. Arbetssätt 4 3. Tidigare utförda renoveringar 5 4. Kortfattad byggnadsbeskrivning 6 5. Åtgärdsplan 26

Läs mer

Underhållsplan för Brf Djursborg 2

Underhållsplan för Brf Djursborg 2 Underhållsplan för Brf Djursborg 2 Underhållsplanen har utförts av projektledare från SBC Sveriges BostadsrättsCentrum Projekt-och byggledning. Underhållsplanen kan uppdateras varje år vad avser index

Läs mer

1(7) Brf Smugglaren. Göteborg, Olivedal 7:8 Nordenskiöldsgatan 21 Nordhemsgatan 71. Förslag till

1(7) Brf Smugglaren. Göteborg, Olivedal 7:8 Nordenskiöldsgatan 21 Nordhemsgatan 71. Förslag till 1(7) Brf Smugglaren Göteborg, Olivedal 7:8 Nordenskiöldsgatan 21 Nordhemsgatan 71 Förslag till Underhållsplan 2010 2010-05-17 2(7) Underhållsplanen är upprättad för att översiktligt beskriva vad som omfattar

Läs mer

Underhållsplan för Brf Frisksportaren

Underhållsplan för Brf Frisksportaren Underhållsplan för Brf Frisksportaren Underhållsbesiktningen har utförts av projektledare från SBC Sveriges BostadsrättsCentrum AB Byggnadsteknisk förvaltning Underhållsplanen kan uppdateras varje år vad

Läs mer

Axets planerade underhåll 10/11, Sammanfattning för perioden 1 sep 2010 31 aug 2011

Axets planerade underhåll 10/11, Sammanfattning för perioden 1 sep 2010 31 aug 2011 Axets planerade underhåll 10/11, Sammanfattning för perioden 1 sep 2010 31 aug 2011 Axet 3 :: 520 000:- Ventilationsfläkt V 3 utökas 20 000:- Trattar bytes A Entrétak målas om 200 000:- A Entrésidorna

Läs mer

Underhållsplan för Brf Veterinären 5 & 6

Underhållsplan för Brf Veterinären 5 & 6 Underhållsplan för Brf Veterinären 5 & 6 Underhållsplanen har utförts av projektledare från SBC Sveriges BostadsrättsCentrum AB Byggnadsteknisk förvaltning. Underhållsplanen kan uppdateras varje år vad

Läs mer

Till dig som bor på Esplanaden 13

Till dig som bor på Esplanaden 13 Till dig som bor på Esplanaden 13 HUSET SKA RENOVERAS Hej! Många av Förvaltarens hus börjar komma upp i åren och behöver snart renoveras. Under de kommande åren går vi igenom nästan alla hus och nu har

Läs mer

Underhållsplan för Bostadsföreningen Döbeln upa

Underhållsplan för Bostadsföreningen Döbeln upa Underhållsplan för Bostadsföreningen Döbeln upa Underhållsbesiktningen har utförts av SBCs byggkonsulter avseende långsiktlig underhållsplan. Underhållsplanen kan uppdateras varje år vad avser index eller

Läs mer

Sundsbro PASSIVHUS. Välkommen till ett av Sveriges energisnålaste och miljövänligaste flerfamiljshus. 24 lägenheter med guldvittring

Sundsbro PASSIVHUS. Välkommen till ett av Sveriges energisnålaste och miljövänligaste flerfamiljshus. 24 lägenheter med guldvittring Sundsbro PASSIVHUS 24 lägenheter med guldvittring Välkommen till ett av Sveriges energisnålaste och miljövänligaste flerfamiljshus SUNDSBRO Välkommen till vårt första passivhus. Ett sju våningar högt hus

Läs mer

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail. Brf Reveljen 1 & 11 Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.com Mäklarinformation version 151218 På föreningens hemsida

Läs mer

Uddeholmsgatan 32 C. Persborg

Uddeholmsgatan 32 C. Persborg Uddeholmsgatan 32 C Persborg Snygg och välhållen lägenhet på attraktivt läge, i närheten av city och kommunikationer! Helkaklat badrum, modernt och stilrent kök och bra planlösning med ljusinsläpp från

Läs mer

Län Södermanland Gatuadress Pilos väg 3 Kommun Nyköping Storlek 2 rum (1 sovrum) / 57 m² Område Nyköping Tillträde tidigast Enligt överenskommelse

Län Södermanland Gatuadress Pilos väg 3 Kommun Nyköping Storlek 2 rum (1 sovrum) / 57 m² Område Nyköping Tillträde tidigast Enligt överenskommelse Län Södermanland Gatuadress Kommun Nyköping Storlek 2 rum (1 sovrum) / 57 m² Område Nyköping Tillträde tidigast Enligt överenskommelse " Praktisk planlösning och gott om förvaringsmöjligheter i fasta garderober.

Läs mer

BESIKTNINGSOBJEKTET. Lahäll 5:26, Tibblevägen 27, Lahäll, Täby kommun. Inga-Lill Hallberg

BESIKTNINGSOBJEKTET. Lahäll 5:26, Tibblevägen 27, Lahäll, Täby kommun. Inga-Lill Hallberg 5 BESIKTNINGSOBJEKTET Fastighet Lahäll 5:26, Tibblevägen 27, Lahäll, Täby kommun Lagfaren ägare Bo Hallberg Inga-Lill Hallberg Uppdragsgivare Bo Hallberg Närvarande vid besiktningen Bo Hallberg Inga-Lill

Läs mer

Minnet bästa läget centralt på Väster

Minnet bästa läget centralt på Väster Minnet bästa läget centralt på Väster Stadsdelen Väster från ovan. Från Minnet tar du dig snabbt in till city. Lummigt och lugnt på Regementsgatan. Nytt boende i gammal stadsdel I utkanten av Väster, med

Läs mer

Underhållsplan för Brf Sannadalsplatån

Underhållsplan för Brf Sannadalsplatån Underhållsplan för Brf Sannadalsplatån Underhållsplanen har utförts av projektledare från SBC Sveriges BostadsrättsCentrum Ombyggnad Underhållsplanen kan uppdateras varje år vad avser index eller eventuella

Läs mer

Årsredovisning 2010. BRF Masken 34 Bohusgatan 27, 116 67 Stockholm Org. nr: 716421-6132 www.brfmasken34.nu

Årsredovisning 2010. BRF Masken 34 Bohusgatan 27, 116 67 Stockholm Org. nr: 716421-6132 www.brfmasken34.nu Årsredovisning 2010 BRF Masken 34 Bohusgatan 27, 116 67 Stockholm Org. nr: 716421-6132 www.brfmasken34.nu Sida 1 (12) ÅRSREDOVISNING 2010 Styrelsen för Bostadsrättsföreningen Masken 34 i Stockholm, org

Läs mer

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.

Brf Reveljen 1 & 11. Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail. Brf Reveljen 1 & 11 Hedinsgatan 11, Kallskärsgatan 3, Kallskärsgatan 5-115 33 Stockholm Hemsida: www.brfreveljen.se E-mail: brfreveljen@gmail.com Mäklarinformation version 150701 På föreningens hemsida

Läs mer

FF1 Drift- och Underhållsplanering

FF1 Drift- och Underhållsplanering FF1 Drift- och Underhållsplanering Drift- och underhållsplaner utgör en viktig del av den fastighetsekonomiska analysen. Denna uppgift syftar till att göra en detaljerad plan för drift- och underhåll för

Läs mer

Axets underhåll, sammanfattning 2006/2007

Axets underhåll, sammanfattning 2006/2007 Axets underhåll, sammanfattning 2006/2007 Samtliga hus :: 30 000:- + 200 000:- = 230 000:- Ränndalar och stuprör åtgärdas (byts, sätts fast, självrensande utkastare monteras) OVK Samtliga gårdar :: 30

Läs mer

Hyresgästsamråd. Storholmen 3 och 5 Storholmsbackarna 2-44 Projekt-ID: 6001. Datum 2015-02-02 Tid 18.00-20.00 Plats Storholmsbackarna 10

Hyresgästsamråd. Storholmen 3 och 5 Storholmsbackarna 2-44 Projekt-ID: 6001. Datum 2015-02-02 Tid 18.00-20.00 Plats Storholmsbackarna 10 Fastighetsutveckling Distrikt Söderort Hyresgästsamråd Storholmen 3 och 5 Storholmsbackarna 2-44 Projekt-ID: 6001 Datum 2015-02-02 Tid 18.00-20.00 Plats Storholmsbackarna 10 Närvarande Anita Sundh Hyresgäst

Läs mer

UNDERHÅLLSPLAN. Avseende BRF Regattan 2, Bodalsvägen 1 9, Lidingö FASTIGHETSUPPGIFTER. Beteckning: Regattan 2 Byggår: Bostadslägenhetsyta:

UNDERHÅLLSPLAN. Avseende BRF Regattan 2, Bodalsvägen 1 9, Lidingö FASTIGHETSUPPGIFTER. Beteckning: Regattan 2 Byggår: Bostadslägenhetsyta: UNDRHÅLLSPLAN Avseende RF Regattan 2, odalsvägen 9, Lidingö FASTIHTSUPPIFTR eteckning: Regattan 2 yggår: 94 Tomtyta: 4.34 kvm oadslägenhetsyta: 2.92 kvm Lokalyta: 07 kvm Antal lägenheter: Antal lokaler:

Läs mer

Lägenhet N4-1001 N5-1001. Storlek Placering. 4 rok, 106 kvm Hus N4, N5, våning 1

Lägenhet N4-1001 N5-1001. Storlek Placering. 4 rok, 106 kvm Hus N4, N5, våning 1 4-1001 5-1001 4 rok, 106 kvm Hus 4, 5, våning 1 Lägenhet i markplan med fönster i tre väderstreck som ger utblickar mot gården och Drottninggatan Stor uteplats på 22 kvm i förlängning av vardagsrum Balkong

Läs mer

Instruktion till Enkel Energikartläggning. Allmänt/Energiledning. Anläggningens namn: Fråga När uppfördes byggnaden?

Instruktion till Enkel Energikartläggning. Allmänt/Energiledning. Anläggningens namn: Fråga När uppfördes byggnaden? Instruktion till Enkel Energikartläggning Detta dokument försöker förklara begrepp i den Energikartläggning enkel. Anläggningens namn: Allmänt/Energiledning Har energikartläggning genomförts? JA NEJ Är

Läs mer

Mäklarinformation Brf Mässen i Stockholm

Mäklarinformation Brf Mässen i Stockholm Mäklarinformation Brf Mässen i Stockholm Denna information riktar sig i första hand till mäklare som förmedlar bostadsrätter inom bostadsrättsföreningen. Reviderad: 2016-02-02 1 Mäklarinformation Mäklarbild

Läs mer

Götaland Kommun Strömstad Storlek 1.5 rum / 41 m² Tillträde tidigast

Götaland Kommun Strömstad Storlek 1.5 rum / 41 m² Tillträde tidigast Län Västra Gatuadress Götaland Kommun Strömstad Storlek 1.5 rum / 41 m² Tillträde tidigast Enligt överenskommelse " En nyrenoverad lägenhet, centralt belägen och med fantastisk utsikt över staden och havet.

Läs mer

VITA BJÖRN RENOVERING MED MÅNGA VALMÖJLIGHETER

VITA BJÖRN RENOVERING MED MÅNGA VALMÖJLIGHETER VITA BJÖRN RENOVERING MED MÅNGA VALMÖJLIGHETER DIALOG MED ER HYRESGÄSTER > Genom samrådsmöten > Vid Öppet hus i visningslägenhet > Enskilda möten och samtal med våra hyresgäster > Planeringsarbetet har

Läs mer

Information inför renoveringen

Information inför renoveringen Information inför renoveringen MÖTESANTECKNINGAR Sundbyberg 5 oktober 2015 Hej och tack till alla er som deltog på informationsmötet och ställde frågor. Här kommer som utlovat en sammanfattning av vad

Läs mer

Brf Saltsjöhöjden, Saltsjöbaden

Brf Saltsjöhöjden, Saltsjöbaden Brf Saltsjöhöjden, Saltsjöbaden Underhållsplan. Stockholm 26 maj 2009 ProjektledarHuset AB Hillar Truuberg 1 Kv Rösunda 33:2 och 31:1, Brf Saltsjöhöjden, Saltsjöbaden - Besiktningsutlåtande 1. Uppdrag

Läs mer

INFORMATIONSMÖTE BRF TINGVALLEN

INFORMATIONSMÖTE BRF TINGVALLEN VÄLKOMNA TILL INFORMATIONSMÖTE BRF TINGVALLEN 28 JANUARI 2015 LQE-AVTAL MED HSB SKÅNE LQE utvidgat ekonomiskt avtal LQE Långsiktig Qvalitets Ekonomi VERKSAMHETSÅRET Årsstämma Leveransplan Kallelser Årlig

Läs mer

Mäklarinformation Brf Vattenspegeln. 1. Huset Allmänt. Brf Vattenspegeln

Mäklarinformation Brf Vattenspegeln. 1. Huset Allmänt. Brf Vattenspegeln Mäklarinformation Brf Vattenspegeln Kontakt i föreningen: Ordförande Calle Hagerström 076-586 95 31 Mail: brfvattenspegeln@gmail.com Organisationsnummer: 769605-2724 1. Huset Allmänt 1.1 Byggår? 1930 1.2

Läs mer

Fastighetsskötsel & trivselfrågor

Fastighetsskötsel & trivselfrågor Fastighetsskötsel & trivselfrågor 1. Hiss Om någon fastnat i hissen tillkalla alltid akut hjälp genom att ringa till hissjouren. Vid annat fel ringer Du också hissjouren. Ringer Du före kl 14.00 så åtgärdas

Läs mer

Län Västmanland Gatuadress Bondebacken 16 Kommun Västerås Storlek 1 rum / 36.5 m² Område Centralt - Oxbacken. Tillträde tidigast

Län Västmanland Gatuadress Bondebacken 16 Kommun Västerås Storlek 1 rum / 36.5 m² Område Centralt - Oxbacken. Tillträde tidigast Län Västmanland Gatuadress Kommun Västerås Storlek 1 rum / 36.5 m² Område Centralt - Oxbacken Tillträde tidigast Enligt överenskommelse " Inflyttningsklart boende i ett mycket attraktivt område med närhet

Läs mer

Loka Brunn. 153 lägenheter i hjärtat av Stockholm

Loka Brunn. 153 lägenheter i hjärtat av Stockholm Loka Brunn. 153 lägenheter i hjärtat av Stockholm Tradition i ständig utveckling. sedan början av seklet, det förra, har vår verksamhet byggt på samma värderingar och kärnvärden. Det har tvingat oss att

Läs mer

Riskinventering av fastigheter

Riskinventering av fastigheter Malmö stad Miljöförvaltningen er HÄR ÄR ETT EXEMPEL på hur en riskinventering av en fastighet kan genomföras. Notera att detta bara är ett exempel, och inte skall ses som ett komplett underlag för hur

Läs mer

INFORMATIONSMÖTE BRF TINGVALLEN

INFORMATIONSMÖTE BRF TINGVALLEN VÄLKOMNA TILL INFORMATIONSMÖTE BRF TINGVALLEN 21 JANUARI 2014 MAGNUS ANDERSSON LQE-AVTAL MED HSB SKÅNE LQE utvidgat ekonomiskt avtal LQE Långsiktig Qvalitets Ekonomi VERKSAMHETSÅRET Årsstämma Leveransplan

Läs mer

Byggnad, lista bostäder

Byggnad, lista bostäder , lista bostäder Sida 1 (1) 21ROAND - 2012-12-07 11:47:28 Urval:. lika med 1. lika med 2121 Byggn. år/ombyggn. år BOA LOA UBA Antal lgh. Antal lokaler 2121 BRF SOLHUS 01 NIKOLAIGATAN 5 1930 2 298,6 42,2

Läs mer

Stenbrinken 7. Län Södermanland Gatuadress Stenbrinken 7 Kommun Nyköping Storlek 4 rum (3 sovrum) / 100,5 m² Område Öster Tillträde tidigast

Stenbrinken 7. Län Södermanland Gatuadress Stenbrinken 7 Kommun Nyköping Storlek 4 rum (3 sovrum) / 100,5 m² Område Öster Tillträde tidigast Län Södermanland Gatuadress Kommun Nyköping Storlek 4 rum (3 sovrum) / 100,5 m² Område Öster Tillträde tidigast Enligt överenskommelse www.hemverket.se - Sida 1 av 14 Exteriör Välskött fastighet med högt

Läs mer

Bostadsrättsföreningen/ApartHotel/Attaché/

Bostadsrättsföreningen/ApartHotel/Attaché/ Kostnadskalkylför BostadsrättsföreningenApartHotelAttaché 76962761993 Stockholmsstad 113 Innehållsförteckning Sid 1. Allmännaförutsättningar 3 2. Beskrivningavtomträtten 3 3. Beräknadkostnadförföreningensfastighetsförvärv

Läs mer

BRF SOLGLÄNTAN STRÅLANDE LÄGE FÖR BEKVÄMT BOENDE

BRF SOLGLÄNTAN STRÅLANDE LÄGE FÖR BEKVÄMT BOENDE BRF SOLGLÄNTAN STRÅLANDE LÄGE FÖR BEKVÄMT BOENDE SÖDRA HAGA I SUNDSVALL HSB ÄR INTE SOM ANDRA BYGGBOLAG TILL ATT BÖRJA MED ÄR VI INTE ETT BYGGBOLAG Vi på HSB bygger över hela landet från norr till söder,

Läs mer

Välkommen till Sigfridsvägen 21

Välkommen till Sigfridsvägen 21 Välkommen till Sigfridsvägen 21 Ett modernt boende med klassisk Ta chansen att bo i det vackra Q-märkta huset från 1935 på Sigfridsområdet. De klassiska detaljerna är väl bevarade, samtidigt som lägenheterna

Läs mer

Centralt belägen aktielägenhet om 1 R+Kv 37 m 2 på Köpmansgatan 12 Mariehamn

Centralt belägen aktielägenhet om 1 R+Kv 37 m 2 på Köpmansgatan 12 Mariehamn Centralt belägen aktielägenhet om 1 R+Kv 37 m 2 på Köpmansgatan 12 Mariehamn Presentation Trevlig och välplanerad etta i centralt och lugnt kvarter på Köpmansgatan 12 i Mariehamn. Bostaden inrymmer hall/entré

Läs mer

Underhållsplan 2015 Bostadsrättsföreningen Slottshörnet

Underhållsplan 2015 Bostadsrättsföreningen Slottshörnet Underhållsplan 2015 Bostadsrättsföreningen Slottshörnet 2 Innehållsförteckning Innehåll Innehållsförteckning... 2 1. Allmänna uppgifter... 3 Uppgifter... 3 Allmän information... 3 Beskrivning underhållsplan...

Läs mer

AB Helsingborgshem. Agenda

AB Helsingborgshem. Agenda AB Helsingborgshem AB Helsingborgshem Agenda 1. Våra åtaganden 2. Generella implementeringspunkter 3. Kv Turkiet (Portalen) 4. Parkkvarteret 5. Björka/Ödåkra 6. Individuellt Mätsystem 7. Fotokollage över

Läs mer

ÖVERLÅTELSEBESIKTNING

ÖVERLÅTELSEBESIKTNING ÖVERLÅTELSEBESIKTNING Östersund Törnrosen 4 Hårdängegatan 7, 831 47 Östersund Datum 15 05 27 Oktopal AB Samuel Permans gata 2, 831 30 Östersund Tel: 06312 35 30 Organisation Nummer: 5566690144, Fskattesedel

Läs mer

Nu bygger vi om i Tensta

Nu bygger vi om i Tensta Nu bygger vi om i Tensta Nu startar vi ombyggnaden av våra hus och lägenheter på Järva. Vi bygger om för dig som bor i Svenska Bostäder Så här planerar vi att bygga om i Tensta Hus för hus Det tar upp

Läs mer

BRF ISPRINSESSAN VASTERTORP * STOCKHOLM

BRF ISPRINSESSAN VASTERTORP * STOCKHOLM BRF ISPRINSESSAN VASTERTORP * STOCKHOLM u ~ HÄGERSTENS- BADET. Bo centralt i Västertorp Vid Västertorpsvägen och Skridskovägen byggs nu denna kompletterande bebyggelse på tomt mitt i en uppvuxen miljö

Läs mer

KVARTERET HELSINGBORG

KVARTERET HELSINGBORG KVARTERET HELSINGBORG BRF Rådhusgatan 15, Karlshamn Byggherre: Bostadsrättsföreningen Rådhusgatan 15 Totalentreprenör: PMB Sverige. Arkitekt: White Arkitekter PMB Sverige förbehåller sig rätten till ändringar.

Läs mer

Län Kalmar Gatuadress Lybecksvägen 7 C Kommun Kalmar Storlek 2 rum (1 sovrum) / 63.5 m² Område Djurängen Tillträde tidigast Enligt överenskommelse

Län Kalmar Gatuadress Lybecksvägen 7 C Kommun Kalmar Storlek 2 rum (1 sovrum) / 63.5 m² Område Djurängen Tillträde tidigast Enligt överenskommelse Län Kalmar Gatuadress Kommun Kalmar Storlek 2 rum (1 sovrum) / 63.5 m² Område Djurängen Tillträde tidigast Enligt överenskommelse " Lägenheten är väldigt tyst, man hör mycket sällan något från grannarna!

Läs mer

Bostadsföreningen Norrbacka u.p.a. Organisationsnummer: 702001,5439

Bostadsföreningen Norrbacka u.p.a. Organisationsnummer: 702001,5439 2009,10,06 Bostadsföreningen Norrbacka u.p.a. Organisationsnummer: 702001,5439 Postadress: Tomtebogatan 26 A, 113 38 STOCKHOLM Om fastigheten Fastighetsbeteckning: Smältan 12, med tre trappuppgångar: Tomtebogatan

Läs mer

Alingsås. Brf Hasseln, Sörhaga. Nya bostäder vid Säveån i Sörhaga RÄTT TILL ÄNDRINGAR FÖRBEHÅLLES, ANGIVNA YTOR ÄR PRELIMINÄRA 120113

Alingsås. Brf Hasseln, Sörhaga. Nya bostäder vid Säveån i Sörhaga RÄTT TILL ÄNDRINGAR FÖRBEHÅLLES, ANGIVNA YTOR ÄR PRELIMINÄRA 120113 Nya bostäder vid Säveån i Sörhaga RÄTT TILL ÄNDRINGAR FÖRBEHÅLLES, ANGIVNA YTOR ÄR PRELIMINÄRA 120113 fasadskiss, hustyp A Här erbjuds lägenheter med exklusivt läge vid Sävån. Närhet till bad och sandstrand

Läs mer

ÅTGÄRDER, SAMT KOSTNADSSAMMANSTÄLLNING, GÄLLANDE VILLA SUSSEBO

ÅTGÄRDER, SAMT KOSTNADSSAMMANSTÄLLNING, GÄLLANDE VILLA SUSSEBO Kontoret för samhällsbyggnad Torgny Fredling Datum: 2014-07-28 Projekt nr. Dnr: ÅTGÄRDER, SAMT KOSTNADSSAMMANSTÄLLNING, GÄLLANDE VILLA SUSSEBO Upplands Väsby Vilunda 1:580 INNEHÅLL INLEDNING 3. Byggtekniskt

Läs mer

Brf Ingenjören 6 Blekingegatan 12, 12A, 12B Stockholm

Brf Ingenjören 6 Blekingegatan 12, 12A, 12B Stockholm Funderar du på att renovera din lägenhet? Som bostadsrättshavare har du många rättigheter, men även en del skyldigheter. Att äga en bostadsrätt innebär inte att du äger lägenheten. Det innebär medlemskap

Läs mer

Studiekonferens för ordförande Ystad Saltsjöbad 15-16 okt. 2015. Rolf Ekstrand 2015-10-15

Studiekonferens för ordförande Ystad Saltsjöbad 15-16 okt. 2015. Rolf Ekstrand 2015-10-15 Studiekonferens för ordförande Ystad Saltsjöbad 15-16 okt. 2015 Rolf Ekstrand 2015-10-15 Underhåll och Ombyggnad Rolf Ekstrand Projektledare Ombyggnad 040-10 94 48 rolf.ekstrand@riksbyggen.se Helhetsansvar

Läs mer

Överlåtelsebesiktning för säljare 2012-12-04

Överlåtelsebesiktning för säljare 2012-12-04 INÄGNAN 2 Hökbursvägen 8 Tumba Överlåtelsebesiktning för säljare 2012-12-04 INNEHÅLLSFÖRTECKNING 1 GRANSKNING AV TILLHANDAHÅLLNA HANDLINGAR SAMT INFORMATION FRÅN UPPDRAGSGIVAREN...2 2 OKULÄR BESIKTNING...3

Läs mer