Supplemental Information. P-TEFb Activation by RBM7 Shapes a Pro-survival. Transcriptional Response to Genotoxic Stress
|
|
- Emil Bergman
- för 6 år sedan
- Visningar:
Transkript
1 Molecular Cell, Volume 74 Supplemental Information P-TEFb Activation by RBM7 Shapes a Pro-survival Transcriptional Response to Genotoxic Stress Andrii Bugai, Alexandre J.C. Quaresma, Caroline C. Friedel, Tina Lenasi, Robert Düster, Christopher R. Sibley, Koh Fujinaga, Petra Kukanja, Thomas Hennig, Melanie Blasius, Matthias Geyer, Jernej Ule, Lars Dölken, and Matjaz Barboric
2 Figure S1 F-RBM7 iclip. Related to Figure 1. (A) Correlations between raw sequencing data of the indicated replicates of F-RBM7 iclip libraries. (B) Autoradiogram of 32P-labelled RNA crosslinked to F-RBM7 in iclip. Prominent RNA protein complexes are seen in the FLAG-M2 immuno-purifications (aflag IP) from HEK 293 cells expressing F-RBM7 upon induction by doxycycline (Dox) but not from control cells. Numbers on the left indicate molecular weight in kilodaltons. (C) (Left) Representative DAPI and anti-g-h2ax staining images of HeLa cells are shown. Cells were treated with DMSO and 4-NQO as indicated. (Right) Quantification of g-h2ax foci-positive HeLa cells. The graph shows the percentage of cells with at least one nuclear g-h2ax foci. Values are plotted as the mean ± s.e.m. (n = 2). *, P < Size bar = 10 mm. (D) CoIP of F-RBM7 with MePCE from WCE of HEK 293 cells. Conditions with (in minutes) and without (-) 4-NQO are shown. (E) RIP-qPCR uarbm39 in F-RBM7 IP from HEK 293 WCE. Conditions with (red bars) and without (blue bars) 4-NQO (0.5 hr) are shown. Results are presented as the mean ± s.e.m. (n = 3). **, P <
3 Figure S2 Genotoxic stress induces the relocation of P-TEFb from 7SK snrnp to Pol II. Related to Figure 2. (A) CoIP of F-MTR4 with 7SK snrnp from WCE of HEK 293 cells. Conditions with (+) and without (-) 4-NQO are shown. (B) Glycerol gradient (10 30 %) sedimentation analysis of WCE from HeLa cells. Conditions with (+) and without (-) 4-NQO are shown. The indicated proteins in collected fractions were detected by Western blotting. Fractions that contain P-TEFb in 7SK snrnp, super elongation complexes (SEC), and outside of these complexes are highlighted. (C,D) CoIP of HEXIM1 with CDK9 from WCE of HeLa (C) and HFF-1 (D) cells. Conditions with (+) and without (-) UV are shown. (E) CoIP of Pol II with F-CDK9 from WCE of HEK 293 cells. Conditions with (+) and without (-) 4-NQO are shown. (F) V-PAC assay in HeLa cells expressing YC-P-TEFb and YN-CTD chimera. (Left) Representative YFP fluorescence (YFP) and phase contrast (Cells) images of cells are shown. Cell treatments are shown below the images. (Right) Quantification of YFP-positive cells that were treated as indicated. Values are plotted as the mean ± s.e.m. (n = 2). 2
4 Figure S3 RBM7 releases P-TEFb from the core of 7SK snrnp upon genotoxic stress. Related to Figure 4. (A) CoIP of F-HEXIM1 with CDK9 from WCE of HEK 293 cells. Conditions with control (-), ZCCHC8 and MTR4 sirna (+) are shown. The cells were treated (+) or not (-) with 4-NQO. (B) Co-IP of F-LARP7 with 7SK snrnp and g-h2ax from WCE of HEK 293 cells. Conditions with (in hours) and without (-) FP are shown. (C) Coomassie-stained gel of recombinant proteins used in in vitro MBP pull-down assays. (D,E) Coomassie-stained gels of in vitro MBP pull-down assays of MBP-RBM7 proteins with GST-cMePCE (D) and GST- HEXIM1 (E). 3
5 Figure S4 Active P-TEFb is vital for Pol II transcriptional response to genotoxic stress. Related to Figure 5. (A) Scatterplots comparing raw read counts for protein-coding and lincrna genes from 4sU-seq data sets (n = 2) are shown and spearman correlation (r) is indicated. HeLa cells were treated as indicated on top of each graph. (B) Spearman correlation between log2 fold-change values from 4sU-seq data sets (n = 2) are shown. HeLa cells were treated as indicated. Type of RNA transcript is shown below the graphs. (C) Top transcription factor binding motifs within 5kb window around TSS of the 4FP gene set as revealed by RcisTarget. For each enriched motif, the annotated high confidence TF, normalized enrichment score, and number of genes highly ranked to the motif are shown. 4
6 Figure S5 RBM7 and 7SK snrnp are critical for the induction of P-TEFb-dependent DDR genes. Related to Figure 6. (A) ChIP-qPCR of the occupancy of CDK9 and Ser2-P relative to Pol II at transcription start site (TSS) and in the middle of gene interior (INT) of the indicated DDR genes. Conditions with (red bars) and without (blue bars) 4-NQO are shown. Results were normalized to the DMSO control and are presented as the mean ± s.e.m. (n = 3). *, P < 0.05; **, P < 0.01, determined by Student's t test. (B) ChIP-qPCR of the levels of Ser2-P relative to Pol II at transcription start site (TSS) and in the middle of gene interior (INT) of the indicated DDR genes. Conditions with 4-NQO (red bars) and with 4-NQO together with FP (yellow bars) are shown. Results were normalized to the 4-NQO values that were set to 1 and are presented as the mean ± s.e.m. Data shown are from one representative experiment (n = 3 technical replicates). (C) RT-qPCR (left) of unspliced transcripts (pre-mrna) of the indicated DDR genes and ChIP-qPCR (right) of the levels of Ser2-P relative to Pol II at transcription start site (TSS) and in the middle of gene interior (INT) of the indicated DDR genes 5
7 in control (sictrl; red) and RBM7 knockdown (sirbm7 #2; yellow) 4-NQO-treated HeLa cells. In RT-qPCR assays, the cells were exposed to 4-NQO for 15 min, 0.5 hr, 1 hr and 2 hr as indicated, and results were normalized to the untreated control and are presented as the mean ± s.e.m. (n = 3). *, P < 0.05; **, P < 0.01; ***, P < 0.001, determined by Student's t test. ChIP-qPCR results were normalized to the control values that were set to 1 and are presented as the mean ± s.e.m. (n = 3). *, P < 0.05; **, P < 0.01, determined by Student's t test. Efficacy of the RBM7 knockdown is shown on the left. *** P < 0.001, determined by Student's t test. (D) RT-qPCR of unspliced transcripts of the indicated DDR genes in 4-NQO-treated HeLa cells which were pre-treated or not with the p38 inhibitor (p38i) SB for 1 hr. The cells were exposed to 4-NQO for 0.5 hr, 1 hr and 2 hr as indicated, and results were normalized to the untreated control and are presented as the mean ± s.e.m. (n = 3). *, P < 0.05; **, P < 0.01, determined by Student's t test. (E,F) RT-qPCR of unspliced transcripts of the indicated DDR genes in control (sictrl; red) and ZCCHC8 (E; sizcchc8, yellow) or MTR4 (F; simtr4, yellow) knockdown 4-NQO-treated HeLa cells. The cells were exposed to 4-NQO for 0.5 hr, 1 hr and 2 hr as indicated, and results were normalized to the untreated control and are presented as the mean ± s.e.m. (n = 3). *, P < 0.05; **, P < 0.01; ***, P < 0.001, determined by Student's t test. Efficacy of the ZCCHC8 and MTR4 knockdowns are shown on the left. **, P < 0.01; ***, P < 0.001, determined by Student's t test. (G) CoIP of HEXIM1 with CDK9 from WCE of HCT116 p53 +/+ and HCT116 p53 -/- cell lines. Conditions with (+) and without (-) UV are shown. (H) RT-qPCR of unspliced transcripts of the indicated DDR genes in 4-NQO-treated HCT116 p53 +/+ (red) and HCT116 p53 -/- (yellow) cell lines. The cells were exposed to 4-NQO for 0.5 hr, 1 hr and 2 hr as indicated, and results were normalized to the respective untreated control and are presented as the mean ± s.e.m. (n = 3). 6
8 Figure S6 P-TEFb and RBM7 promote cell viability upon genotoxic stress. Related to Figure 7. (A,C) Hypersensitivity of HFF-1, HeLa and RPE-1 cells to genotoxic stress upon FP treatment (A) and RBM7 depletion (C). The cells were treated as indicated by the legends and examined at the time points indicated below the graphs. Two independent sirnas (sirbm7 #2, HeLa cells; sirbm7 #1, RPE-1 cells) were used to deplete RBM7. Cytotoxicity results are presented as fluorescence values relative to the untreated control and plotted as the mean ± s.e.m. (n = 2). (B) Western blotting analysis of RBM7 depletion in HeLa and RPE-1 cells using RNAi. (D) Expression of F-RBM7 increases survival of 4-NQO-treated HeLa cells with depleted levels of endogenous RBM7. The parental, WT and mrnp1 F-RBM7-expressing HeLa cells were treated as indicated by the legends and examined at the time points indicated below the graphs. sirbm7 #2 was used to deplete RBM7. Cytotoxicity results are presented as fluorescence values relative to the untreated control and plotted as the mean ± s.e.m. (n = 3). *, P < 0.05, determined by Student's t test using 4-NQO sirbm7 data sets from parental and F-RBM7 WT HeLa cells. Levels of the F-RBM7 proteins in RBM7 knockdown cells are shown on the left. (E,F) FP treatment (E) and RBM7 depletion (F) decrease viability of 4-NQO-treated HeLa cells. The cells were treated as indicated by the legends and examined at the time points indicated below the graphs. sirbm7 #2 was used to deplete RBM7. Viability results are presented as fluorescence values relative to the untreated control and plotted as the mean ± s.e.m. (n = 3). *, P < 0.05; ***, P < 0.001, determined by Student's t test. (G) Hypersensitivity of HCT116 p53 +/+ cells to genotoxic stress upon FP treatment. HCT116 cell lines were treated as indicated by the legend and examined at the time points indicated below the graphs. Cytotoxicity results are presented as fluorescence values relative to the untreated control in HCT116 p53 +/+ cells and plotted as the mean ± s.e.m. (n = 3) *, P < 0.05; **, P < 0.01, determined by Student's t test. (H,I) Western blotting analysis of Caspase-3 and PARP cleavage using the cleaved products-specific antibodies. HeLa cells were treated with DMSO, 4-NQO, and FP for eight hours as indicated. sirbm7 #2 was used to deplete RBM7. 7
9 Table S4. Specificity of CDK9, Pol II and Ser2-P ChIP-qPCR assays. Related to Figure 6. Enrichments of the CDK9, Pol II and Ser2-P chromatin occupancies over the normal IgG and FOS intergenic site controls are shown. Conditions with (red lines) and without (blue lines) 4-NQO are shown. Data shown are derived from mean % of input values corresponding to the data presented in Figure 6A, and are presented as fold-enrichments over the controls which were set to 1. (n = 3). 8
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
SUPPLEMENTARY FIGURE LEGENDS
SUPPLEMETARY FIGURE LEGEDS Supplementary Fig. 1. Flow cytometric analysis of wildtype, mutant and chimeric protein surface expression. Cells transduced with the individual constructs indicated were stained
Supplementary information for. MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing
Electronic Supplementary Material (ESI) for Lab on a Chip. This journal is The Royal Society of Chemistry 2019 Supplementary information for MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing Alphonsus
Time (min)
3 2.6 TEF30 VIPP1 Fold change 2.2 1.8 1.4 1 0.6-60 0 60 120 180 240 300 360 420 480 Time (min) Supplemental Figure S1. TEF30 protein accumulates in Chlamydomonas cells exposed to high light. Chlamydomonas
Table 1. Body weight, body weight gain, ph, β-ga and population of Bifidobacterium longum during 16 weeks.
Table 1. Body weight, body weight gain, ph, β-ga and population of Bifidobacterium longum during 16 weeks. Groups Week Body weight (g) Body weight gain (g) ph β-ga 1 Viable BF 2 Normal AOM + DSS control
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION SUPPLEMENTARY METHODS Preparation of the cells for transmission electron microscopy - Cells grown on coverslips were fixed for 45 minutes with 2.5% glutaraldehyde (50 mm cacodylate
Personnummer. DUGGA Molekylärbiologi T3 / HT p (G = 24 p)
KORTSVARSFRÅGOR 1. Restriktionsenzymet HindIII klyver sekvensen 5 -AAGCTT-3 och lämnar ett fyra basers 5 -överhäng. Rita ut hur DNA-ändarna ser ut på ett fragment som klyvts med HindIII. (2p) SV: 5 -A
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, EITA50, LP4, 209 Inlämningsuppgift av 2, Assignment out of 2 Inlämningstid: Lämnas in senast kl
BÄNKVÅG / BENCH SCALE ANVÄNDARMANUAL / USER MANUAL SW-III www.liden-weighing.com Svenska OBS! Under vågen sitter en justerbar skruv (se bild). Standardinställning är den för vägning. Om ni vill rengöra
BÄNKVÅG / BENCH SCALE Modell : SW-III / Model : SW-III ANVÄNDARMANUAL / USER MANUAL SW-III WWW.LIDEN-WEIGHING.SE 2014-03-26 OBS! Under vågen sitter en justerbar skruv (se bild). Standardinställning är
Measuring child participation in immunization registries: two national surveys, 2001
Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
RADIATION TEST REPORT. GAMMA: 30.45k, 59.05k, 118.8k/TM1019 Condition D
RADIATION TEST REPORT PRODUCT: OP47AYQMLL Die Type: 147X FILE: OP47_LDR.xlsx DATE CODE: 95 GAMMA: 3.45k, 59.5k, 118.8k/TM119 Condition D GAMMA SOURCE: Co6 DOSE RATE: 8.6mRad(si)/s FACILITIES: University
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
Supplemental Figure S1.
A 1 -----------------------------------MASKKMTKSYFDVLGICCTSEVPLIENILNSMDGVKEFSVIVPSRTVIVVHDTLILSQFQIVKALNQAQLEANVRVTG--ETNFK 1 -------------------------MALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLEANVRVNG--ETSFK
REHAB BACKGROUND TO REMEMBER AND CONSIDER
Training in water REHAB BACKGROUND TO REMEMBER AND CONSIDER PHASE I: PROLIFERATION PROTECTION, 0-6 WEEKS PHASE II: TRANSITION PROGRESSION, 7-12 WEEKS PHASE III: REMODELLING FUNCTION, 13-32 WEEKS PHASE
Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:
Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
2.45GHz CF Card Reader User Manual. Version /09/15
2.45GHz CF Card Reader User Manual Version 2.0 2008/09/15 Install SYRD245-CF Card Reader to PDA: 1. Explorer SYRD245-CF folder of SYRIS Xtive CD-ROM 2. Check your PDA OS (Mobile5 or PPC2003) NETCF V2 currently
PRESS FÄLLKONSTRUKTION FOLDING INSTRUCTIONS
PRESS FÄLLKONSTRUKTION FOLDING INSTRUCTIONS Vänd bordet upp och ner eller ställ det på långsidan. Tryck ner vid PRESS och fäll benen samtidigt. Om benen sitter i spänn tryck benen mot kortsidan före de
Discovering!!!!! Swedish ÅÄÖ. EPISODE 6 Norrlänningar and numbers 12-24. Misi.se 2011 1
Discovering!!!!! ÅÄÖ EPISODE 6 Norrlänningar and numbers 12-24 Misi.se 2011 1 Dialogue SJs X2000* från Stockholm är försenat. Beräknad ankoms?d är nu 16:00. Försenat! Igen? Vad är klockan? Jag vet inte.
APOPTOS Programmerad celldöd
APOPTOS Programmerad celldöd Håkan Billig 2014 hakan.billig@fysiologi.gu.se 1 APOPTOS 1. Exempel på celldöd under normalt liv Grodyngel Fosterutveckling Anpassa cellantal Nerv-målcells interaktion hormon-målcells
Supplementary Information
Supplementary Information dynamically regulates group I metabotropic glutamate receptors. Jia Hua Hu, Linlin Yang, Paul J. Kammermeier, Chester G. Moore, Paul R. Brakeman, Jiancheng Tu, Shouyang Yu, Ronald
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Supplemental Data. Antony et al. (2010). Plant Cell /tpc
Sb05g018110 MAG--LSLQHPMAFAFGLLGNIISFMTYLAPLYRPTFYRIYKSKSTQGFQSVPYVVALF 57 Zm100194326 MAG--LSLQHPMAFAFGLLGNIISFMTYLAPL--PTFCRIYRNKSTEGFQSVPYVVALF 55 Zm100192602 MAG--LSLLHPMAFAFGLLGNIISFMTYLAPL--PTFYRIYKNKSTEGFQSVPYVVALF
INSTALLATION INSTRUCTIONS
INSTALLATION - REEIVER INSTALLATION INSTRUTIONS RT0 RF WIRELESS ROOM THERMOSTAT AND REEIVER MOUNTING OF WALL MOUTING PLATE - Unscrew the screws under the - Pack contains... Installation - Receiver... Mounting
LUNDS TEKNISKA HÖGSKOLA Inst. for Elektro- och Informationsteknik. SIGNALBEHANDLING I MULTIMEDIA, ETI265 Inlämningsuppgift 1 (av 2), Task 1 (out of 2)
LUNDS TEKNISKA HÖGSKOLA Inst. for Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, ETI65 Inlämningsuppgift (av ), Task (out of ) Inlämningstid: Inlämnas senast kl 7. fredagen den 5:e maj
Examples on Analog Transmission
Examples on Analog Transmission Figure 5.25 Types of analog-to-analog modulation Figure 5.26 Amplitude modulation Figure 5.29 Frequency modulation Modulation och demodulation Baudrate = antal symboler
Questionnaire on Nurses Feeling for Hospital Odors
J. Japan Association on Odor Environment Vol. -1 No. 0,**0 437 *, ** * * Questionnaire on Nurses Feeling for Hospital Odors Tomoyo ITAKURA*, **, Megumi MITSUDA*, Takuzo INAGAKI*,,/. + +-/ 13.+... + +,,
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and
BRUKSANVISNING. Oscilla 910
BRUKSANVISNING Oscilla 910 C A TEGNÉR AB BOX 20003 161 02 BROMMA TEL 08-564 822 00 FAX 08-564 822 09 INTERNET: www.categner.se E-MAIL: info@categner.se OSCILLA SM910 INNEHÅLL FRONTPANEL... 3 BAKPANEL...
PORTSECURITY IN SÖLVESBORG
PORTSECURITY IN SÖLVESBORG Kontaktlista i skyddsfrågor / List of contacts in security matters Skyddschef/PFSO Tord Berg Phone: +46 456 422 44. Mobile: +46 705 82 32 11 Fax: +46 456 104 37. E-mail: tord.berg@sbgport.com
This exam consists of four problems. The maximum sum of points is 20. The marks 3, 4 and 5 require a minimum
Examiner Linus Carlsson 016-01-07 3 hours In English Exam (TEN) Probability theory and statistical inference MAA137 Aids: Collection of Formulas, Concepts and Tables Pocket calculator This exam consists
Measuring void content with GPR Current test with PaveScan and a comparison with traditional GPR systems. Martin Wiström, Ramboll RST
Measuring void content with GPR Current test with PaveScan and a comparison with traditional GPR systems Martin Wiström, Ramboll RST Hålrum med GPR SBUF-projekt pågår för att utvärdera möjligheterna att
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private
ISO general purpose screw threads Basic profile Part 1: Metric screw threads
SVENSK STANDARD SS-ISO 68-1 Fastställd 2003-08-01 Utgåva 1 ISO-gängor för allmän användning Basprofil Del 1: Metriska ISO-gängor ISO general purpose screw threads Basic profile Part 1: Metric screw threads
Får endast utföras av behörig personal. May only be carried out by authorized electrician
Instruktion för DMIS Instruction for DMIS FLE400FC, FLE850MP, W3400H, W4400H/W4600H (-980/1287) W3850H/W31100H, W4850/W41100H (-1220/636) Clarus Control 471 1530-75 2016.05.04 Får endast utföras av behörig
Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM
Rastercell Digital Rastrering Hybridraster, Rastervinkel, Rotation av digitala bilder, AM/FM rastrering Sasan Gooran (VT 2007) Önskat mått * 2* rastertätheten = inläsningsupplösning originalets mått 2
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
2.1 Installation of driver using Internet Installation of driver from disk... 3
&RQWHQW,QQHKnOO 0DQXDOÃ(QJOLVKÃ'HPRGULYHU )RUHZRUG Ã,QWURGXFWLRQ Ã,QVWDOOÃDQGÃXSGDWHÃGULYHU 2.1 Installation of driver using Internet... 3 2.2 Installation of driver from disk... 3 Ã&RQQHFWLQJÃWKHÃWHUPLQDOÃWRÃWKHÃ3/&ÃV\VWHP
Bridging the gap - state-of-the-art testing research, Explanea, and why you should care
Bridging the gap - state-of-the-art testing research, Explanea, and why you should care Robert Feldt Blekinge Institute of Technology & Chalmers All animations have been excluded in this pdf version! onsdag
Skyddande av frågebanken
Presentatör Martin Francke Flygteknisk inspektör Sjö- och luftfartsavdelningen Enheten för operatörer, fartyg och luftfartyg Sektionen för underhålls- och tillverkningsorganisationer 1 147.A.145 Privileges
District Application for Partnership
ESC Region Texas Regional Collaboratives in Math and Science District Application for Partnership 2013-2014 Applying for (check all that apply) Math Science District Name: District Contacts Name E-mail
Rev No. Magnetic gripper 3
Magnetic gripper 1 Magnetic gripper 2 Magnetic gripper 3 Magnetic gripper 4 Pneumatic switchable permanent magnet. A customized gripper designed to handle large objects in/out of press break/laser cutting
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Webbregistrering pa kurs och termin
Webbregistrering pa kurs och termin 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en länk till Studieöversiktssidan. På den sidan
EXPERT SURVEY OF THE NEWS MEDIA
EXPERT SURVEY OF THE NEWS MEDIA THE SHORENSTEIN CENTER ON THE PRESS, POLITICS & PUBLIC POLICY JOHN F. KENNEDY SCHOOL OF GOVERNMENT, HARVARD UNIVERSITY, CAMBRIDGE, MA 0238 PIPPA_NORRIS@HARVARD.EDU. FAX:
Supporting Information
Biosynthesis of Novel Statins by Combining Heterologous Genes from Xylaria and Aspergillus Hiroya Itoh, Makoto Matsui, Yuki Miyamura, Itaru Takeda, Jun Ishii, Toshitaka Kumagai, Masayuki Machida, Takashi
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Enkel linjär regression. Enkel linjär regression. Enkel linjär regression
Enkel linjär regression Exempel.7 i boken (sida 31). Hur mycket dragkraft behövs för att en halvledare skall lossna från sin sockel vid olika längder på halvledarens ben och höjder på sockeln. De halvledare
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
Calculate check digits according to the modulus-11 method
2016-12-01 Beräkning av kontrollsiffra 11-modulen Calculate check digits according to the modulus-11 method Postadress: 105 19 Stockholm Besöksadress: Palmfeltsvägen 5 www.bankgirot.se Bankgironr: 160-9908
säkerhetsutrustning / SAFETY EQUIPMENT
säkerhetsutrustning / SAFETY EQUIPMENT Hastighetsvakt / Speed monitor Kellves hastighetsvakter används för att stoppa bandtransportören när dess hastighet sjunker under beräknade minimihastigheten. Kellve
MOLECULAR SHAPES MOLECULAR SHAPES
Molecules with 2 electron pair groups around Linear molecules have polar bonds, but are the central atom form a linear shape. usually non-polar. is 180 linear 2 electron pairs around the central atom 1
Scratch Junior. makeandshape.com. by MIT. Gränssnitt Scratch Junior
Scratch Junior by MIT Gränssnitt Scratch Junior 1. Spara 2. Scen 3. Presentationsläge (fullskärm) 4. Rutnät 5. Byt bakgrund 6. Lägg till text 7. Återställ figur (till sin ursprungliga position) 8. Grön
PRESS FÄLLKONSTRUKTION FOLDING INSTRUCTIONS
PRESS FÄLLKONSTRUKTION FOLDING INSTRUCTIONS Vänd bordet upp och ner eller ställ det på långsidan. Tryck ner vid PRESS och fäll benen samtidigt. OBS! INGA STORA KRAFTER KRÄVS!! Om benen sitter i spänn tryck
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
in the inward-facing conformation revealed by single particle electron Supplementary information
Manuscript submitted to: Volume 2, Issue 2, 131-152. AIMS Biophysics Received date 16 February 2015, Accepted date 04 May 2015, Published date 13 May 2015 DOI: 10.3934/biophy.2015.2.131 Research article
MCP-16RC, Air Purification
Kompakt patronfilter med tryckstötsrensning. MCP-16RC Air Purification Tower är ett kompakt patronfilter för decentraliserad luftrening inomhus, där luft återåtervinning är möjlig. Den kompakta filterenheten
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
Webbreg öppen: 26/ /
Webbregistrering pa kurs, period 2 HT 2015. Webbreg öppen: 26/10 2015 5/11 2015 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Könsfördelningen inom kataraktkirurgin. Mats Lundström
Könsfördelningen inom kataraktkirurgin Mats Lundström Innehåll Fördelning av antal operationer utveckling Skillnader i väntetid Effekt av NIKE Skillnader i synskärpa före operation Skillnader i Catquest-9SF
SOLAR LIGHT SOLUTION. Giving you the advantages of sunshine. Ningbo Green Light Energy Technology Co., Ltd.
2017 SOLAR LIGHT SOLUTION Address:No.5,XingYeMiddleRoad,NingboFreeTradeZone,China Tel:+86-574-86812925 Fax:+86-574-86812905 Giving you the advantages of sunshine SalesServiceE-mail:sales@glenergy.cn Tech.ServiceE-mail:service@glenergy.cn
DUGGA Molekylärbiologi T2 / VT p (G = 25 p)
KORTSVARSFRÅGOR 1. Restriktionsenzymet BamHI klyver sekvensen 5 -G*GATCC-3 och lämnar 4 basers 5' överhäng. Rita upp det längsta DNA-fragmentet som bildas efter klyvning av nedanstående given sekvens med
System arbetssystem informationssystem
System arbetssystem informationssystem Vad är ett system? Exempel - Matsmältningssystemet - Immunförsvaret - Ett hemelektroniksystem -En skola System - definition Ett system är en uppsättning interagerande
Inkvarteringsstatistik. Göteborg & Co. Februari 2012
Inkvarteringsstatistik Göteborg & Co Februari 2012 FoU/ Marknad & Försäljning Gästnätter storstadsregioner Februari 2012, hotell och vandrarhem Gästnattsutveckling storstadsregioner Februari 2012, hotell
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
NORDIC GRID DISTURBANCE STATISTICS 2012
NORDIC GRID DISTURBANCE STATISTICS 2012 Utdrag ur rapport utarbetad av DISTAC-gruppen under RGN inom ENTSO-E Sture Holmström 2 Korta bakgrundsfakta > 1999-2000 utarbetades Riktlinjer för klassificering
Immunteknologi, en introduktion. Hur man använder antikroppar för att mäta eller detektera biologiska händelser.
Immunteknologi, en introduktion Hur man använder antikroppar för att mäta eller detektera biologiska händelser. Antikroppar genereras av b-lymphocyter, som är en del av de vita blodkropparna Varje ursprunglig
Matthew Thurley Industriell bildanalys (E0005E) Response rate = 65 %
Matthew Thurley Industriell bildanalys (E000E) Response rate = % Survey Results Legend Relative Frequencies of answers Std. Dev. Mean Question text Left pole % % Right pole n=no. of responses av.=mean
Båtbranschstatistik. Boating Industry Statistics SWEDISH MARINE INDUSTRIES FEDERATION
Båtbranschstatistik Boating Industry Statistics 1994 2003 SWEDISH MARINE INDUSTRIES FEDERATION Segelbåtar Antal Sailboats Units Segelbåtar Värde, MSEK Sailboats Value, MSEK Motorbåtar (inombord) Antal
4 grundregler. Minneshantering. Problemet. Windows minkrav
4 grundregler 1. Man kan aldrig få för mycket minne 2. Minnet kan aldrig bli för snabbt Minneshantering 3. Minne kan aldrig bli för billigt 4. Programmens storlek ökar fortare än minnet i datorerna (känns
Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting
Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting Salil Chanroj a, Yongxian Lu a, Senthilkumar Padmanaban a, Kei Nanatani c, Nobuyuki
Boiler with heatpump / Värmepumpsberedare
Boiler with heatpump / Värmepumpsberedare QUICK START GUIDE / SNABBSTART GUIDE More information and instruction videos on our homepage www.indol.se Mer information och instruktionsvideos på vår hemsida
Arctic. Design by Rolf Fransson
Arctic Design by Rolf Fransson 2 Endless possibilities of combinations. Oändliga kombinationsmöjligheter. 3 4 5 If you are looking for a range of storage furniture which limits of combination is set by
Suppl. Figure 1(a) Jur wt DMSO
Suppl. Figure 1(a) Jur wt DMSO Jur wt 6-MP Jur wt 6-TG Jur kd DMSO Jur kd 6-MP Jur kd 6-TG Suppl. Figure 1(b) Jur wt DMSO Jur wt 6-MP Jur wt 6-TG Jur kd DMSO Jur kd 6-MP Jur kd 6-TG Suppl. Figure 2(a)
www.pianoflygelservice.com
PRESENTERAR KLIMATANLÄGGNING FÖR PIANON OCH FLYGLAR. Varför blir ett piano eller en flygel ostämd? Det kan vara många orsaker, t.ex. hårdhänt bruk, flyttning av instrument, stora skillnader i luftfuktighet
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
Sannolikhetsteori. Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik,
Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik, 5p. Tid: Lördag den 29 mars, 2008 kl 14.00-18.00 i V-huset. Examinator: Olle Nerman, tel 7723565. Jour: Alexandra Jauhiainen,
Materialplanering och styrning på grundnivå. 7,5 högskolepoäng
Materialplanering och styrning på grundnivå Provmoment: Ladokkod: Tentamen ges för: Skriftlig tentamen TI6612 Af3-Ma, Al3, Log3,IBE3 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
LOG/iC2. Introduction
LOG/iC2 Introduction L00000 11110111111111111111111111111111111111111111* L04884 11111111111111111111111111111111111111111111* L04928 11111111011111111111111111111111111111101111* L04972 11111111101110111111111111111111111111011111*
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
Sectra Critical Security Services. Fel bild
Sectra Critical Security Services Fel bild Sectra is world leading in data security Sectra is also one of Europes most reknown IT-security companies with solutions such as: EU TOP SECRET High speed encryption
Supplementary Data. Figure S1: EIMS spectrum for (E)-1-(3-(3,7-dimethylocta-2,6-dienyl)-2,4,6-trihydroxyphenyl)butan-1-one (3d) 6'' 7'' 3' 2' 1' 6
Supplementary Data H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S1: EIMS spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)-,,-trihydroxyphenyl)butan-1-one (d) H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S:
ASSEMBLY INSTRUCTIONS SCALE SQUARE - STANDARD
ASSEMBLY INSTRUCTIONS ALL COMPONENTS Metal profile 0 mm Gripper Ceiling attachments Screws for ceiling attachements (not included) Wires Metal profile 60 mm Metal profile 00 mm Felt - Full Felt - Half
Normalfördelning. Modeller Vi har alla stött på modeller i olika sammanhang. Ex:
Normalfördelning 1 Modeller Vi har alla stött på modeller i olika sammanhang. Ex: Leksaksbilar Modelljärnvägar Dockskåp 2 En leksaksbil är i vissa avseenden en kopia av en riktig bil. Men den skiljer sig
Övning 4 EITF25 & EITF Protokoll. October 29, 2016
- 2016 Protokoll October 29, 2016 1 Uppgift 1. Nedan finns en Ethernet II-ram där Preamble, SFD och CRC är borttagna. Ramen är beskriven i hexadecimalt format. Svara på följande frågor genom att studera
ISO general purpose metric screw threads Selected sizes for screws, bolts and nuts
SVENSK STANDARD SS-ISO 262 Fastställd 2003-08-01 Utgåva 1 Metriska ISO-gängor för allmän användning Utvalda storlekar för skruvar och muttrar ISO general purpose metric screw threads Selected sizes for
Manhour analys EASA STI #17214
Manhour analys EASA STI #17214 Presentatör Johan Brunnberg, Flygteknisk Inspektör & Del-M Koordinator Sjö- och luftfartsavdelningen Operatörsenheten Sektionen för teknisk operation 1 Innehåll Anmärkningen
Kursbok: The immune system Peter Parham. Kapitel 5 Hela skall läsas och kunnas utom: Kapitel 5.5; Fig. 5.9 Kapitel 5.11 och 5.12
T-cellsutveckling. Kursbok: The immune system Peter Parham Kapitel 5 Hela skall läsas och kunnas utom: Kapitel 5.5; Fig. 5.9 Kapitel 5.11 och 5.12 Några viktiga punkter för att börja med: T celler: thymus
Exempel på uppgifter från års ämnesprov i matematik för årskurs 3. Engelsk version
Exempel på uppgifter från 2010 2013 års ämnesprov i matematik för årskurs 3 Engelsk version Exempeluppgifter i årskurs 3, 2010, 2011 och 2012 1 Äp3Ma13 Part B 2 Innehåll Inledning... Fel! Bokmärket är
SEKUNDERNA - THE SECONDS, FILM/PROJECT
SEKUNDERNA - THE SECONDS, 2004-2007 FILM/PROJECT Verkbeskrivning - Work description Filmen sekunderna besår av 365 stillbilder överförda till 40:min 35mm, HD stum film. Den 6 juli 2004 kl.18.30 utfördes
ASSEMBLY INSTRUCTIONS SCALE CIRCLE - STANDARD
ASSEMBLY INSTRUCTIONS ALL COMPONENTS Metal profile 0 mm Gripper Ceiling attachments Screws for ceiling attachements (not included) Wires Metal profile 60 mm Metal profile 00 mm Felt - Full Felt - Half
Statistical Quality Control Statistisk kvalitetsstyrning. 7,5 högskolepoäng. Name: Personal number: Date of exam: 28 aug Time: 14-18
Statistical Quality Control Statistisk kvalitetsstyrning 7,5 högskolepoäng Ladok code: 41T05A, The exam is given to: 41I02B IBE11, Pu2, Af2-ma Name: Personal number: Date of exam: 28 aug Time: 14-18 Hjälpmedel
Anders Persson Philosophy of Science (FOR001F) Response rate = 0 % Survey Results. Relative Frequencies of answers Std. Dev.
Anders Persson Philosophy of Science (FOR00F) Response rate = 0 % Survey Results Legend Relative Frequencies of answers Std. Dev. Mean Question text Left pole % % Right pole n=no. of responses av.=mean