* 2 0 * 4 0 * 6 0 * 8 0 * * * * * * * * * 2 6 0

Save this PDF as:
 WORD  PNG  TXT  JPG

Storlek: px
Starta visningen från sidan:

Download "* 2 0 * 4 0 * 6 0 * 8 0 * * * * * * * * * 2 6 0"

Transkript

1 Supplemental Figure 1. Protein alignment of the six members of the NPR family. Protein alignment was generated using MUSCLE software. Amino acid residues highlighted in back share similar chemical properties in all six members and residues highlighted in grey are common for some of the members. Numbers refer to the amino acid position on. BTB/POZ and ankyrin repeats domains are represented by dashed line box and solid line box, respectively. Conserved cysteines are indicated by solid black arrows. The five basic amino acids facilitating the nuclear localization of NPPR1 are indicated by empty black arrows. N P R 1 : N P R : N P R : N P R : B O P : B O P 1 : N P R 1 : N P R : N P R : N P R : B O P : B O P 1 : N P R 1 : N P R : N P R : N P R : B O P : B O P 1 : N P R 1 : N P R : N P R : N P R : B O P : B O P 1 : N P R 1 : N P R : N P R : N P R : B O P : B O P 1 : * 0 * 0 * 0 * 8 0 * * 1 0 * M D T T I D G F A D S Y E I S S T S F V A T D N T D S S I V Y L A A E Q V L T G P D V S A L Q L L S N S F E S V F D S P D D F Y S D A K L V L - S D G R E V S F H R C V L S A R S S F F K S A L A A A K K E K D S N N T A A V K L E L K M A T T T T T T T A R F S D S Y E F S N T S G N S F F A A E S S L D Y P T E - - F L T P P E V S A L K L L S N C L E S V F D S P E T F Y S D A K L V L - A G G R E V S F H R C I L S A R I P V F K S A L A T V K E Q K S S T T V K L Q L K M A T L T E P S S S L S F T S S H F - - S Y G S I G S N H F S S S - - S A S N P E V V S L T K L S S N L E Q L L S N S D C D Y S D A E I I V - - D G V P V G V H R C I L A A R S K F F Q D L F K K E K K I S K T E K P K Y Q L R M A A T A I E P S S S I S F T S S H L - - S N P S P V V T T Y H S A - - A N L E E L S S N L E Q L L T N P D C D Y T D A E I I I E E E A N P V S V H R C V L A A R S K F F L D L F K K D K D S S E - K K P K Y Q M K M S N L E E S L R S L S L D F L N L L I N G Q A - F S D V T F S V - - E G R L V H A H R C I L A A R S L F F R K F F C G T D S P Q P V T G I D P T Q H G S V P A S P T R G S T A P A M S N T F E E S L K S M S L D Y L N L L I N G Q A - F S D V T F S V - - E G R L V H A H R C I L A A R S L F F R K F F C E S D P S Q P G A E P A N Q T G S G A R A A A V G t L S 5 D g V H R C L A R s f F 1 0 * 1 0 * * 0 0 * 0 * 0 * 0 E I A K D Y E V G F D S V V T V L A Y V Y S S R V R P P P K G V S E C A D E N C C H V A C R P A V D F M L E V L Y L A F I F K I P E L I T L Y Q R H L L D V V D K V V I E D T L V I L K L A N I C G K A C M K L L D R C K E I I V K S N V D M V S L E K S L P E E E I A R D Y E V G F D S V V A V L A Y V Y S G R V R S P P K G A S A C V D D D C C H V A C R S K V D F M V E V L Y L S F V F Q I Q E L V T L Y E R Q F L E I V D K V V V E D I L V I F K L D T L C G T T Y K K L L D R C I E I I V K S D I E L V S L E K S L P Q H E M L P Y G A V A H E A F L Y F L S Y I Y T G R L K P F P L E V S T C V D P V C S H D C C R P A I D F V V Q L M Y A S S V L Q V P E L V S S F Q R R L C N F V E K T L V E N V L P I L M V A F N C K L T - - Q L L D Q C I E R V A R S D L Y R F C I E K E V P P E D L L P Y G N V G R E A F L H F L S Y I Y T G R L K P F P I E V S T C V D S V C A H D S C K P A I D F A V E L M Y A S F V F Q I P D L V S S F Q R K L R N Y V E K S L V E N V L P I L L V A F H C D L T - - Q L L D Q C I E R V A R S D L D R F C I E K E L P L E G I I P V N S V G Y E V F L L L L Q F L Y S G Q V S I V P Q K H E P R P N C G E R G C W H T H C S A A V D L A L D T L A A S R Y F G V E Q L A L L T Q K Q L A S M V E K A S I E D V M K V L I A S R K Q D M H - - Q L W T T C S H L V A K S G L P P E I L A K H L P I D G V I P V N S V G Y E V F L L L L Q F L Y S G Q V S I V P H K H E P R S N C G D R G C W H T H C T A A V D L S L D I L A A A R Y F G V E Q L A L L T Q K H L T S M V E K A S I E D V M K V L I A S R K Q D M H - - Q L W T T C S Y L I A K S G L P Q E I L A K H L P I E V g L 5 Y g P s C d C H C a D f L l V K E 1 l L C S K P * 8 0 * 0 0 * 0 * 0 * 0 * 8 0 * L V K E I I D R R K E L G L E V P K V K K H V S N V H K A L D S D D I E L V K L L L K E D H T N L D D A C A L H F A V A Y C N V K T A T D L L K L D L A D V N H R - N P R G Y T V L H V A A M R K E P Q L I L S L L E K G A S A S E A T I F K Q I I D I R E A L C L E P P K L E R H V K N I Y K A L D S D D V E L V K M L L L E G H T N L D E A Y A L H F A I A H C A V K T A Y D L L E L E L A D V N L R - N P R G Y T V L H V A A M R K E P K L I I S L L M K G A N I L D T T V A E K I K Q L R L I S P Q D E E T S P K I S E K L L E R I G K I L K A L D S D D V E L V K L L L T E S D I T L D Q A N G L H Y S V V Y S D P K V V A E I L A L D M G D V N Y R - N S R G Y T V L H F A A M R R E P S I I I S L I D K G A N A S E F T V L E K I K Q L R V K S V N I P E V E D K S I E R T G K V L K A L D S D D V E L V K L L L T E S D I T L D Q A N G L H Y A V A Y S D P K V V T Q V L D L D M A D V N F R - N S R G Y T V L H I A A M R R E P T I I I P L I Q K G A N A S D F T V V T K I E E L R L K S S I A R R S L M P H N H H H D L S V A Q D L E D Q K I R R M R R A L D S S D V E L V K L M V M G E G L N L D E S L A L H Y A V E S C S R E V V K A L L E L G A A D V N Y P A G P A G K T P L H I A A E M V S P D M V A V L L D H H A D P N V R T L V A K I E E L R L K S S M P L R S L M P - - H H H D L T S T L D L E D Q K I R R M R R A L D S S D V E L V K L M V M G E G L N L D E S L A L I Y A V E N C S R E V V K A L L E L G A A D V N Y P A G P T G K T A L H I A A E M V S P D M V A V L L D H H A D P N V Q T I R A L D S D E L V K L D L h 5 a L L a D V N G T L H A A P L A T 0 0 * 0 * 0 * 0 * 8 0 * * 5 0 L E G R T A L M I A K Q A T M A V E C N N I P E Q C K H S L K G R L C V E I L E Q E D K R E Q I - P R D V P P S F A V A A D E L K M T L L D L E N R V A L A Q R L F P T E A Q A A M E I A E M K G T C E F I V - T S L E P D R L T G T K R T S P G V K I A P F R I L E E L D G R T A L V I V K R L T K A D D Y K T S T E D G T P S L K G G L C I E V L E H E Q K L E Y L S P I E A S L S L P V T P E E L R M R L L Y Y E N R V A L A R L L F P V E T E T V Q G I A K L E E T C E F T A - S S L E P D H H I G E K R T S L D L N M A P F Q I H E K S D G R S A V N I L R R L T N P K D Y H T K T A K G R E S S K A R L C I D I L E R E I R K N P M - V L D T P M C S I S M P E D L Q M R L L Y L E K R V G L A Q L F F P T E A K V A M D I G N V E G T S E F T G - L S P P S S G L T G - N L S Q V D L N E T P H M Q T Q R F D G R S A V N I C R R L T R P K D Y H T K T S R K E P S - K Y R L C I D I L E R E I R R N P L V S G D T P T C S H S M P E D L Q M R L L Y L E K R V G L A Q L F F P A E A N V A M D V A N V E G T S E C T G L L T P P P S N D T T E N L G K V D L N E T P Y V Q T K R V G G I T P L D I L R T L T S D F L F K G A V P G L T H I E P N K L R L C L E L V Q S A A M V I S R E E G N N S N N Q N N D N N T G V D G I T P L D I L R T L T S D F L F K G A I P G L T H I E P N K L R L C L E L V Q S A A L V I S R E E G N N N S N D N N T M G I l T p p L L a e g t * 5 0 * 5 0 * * 0 0 * 0 * 0 * H Q S R L K A L S K T V E L G K R F F P R C S A V L D Q I M N C E D L T Q L A C G E D D T A E K R L Q K K Q R Y M E I Q E T L K K A F S E D N L - E L G N S S L T D S T S S T S K S T G G K R S N R K L S H R R R H L S R L R A L C K T V E L G K R Y F K R C S - - L D H F M D T E D L N H L A S V E E D T P E K R L Q K K Q R Y M E L Q E T L M K T F S E D K E - E C G K S S T P K P T S A V R S N R K L S H R R L K V D K R D F L K R P Y G N G D L L T R M V A L M K T V E T G R R F F P Y G S E V L D K Y M A E Y I D D D I L D D F H F E K G S T H E R R L K R M R Y R E L K D D V Q K A Y S K D K E S K I A R S C L S A S S S P S S S S I R D D L H N T T M L T R M K A L M K T V E T G R R Y F P S C Y E V L D K Y M D Q Y M D E E I P D M S Y P E K G T V K E R R Q K R M R Y N E L K N D V K K A Y S K D K V A R S C L S S S S P A S S L R E A L E N P T I Y P H M N E E H N S G S S G G S N N N L D S R L V Y L N L G A G T G Q M G P G R D Q G D D H - - N S Q R E G M S R H H H H H Q D P S T M Y H H H H Q H H F I Y P R M K D E H T S G S S L D S R L V Y L N L G A T N R D I G D D N - - S N Q R E G M N - L H H H H H D P S T M Y H H H H H H F p Y D : 5 9 : 0 0 : 5 8 : 5 7 : 9 1 : 7 : : 1 1 : 1 0 : : 8 7 : 8 : : : : 8 : 1 7 : 1 : 5 9 : 5 8 : 5 5 : : 9 : : 8 9 : 8 9 : 8 : 7 7 : 1 5 : 0 5

2 Supplemental Figure. Schematic representation of cis-acting element in the promoters of NPR family genes. The blue lines represent the promoter regions of the six members (about 1.5kb upstream of start codon). Putative TATA boxes (yellow blocks), CAAT boxes (blue blocks) and W boxes (red blocks) were identified by querying the PLACE database. ( NPR NPR NPR BOP BOP1 100 bp TATA box CAAT box W box

3 Supplemental Figure. Expression profiles of NPR family members from microarray database resource Genevestigator. Summary of relative expression levels (Log ) of NPR family genes in various tissues of Arabidopsis, generated by Genevestigator software. The expression of each gene is represented by its designated color. Arabidopsis thaliana callus cell culture / primary cel l sperm cel l seedlin g cotyledons hypocotyl radicle imbibed seed inflorescence flower carpel ovar y stigma petal sepal stamen pollen abscission zone pedicel silique seed embryo endosper m micropylar endosperm peripheral endosper m chalazal endosper m testa (seed coat ) general seed coat chalazal seed coat suspensor stem node shoot apex cauline leaf rosette juvenile leaf adult leaf petiole senescent leaf hypocotyl xylem cork leaf primordi a stem roots lateral root root hair zone root tip elongation zone endodermi s endodermis+corte x epid. atrichoblast s lateral root cap stel e NPR NPR NPR BOP BOP1 arrays Log Relative Expression Levels

4 Supplemental Figure. Bacterial populations (genotypes indicated on x-axis) day 0 after inoculation with virulent P.s.t. DC000. Data represent mean ± SE of three replicates, each consisting of four infected inflorescences. A, Flowers of six-week-old Col-0, npr1-, npr-, npr- and npr- npr- (as in Fig. H). B, Flowers of six-week-old Col-0, npr1-, npr- and npr1- npr- double mutant (as in Fig. K). C, Leaves of four-week-old Col-0 and five independent transgenic lines overexpressing NPR (as in Fig. 5C). D, Flowers of an F (Col-0 X npr-) segregating population of 9 plants, including Col-0, 5 heterozygous NPR/npr-, and 7 homozygous npr mutants (as in Fig. 7E). A 5 B 5 Log 10 Pseudomonas syringae (cfu mg FW -1 ) 1 Log 10 Pseudomonas syringae (cfu mg FW -1 ) 1 0 Col-0 npr1- npr- npr- npr- npr- 0 Col-0 npr1- npr- npr1- npr- C 5 D 5 Log 10 Pseudomonas syringae (cfu mg FW -1 ) 1 Log 10 Pseudomonas syringae (cfu mg FW -1 ) 1 0 Col-0 5S:NPR T1-1 5S:NPR T1-5S:NPR T1-5S:NPR T1-5S:NPR T1-5 0 Col-0 NPR/npr- npr-

5 Supplemental Figure 5. Additional negative control for transient BiFC analysis (Fig. ). A, Representative bright field image. B through F, Representative confocal images of onion epidermal cells co-bombarded with constructs expressing B, YFPC and NPR:YFPN, C,YFPN and TGA:YFPC, D, YFPC and :CFPN, E, CFPN and TGA:YFPC, F, YFPN and :YFPC. All of them served as extra negative control for transient BiFC assay in Fig. to rule out that each YFP half alone can interact with NPR, TGA or. A C E B D F

6 Supplemental Dataset 1. Protein sequences used to generate the phylogenetic tree presented in Figure 1B. >AT1G80 () MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSD AKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVT VLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFKIPELITLYQRHLLDVVD KVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVP KVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVN HRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKH SLKGRLCVEILEQEDKREQIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAE MKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQI MNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGK RSNRKLSHRRR >ATG10 (NPR) MATTTTTTTARFSDSYEFSNTSGNSFFAAESSLDYPTEFLTPPEVSALKLLSNCLESVFDSPETFYS DAKLVLAGGREVSFHRCILSARIPVFKSALATVKEQKSSTTVKLQLKEIARDYEVGFDSVVAVLA YVYSGRVRSPPKGASACVDDDCCHVACRSKVDFMVEVLYLSFVFQIQELVTLYERQFLEIVDKV VVEDILVIFKLDTLCGTTYKKLLDRCIEIIVKSDIELVSLEKSLPQHIFKQIIDIREALCLEPPKLERH VKNIYKALDSDDVELVKMLLLEGHTNLDEAYALHFAIAHCAVKTAYDLLELELADVNLRNPRG YTVLHVAAMRKEPKLIISLLMKGANILDTTLDGRTALVIVKRLTKADDYKTSTEDGTPSLKGGLC IEVLEHEQKLEYLSPIEASLSLPVTPEELRMRLLYYENRVALARLLFPVETETVQGIAKLEETCEFT ASSLEPDHHIGEKRTSLDLNMAPFQIHEKHLSRLRALCKTVELGKRYFKRCSLDHFMDTEDLNHL ASVEEDTPEKRLQKKQRYMELQETLMKTFSEDKEECGKSSTPKPTSAVRSNRKLSHRRLKVDKR DFLKRPYGNGD >AT5G5110 (NPR) MATLTEPSSSLSFTSSHFSYGSIGSNHFSSSSASNPEVVSLTKLSSNLEQLLSNSDCDYSDAEIIVDG VPVGVHRCILAARSKFFQDLFKKEKKISKTEKPKYQLREMLPYGAVAHEAFLYFLSYIYTGRLKP FPLEVSTCVDPVCSHDCCRPAIDFVVQLMYASSVLQVPELVSSFQRRLCNFVEKTLVENVLPILM VAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPPEVAEKIKQLRLISPQDEETSPKISEKLLERIGKI LKALDSDDVELVKLLLTESDITLDQANGLHYSVVYSDPKVVAEILALDMGDVNYRNSRGYTVL HFAAMRREPSIIISLIDKGANASEFTSDGRSAVNILRRLTNPKDYHTKTAKGRESSKARLCIDILER EIRKNPMVLDTPMCSISMPEDLQMRLLYLEKRVGLAQLFFPTEAKVAMDIGNVEGTSEFTGLSPP SSGLTGNLSQVDLNETPHMQTQRLLTRMVALMKTVETGRRFFPYGSEVLDKYMAEYIDDDILD DFHFEKGSTHERRLKRMRYRELKDDVQKAYSKDKESKIARSCLSASSSPSSSSIRDDLHNTT >ATG190 (NPR) MAATAIEPSSSISFTSSHLSNPSPVVTTYHSAANLEELSSNLEQLLTNPDCDYTDAEIIIEEEANPVS VHRCVLAARSKFFLDLFKKDKDSSEKKPKYQMKDLLPYGNVGREAFLHFLSYIYTGRLKPFPIEV STCVDSVCAHDSCKPAIDFAVELMYASFVFQIPDLVSSFQRKLRNYVEKSLVENVLPILLVAFHC

7 DLTQLLDQCIERVARSDLDRFCIEKELPLEVLEKIKQLRVKSVNIPEVEDKSIERTGKVLKALDSD DVELVKLLLTESDITLDQANGLHYAVAYSDPKVVTQVLDLDMADVNFRNSRGYTVLHIAAMRR EPTIIIPLIQKGANASDFTFDGRSAVNICRRLTRPKDYHTKTSRKEPSKYRLCIDILEREIRRNPLVS GDTPTCSHSMPEDLQMRLLYLEKRVGLAQLFFPAEANVAMDVANVEGTSECTGLLTPPPSNDTT ENLGKVDLNETPYVQTKRMLTRMKALMKTVETGRRYFPSCYEVLDKYMDQYMDEEIPDMSYP EKGTVKERRQKRMRYNELKNDVKKAYSKDKVARSCLSSSSPASSLREALENPT >ATG170 (BOP) MSNLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDSPQPVTGI DPTQHGSVPASPTRGSTAPAGIIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHT HCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDVMKVLIASRKQDMHQLWTTC SHLVAKSGLPPEILAKHLPIDVVTKIEELRLKSSIARRSLMPHNHHHDLSVAQDLEDQKIRRMRRA LDSSDVELVKLMVMGEGLNLDESLALHYAVESCSREVVKALLELGAADVNYPAGPAGKTPLHI AAEMVSPDMVAVLLDHHADPNVRTVGGITPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELV QSAAMVISREEGNNSNNQNNDNNTGIYPHMNEEHNSGSSGGSNNNLDSRLVYLNLGAGTGQMG PGRDQGDDHNSQREGMSRHHHHHQDPSTMYHHHHQHHF >ATG5710 (BOP1) MSNTFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESDPSQPGA EPANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHEPRSNCGDRGCWHTHC TAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASIEDVMKVLIASRKQDMHQLWTTCSY LIAKSGLPQEILAKHLPIELVAKIEELRLKSSMPLRSLMPHHHDLTSTLDLEDQKIRRMRRALDSS DVELVKLMVMGEGLNLDESLALIYAVENCSREVVKALLELGAADVNYPAGPTGKTALHIAAEM VSPDMVAVLLDHHADPNVQTVDGITPLDILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAL VISREEGNNNSNDNNTMIYPRMKDEHTSGSSLDSRLVYLNLGATNRDIGDDNSNQREGMNLHH HHHDPSTMYHHHHHHF >OS01G09880 MSSNGKPNPPPAASAAAAAGNGAGGPPKMYQRPIYRPQAPAAKRRRGGRSSCRFSCCCCFFYAV LVVLLLAFVAAVAGGAFYLLYRPHRPAFTLSVARVDKLSLSSSATAPTLTDSIDVTLTAKNPNKK LVYLYDDFAVTAATAANAVPLGEGSVPGFVHDAGNITVIKATVSASALGVDPTTAATDIKKSGE FTITLDLETKAGVKVGGLKTKKIGVLVHCEGIKVAAPAPPPPPAKKKKGGVKLSVSDAPSPAASV DDTTPSPPPATTVARVCQVRIRVKIWKWTF >OS0G0 METSTISFSSSSPPSPPPPQPAPGDIDAVSLGRLSRNLENLLDPAFLNCADAEIVLASGGGDPGGGA VVGVHRCILAARSRFFYDHFSSAPAPAPATAGDKPQLDLDGLVPGGRHIGRDALVAVLSYLYTG RLRSAPPEAAACLDDGCSHDACRPAIDFVVESTYAASGFQISELVSLFQRRLSDFVNKALAEDILP ILVVASTCHLPELLNQCIQRVANSNLDNRYLEKRLPDDLYAKLKEFRVPDEPHSGILDPEHEKRV RNIHKALDSDDVDLVGMLLKESPVTLDDAFAIHYAAAYCEPKVLAELLKLESANVNLKNSSGYT PLHMACMRREPDIIVSLIEKGASVLERTQDGRDALTICKRLTREKDRNEKSEKCKERSKAYLCIG VLQQEIKRRPQILEDQMSAEESIATPLLVDNFHMRLLNLENRVAFARIFFPSEAKLVMRIAQADST QEFAGLTSANFSKLKEVDLNETPTMQNRRLRERLDALTKTVELGRRYFPHCSEVLDKFLNEESTD

8 LILLESGTAEDQQTKRMRFSELREDVRKAFTKDKAAGAAISSSTSASSSPRYETKLRPGNKKGKL SR >OS01G500 MPARSAVVVIAMEPSSSITIASSSSYLSNGSSPCSVSLAPPGAGAVAAQAAPVAAGEGGGGGGGG GGGGSSSVEVVSLNRLSANLERLLLDSDLDCSDADVDVADGGPPVPVHRCILAARSTFFYNLFA ARGRGGDGAAGGGGGGGGGGGERTGGRPRYKMEELVPGGRVGRDAFLSLLGYLYTGKLRPAP DDVVSCADPMCPHDSCPPAIRFNVEQMYAAWAFKITELISLFQRRLLNFVDKTLVEDVLPILQVA FHSELTPVLEKCIRRIARSNLDNVSLDKELPPEVAVQIKEIRQKSQPNEGDTVISDPVHEKRVRRIH RALDSDDVELVKLLLNESEITLDDANALHYAAAYCDSKVVSELLDLRLANLNLKNSRGYTALHL AAMRREPAIIMCLLNKGAAVSQLTADGQSAMSICRRLTRMKDYNTKMEQGQESNKDRLCIDILD REMIRKPMAVEDSVTSPLLADDLHMKLLYLENRVAFARLFFPAEAKVAMQIAQADTTPEFGIVP AASTSGKLKEVDLNETPVTQNKRLRSRVDALMKTVELGRRYFPNCSQVLDKFLEDDLPDSPDAL DLQNGTSDEQNVKRMRFCELKEDVRKAFSKDRADNSMFSILSSSSSSSPPPKVAKK >OS11G0800 MEAPGELLLLSMAAFATAHPGERASIQAALGSLPRAPSSTMYYRFGSHGLQVLGENREPSASGG GGQAQATQQQQGTSSGVADNRREHAFDFGVGSSSSSSGRRHAMGAAPSVISGSKRVAREE GGHSCGFEFEGSDQGRHAARGQACGLGGLDQGPSGGSAHDEDARGYGFGDARCVGQRKDAAP THQLRIGAGRDQGRSVRLRRDAREDGRGRRLEEGNRAGDGYVAASVQAHGDACVEDQGAGSS SVQQLPSSVDGSDGMIAFEVGKELTLHGSVVSSPWNELWLGKPLIFHDLDLVRAMKDQGGMPN ERIDLSGKITSILLSHPGPVSYFRIDSSVINNGAQQKIEEWCDVLRKKNVETVVMANCQWPSHPIE FPLQSLNCSSLRTLHLCFFNIPDMYLDHVSSLAVIDLACCRISDENLFALVCQCVSLRELDIGMFSE GKERIRSESLKFLQIWRSSVSHITIQWAPKLEKVIIGAAQGMKSFSSRTSSSTWISILGAPMLREVW FNLSSQTRSIDNVYLDVGHVPITSLRKLELSIAFKERKGRHALLNFFRSCTELKELVLWREDKVYF EEECDVHSDDWSSALKDIACLKSHLQVLKLFDYGGGETEIAIASAVLEHGASIENLTIMSTTSNAD DILSQAKQKLEKVERDSQITGDKKKYSIRDSQENWRQKIQIIQRVAVKQALIPREFIQSINSPRGLR FLLRGWGSSRVTDPAGAVAQDAELMESVGAGHRPDVVALLEILEAHRAALLCRLAHSQVVKIA AGECMFHGVRGGGGGGGGGILAKVAGLHTMHWRIPYHPTRDLLDEVALGICRGGCGIHACAN ASRSRG >OS1G010 MSSEDSLKSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPP PPPPPLNWPTAGGGGGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASV AAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDD VMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAAAAAPRSP FLTHHYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCN RDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNSRTLDGVTPLDV LRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGAPVTGGEAGGSDGGNFPRSD ADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNNGRGSPPPAMYFPNGFA > OS01G700

9 MEETLKSLSMDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQAAAPP GALLLDHLSPRSPSGGASASSPRGAGGSAAAAAAATPGAVIPVSSVSYEVFLLLLQFLYSGQVSL VPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQLAGMVEKASIEDV MKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDELRLKSMSRRSPFLSHHH HHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVEN CSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAVLLDHHADPNVRTVDGVTPL DILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMVMSREDAQTAAVNAAPIYGESPGGG GGGGVYNASGTSSSMVNLSLDNRMVYLNLGMDAQFGKMNDGGDGDDGGSRGPSSLFSPHGFP >ATG750 (CAO) MQKVFLAMDTCALVIHQSLSRIKLSPPKSSSSSSSAFSPESLPIRRIELCFRGAICAAVQRNYEETTS SVEEAEEDDESSSSYGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWW TAARKADEQALSQLLEDRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLDHRDMRGGL TALHMAAGYVRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPMQFGRRIGLEKVIN VLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEYAV AESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE

10 Supplemental Table 1. Primer sequences used in this study. Table 1. Primer sequences used for npr- and npr- genotyping. Primer Name Primer Sequences LP 5'-AGTGATCCGAAAGTTGTTGCC-' RP 5'-CCCTTCTCAAAGAAATCG-' LP 5'-TGTGTTCCATTTCTCCTG-' LBa1 5'-TGGTTCACGTAGTGGGCCATCG-' Supplemental Table. Primer sequences used to amplify promoters of NPR genes and cdna clones used. Gene Name Primer Sequences BAC Clone ID NPR NPR NPR BOP BOP1 5 -CGAAGCTTTTTGGCAATTGGGTGTTT- 5 -ATCCGAATCGGCGAATCCATCAA- 5 -GCAAGCTTAAGAAAGCAAGACCAAAA- 5 -CGCCGGCATCACGAGATCGGCG- 5 -GCAAGCTTTAGCCTTGTAGGTAGAGT- 5 -CTCCGCCTTCTTGTAGAATTATCA- 5 -CGAAGCTTCTTGGCTTGAGAGGTTTG- 5 -CGCCGTTTGTTCCCCAGAAGTAT- 5 -CGAAGCTTAACCCATAGTATTTCTTA- 5 -CGCCGAGTTGCCTCCTTTTATTG- 5 -GCAAGCTTTTCTGCGATAATGGT- 5 -GCCCGAGCTCCTTTGTTGATTTC- BAC F15H1 BAC F0B18 BAC K17O BAC T1H5 BAC F1H10 BAC FI1 Supplemental Table. Primer and probe sequences for TaqMan Assays of NPR genes in different plant tissues. Gene Name Primer Sequences Probe Sequences NPR NPR NPR BOP BOP1 Ubiquitin Actin 5'-GTCACGTGCTGTCTGACCTTGT-' 5'-TCACAGTTCATAATCTGGTCGAGC-' 5'-TTGCGTAGACGACGATTGTTG-' 5'-AAAGAACCTCCACCAAATCC-' 5'-AAGGTCCAAAAGGCATA-' 5'-AAGACAAGACCGCGCAATCT-' 5'-CACCCACTTGTTCCCATTCG-' 5'-CTGAGCAAGTCCCACTCGCT-' 5'-GAGCTGCCGTGAATTATCC-' 5'-CAGCCGCGTGCAA-' 5'-GGCCGTCTAGTCCACGCT C-' 5'-GAATTTGCGGAAGAAGAGGCT-' 5'-AGGCCTCAACTGGTTGCTGT-' 5'-ACCGGCAAGACCATCACTCT-' 5'-GATTCAGCCCAGAAGTCTTG-' 5'-TCTCGTGGATTCCAGCAGCT-' 5'-TYCCGCGCTGTTCGGCAGT-' 5'-CACGTGGCTTGCCGGTCAAAG G-' 5'-AGCAAAGACAAAGAGTCT-' 5'-TGCCCGAGGATCTCCAAAGGTT-' 5'-CGGGTCCGGCAGGGAAAACAC-' 5'-CCGTTGCATCCTCGCTGCTCG-' 5'-CGAGAGCAGCGACACCCATCGACA-' 5'-CCAGCCCTCGTTTGTGGGAAAGG-' Supplemental Table. Primer sequences used for amplifying cdna fragments for dotblot analysis.

11 Gene Name NPR PR1 Ubiquitin Primer Sequences 5 - CGTGTGCTCTTCATTTCGCTG- 5 - ATCGTTTCCCGAGTTCCACGGTTT- 5 - AGTGATCCGAAAGTTGTTGCCGAG- 5 - ACCTTCGACCAGTCTCAACTGT- 5 - CTCGAAAGCTCAAGATAGCCCACA- 5 - CTTCTCGTTCACATAATTCCCACG- 5 - ACCGGCAAGACCATCACTCT- 5 - AGGCCTCAACTGGTTGCTGT- Supplemental Table 5. Primer sequences used for BiFC vector construction and vector names. Gene Name Primer Sequences and cloning site BiFC Vector Name TGA NPR 5 -GCGAGCTCCCGACACCACCAT (SacI) 5'-GCCCGCGGCACCGACGACGAG-' (SacII) psata-ncerulean-n (pe7) 5 -GCGAGCTCCCGACACCACCAT-' (SacI) 5 -GCCCGCGGCACCGACGACGAG-'(SacII) psata-ceyfp-n1 (pe) 5 -GCGAATTCCGCTGATACCAGT-' (EcoRI) 5'-GTACCACTCTCTGGGTCGAGC-' (KpnI) 5'-GCGAGCTCCCGCTACTTTGAC-' (SacI) 5'-ATCCGCGGCTTGTGTTGTGC-' (SacII) psata-ceyfp-n1 (pe) psata-neyfp-n1 (pe085)

SUPPLEMENTARY FIGURE LEGENDS

SUPPLEMENTARY FIGURE LEGENDS SUPPLEMETARY FIGURE LEGEDS Supplementary Fig. 1. Flow cytometric analysis of wildtype, mutant and chimeric protein surface expression. Cells transduced with the individual constructs indicated were stained

Läs mer

Supplemental Data. Antony et al. (2010). Plant Cell /tpc

Supplemental Data. Antony et al. (2010). Plant Cell /tpc Sb05g018110 MAG--LSLQHPMAFAFGLLGNIISFMTYLAPLYRPTFYRIYKSKSTQGFQSVPYVVALF 57 Zm100194326 MAG--LSLQHPMAFAFGLLGNIISFMTYLAPL--PTFCRIYRNKSTEGFQSVPYVVALF 55 Zm100192602 MAG--LSLLHPMAFAFGLLGNIISFMTYLAPL--PTFYRIYKNKSTEGFQSVPYVVALF

Läs mer

Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG

Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP

Läs mer

Supplemental Figure S1.

Supplemental Figure S1. A 1 -----------------------------------MASKKMTKSYFDVLGICCTSEVPLIENILNSMDGVKEFSVIVPSRTVIVVHDTLILSQFQIVKALNQAQLEANVRVTG--ETNFK 1 -------------------------MALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLEANVRVNG--ETSFK

Läs mer

Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:

Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller: Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock

Läs mer

CUSTOMER READERSHIP HARRODS MAGAZINE CUSTOMER OVERVIEW. 63% of Harrods Magazine readers are mostly interested in reading about beauty

CUSTOMER READERSHIP HARRODS MAGAZINE CUSTOMER OVERVIEW. 63% of Harrods Magazine readers are mostly interested in reading about beauty 79% of the division trade is generated by Harrods Rewards customers 30% of our Beauty clients are millennials 42% of our trade comes from tax-free customers 73% of the department base is female Source:

Läs mer

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/2/91/ra61/dc1 Supplementary Materials for Coordinated Responses to Oxygen and Sugar Deficiency llow Rice Seedlings to Tolerate Flooding Kuo-ei Lee, Peng-en Chen,

Läs mer

Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM

Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM Rastercell Digital Rastrering Hybridraster, Rastervinkel, Rotation av digitala bilder, AM/FM rastrering Sasan Gooran (VT 2007) Önskat mått * 2* rastertätheten = inläsningsupplösning originalets mått 2

Läs mer

Preschool Kindergarten

Preschool Kindergarten Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound

Läs mer

Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!!

Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!! Exam Molecular Bioinformatics X (MB) - March, - Page of Skriv svar på varje uppgift på separata blad. Lycka till!! Write the answers to each of the questions on separate sheets of paper. ood luck!! ) Sequence

Läs mer

Personnummer. DUGGA Molekylärbiologi T3 / HT p (G = 24 p)

Personnummer. DUGGA Molekylärbiologi T3 / HT p (G = 24 p) KORTSVARSFRÅGOR 1. Restriktionsenzymet HindIII klyver sekvensen 5 -AAGCTT-3 och lämnar ett fyra basers 5 -överhäng. Rita ut hur DNA-ändarna ser ut på ett fragment som klyvts med HindIII. (2p) SV: 5 -A

Läs mer

Grafer, traversering. Koffman & Wolfgang kapitel 10, avsnitt 4

Grafer, traversering. Koffman & Wolfgang kapitel 10, avsnitt 4 Grafer, traversering Koffman & Wolfgang kapitel 1, avsnitt 4 1 Traversering av grafer De flesta grafalgoritmer innebär att besöka varje nod i någon systematisk ordning precis som med träd så finns det

Läs mer

Supplementary Material for: The generation of thermostable fungal laccase chimeras. by SCHEMA-RASPP structure-guided recombination in

Supplementary Material for: The generation of thermostable fungal laccase chimeras. by SCHEMA-RASPP structure-guided recombination in 1 Supplementary Material for: The generation of thermostable fungal laccase chimeras by SCHEMA-RASPP structure-guided recombination in vivo Ivan Mateljak a, Austin Rice b, Kevin Yang b, Thierry Tron c

Läs mer

Molecular Biology Primer

Molecular Biology Primer Molecular Biology Primer Starting 19 th century Cellular biology: Cell as a fundamental building block 1850s+: ``DNA was discovered by Friedrich Miescher and Richard Altmann Mendel s experiments with garden

Läs mer

Övning 4 EITF25 & EITF Protokoll. October 29, 2016

Övning 4 EITF25 & EITF Protokoll. October 29, 2016 - 2016 Protokoll October 29, 2016 1 Uppgift 1. Nedan finns en Ethernet II-ram där Preamble, SFD och CRC är borttagna. Ramen är beskriven i hexadecimalt format. Svara på följande frågor genom att studera

Läs mer

KARL ANDERSSON & SÖNER

KARL ANDERSSON & SÖNER MAY DESIGN PATRIK HANSSON 2013 Patrik fick i uppdrag av Karl Andersson & Söner att utveckla en praktisk byrå med egen identitet och olika ben alternativ. Resultatet blev byrån May med en lådfront där handtagen

Läs mer

Slutrapport till Partnerskap Alnarp (2007-05-01) för projektet: Omega 3 havre Havre med förbättrad fettbalans och förhöjt näringsvärde.

Slutrapport till Partnerskap Alnarp (2007-05-01) för projektet: Omega 3 havre Havre med förbättrad fettbalans och förhöjt näringsvärde. Slutrapport till Partnerskap Alnarp (2007-05-01) för projektet: Omega 3 havre Havre med förbättrad fettbalans och förhöjt näringsvärde. Projekttid (2005-06-01 - - 2006-05-31) Projektansvarig: Anders S.

Läs mer

Förskolan Kastanjen The Chestnut. Freja Palerius. Ersätt bilden med en egen bild. Handledare/ Lisa Deurell & Stefan Inghult Raam Supervisor.

Förskolan Kastanjen The Chestnut. Freja Palerius. Ersätt bilden med en egen bild. Handledare/ Lisa Deurell & Stefan Inghult Raam Supervisor. Förskolan Kastanjen The Chestnut Freja Palerius Handledare/ Lisa Deurell & Stefan Inghult Raam Supervisor Ersätt bilden med en egen bild Examinator/ Examiner Erik Wingquist Examensarbete inom arkitektur,

Läs mer

Isolda Purchase - EDI

Isolda Purchase - EDI Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language

Läs mer

Supplemental Information. P-TEFb Activation by RBM7 Shapes a Pro-survival. Transcriptional Response to Genotoxic Stress

Supplemental Information. P-TEFb Activation by RBM7 Shapes a Pro-survival. Transcriptional Response to Genotoxic Stress Molecular Cell, Volume 74 Supplemental Information P-TEFb Activation by RBM7 Shapes a Pro-survival Transcriptional Response to Genotoxic Stress Andrii Bugai, Alexandre J.C. Quaresma, Caroline C. Friedel,

Läs mer

Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting

Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting Salil Chanroj a, Yongxian Lu a, Senthilkumar Padmanaban a, Kei Nanatani c, Nobuyuki

Läs mer

DUGGA Molekylärbiologi T2 / VT p (G = 25 p)

DUGGA Molekylärbiologi T2 / VT p (G = 25 p) KORTSVARSFRÅGOR 1. Restriktionsenzymet BamHI klyver sekvensen 5 -G*GATCC-3 och lämnar 4 basers 5' överhäng. Rita upp det längsta DNA-fragmentet som bildas efter klyvning av nedanstående given sekvens med

Läs mer

Mapping sequence reads & Calling variants

Mapping sequence reads & Calling variants Universitair Medisch Centrum Utrecht Mapping sequence reads & Calling variants Laurent Francioli 2014-10-28 l.francioli@umcutrecht.nl Next Generation Sequencing Data processing pipeline Mapping to reference

Läs mer

KARL ANDERSSON & SÖNER

KARL ANDERSSON & SÖNER SHELL DESIGN NOTE 2015 Pallen Shell karakteriseras av de rena linjerna och spännande materialmöten som starkt förknippas med skandinavisk design. Shell har likt en stol, en tydlig riktning med en antydan

Läs mer

Det här med levels.?

Det här med levels.? Det här med levels.? Eller: När ska det vara praktik i Modulen? 1 Appendix I Basic knowledge requirements 1. KNOWLEDGE LEVELS CATEGORY A, B1, B2 AND C AIRCRAFT MAINTENANCE LICENCE Basic knowledge for categories

Läs mer

MAP Modified Atmosphere Packaging CA Controlled Atmosphere + .* +0 +* +1. MA Modified Atmosphere MA MA

MAP Modified Atmosphere Packaging CA Controlled Atmosphere + .* +0 +* +1. MA Modified Atmosphere MA MA 271 MA MA + + +, + : 20-., : /1+. - : --./ 33. 2 + a, MAP Modified Atmosphere Packaging CA Controlled Atmosphere + b + c.* +0 +* +1 +,//*,*** t +,.1-,*** t +, - MA Modified Atmosphere -*/ 20.,, + +, Email

Läs mer

ISO general purpose screw threads Basic profile Part 1: Metric screw threads

ISO general purpose screw threads Basic profile Part 1: Metric screw threads SVENSK STANDARD SS-ISO 68-1 Fastställd 2003-08-01 Utgåva 1 ISO-gängor för allmän användning Basprofil Del 1: Metriska ISO-gängor ISO general purpose screw threads Basic profile Part 1: Metric screw threads

Läs mer

Technique and expression 3: weave. 3.5 hp. Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2.

Technique and expression 3: weave. 3.5 hp. Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2. Technique and expression 3: weave 3.5 hp Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2 ExamCode: February 15 th 9-13 Means of assistance: Calculator, colorpencils,

Läs mer

BOENDEFORMENS BETYDELSE FÖR ASYLSÖKANDES INTEGRATION Lina Sandström

BOENDEFORMENS BETYDELSE FÖR ASYLSÖKANDES INTEGRATION Lina Sandström BOENDEFORMENS BETYDELSE FÖR ASYLSÖKANDES INTEGRATION Lina Sandström Frågeställningar Kan asylprocessen förstås som en integrationsprocess? Hur fungerar i sådana fall denna process? Skiljer sig asylprocessen

Läs mer

Schenker Privpak AB Telefon 033-178300 VAT Nr. SE556124398001 Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr 033-257475 Säte: Borås

Schenker Privpak AB Telefon 033-178300 VAT Nr. SE556124398001 Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr 033-257475 Säte: Borås Schenker Privpak AB Interface documentation for Parcel Search 2011-10-18 Version: 1 Doc. no.: I04306 Sida 2 av 5 Revision history Datum Version Sign. Kommentar 2011-10-18 1.0.0 PD First public version.

Läs mer

Collaborative Product Development:

Collaborative Product Development: Collaborative Product Development: a Purchasing Strategy for Small Industrialized House-building Companies Opponent: Erik Sandberg, LiU Institutionen för ekonomisk och industriell utveckling Vad är egentligen

Läs mer

Assigning Ethical Weights to Clinical Signs Observed During Toxicity Testing

Assigning Ethical Weights to Clinical Signs Observed During Toxicity Testing : Assigning Ethical Weights to Clinical Signs Observed During Toxicity Testing Supplementary Data Information (in Swedish) given to the test participants concerning the hypothetical experiment English

Läs mer

karl andersson & söner

karl andersson & söner pastillo Design Ulla Christiansson 2004 Pastillo består av stol, hög-, mellanhög- och låg pall. Den pillimariska, påhittiga, passande stolen finns med klädd sits och rygg. Pallarna finns med sitsar klädda

Läs mer

Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:

Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions: IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its

Läs mer

Col-0 SAIL Col-0 SAIL L Col-0 SAIL

Col-0 SAIL Col-0 SAIL L Col-0 SAIL A Met Met At5g470 00 bp Primer for genotyping T-DNA insertion position SAIL_57_G Coding sequence UTR B kb DNA ladder Primers: Col-0 SAIL kb DNA ladder Primers: - Col-0 SAIL.5.5 0.5 0.5 C kb Actin- Full

Läs mer

Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00. English Version

Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00. English Version Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling

Läs mer

Windlass Control Panel v1.0.1

Windlass Control Panel v1.0.1 SIDE-POWER Windlass Systems 86-08950 Windlass Control Panel v1.0.1 EN Installation manual Behåll denna manual ombord! S Installations manual SLEIPNER AB Kilegatan 1 452 33 Strömstad Sverige Tel: +46 525

Läs mer

Supplementary Information

Supplementary Information Supplementary Information dynamically regulates group I metabotropic glutamate receptors. Jia Hua Hu, Linlin Yang, Paul J. Kammermeier, Chester G. Moore, Paul R. Brakeman, Jiancheng Tu, Shouyang Yu, Ronald

Läs mer

Plain A262. För T16 (T5) lysrör. Innehåll. Monteringsanvisning. A. Instruktion för rampmontering

Plain A262. För T16 (T5) lysrör. Innehåll. Monteringsanvisning. A. Instruktion för rampmontering Plain A262 För T16 (T5) lysrör Innehåll Ramparmatur: ändmodul En stängd gavel/ en öppen gavel Plint i båda ändarna Överkopplingssladd 1 rampgavel 1 lysrörsbytare Ramparmatur: mellanmodul Plint i en ände

Läs mer

Kursplan. FÖ1038 Ledarskap och organisationsbeteende. 7,5 högskolepoäng, Grundnivå 1. Leadership and Organisational Behaviour

Kursplan. FÖ1038 Ledarskap och organisationsbeteende. 7,5 högskolepoäng, Grundnivå 1. Leadership and Organisational Behaviour Kursplan FÖ1038 Ledarskap och organisationsbeteende 7,5 högskolepoäng, Grundnivå 1 Leadership and Organisational Behaviour 7.5 Credits *), First Cycle Level 1 Mål Efter genomförd kurs skall studenterna

Läs mer

Exempel på uppgifter från 2010, 2011 och 2012 års ämnesprov i matematik för årskurs 3. Engelsk version

Exempel på uppgifter från 2010, 2011 och 2012 års ämnesprov i matematik för årskurs 3. Engelsk version Exempel på uppgifter från 2010, 2011 och 2012 års ämnesprov i matematik för årskurs 3 Engelsk version 2 Innehåll Inledning... 5 Written methods... 7 Mental arithmetic, multiplication and division... 9

Läs mer

Graphs (chapter 14) 1

Graphs (chapter 14) 1 Graphs (chapter ) Terminologi En graf är en datastruktur som består av en mängd noder (vertices) och en mängd bågar (edges) en båge är ett par (a, b) av två noder en båge kan vara cyklisk peka på sig själv

Läs mer

Syfte Eleverna får läsa enkla texter och visa sin förståelse genom att rita lösningen.

Syfte Eleverna får läsa enkla texter och visa sin förståelse genom att rita lösningen. Read and draw Syfte Eleverna får läsa enkla texter och visa sin förståelse genom att rita lösningen. Läraren reflekterar En enkel, rolig och självrättande uppgift som går att utveckla i det oändliga, t

Läs mer

DE TRE UTMANINGARNA..

DE TRE UTMANINGARNA.. DE TRE UTMANINGARNA.. SYSTEM MATERIAL PROCESSER PROTOTYP UTVECKLING SERIE UTVECKLINGSFASER NY LEVERANTÖR System Process AS9100 NadCap Geometri Legering In718/ Ti Rf/ Al Standard ISO9000 TID RESAN MOT MÅLET

Läs mer

Discovering!!!!! Swedish ÅÄÖ. EPISODE 6 Norrlänningar and numbers 12-24. Misi.se 2011 1

Discovering!!!!! Swedish ÅÄÖ. EPISODE 6 Norrlänningar and numbers 12-24. Misi.se 2011 1 Discovering!!!!! ÅÄÖ EPISODE 6 Norrlänningar and numbers 12-24 Misi.se 2011 1 Dialogue SJs X2000* från Stockholm är försenat. Beräknad ankoms?d är nu 16:00. Försenat! Igen? Vad är klockan? Jag vet inte.

Läs mer

for Selective Microtubule Polyglutamylation Juliette van Dijk, Krzysztof Rogowski, Julie Miro, Benjamin Lacroix, Bernard Eddé, and Carsten Janke

for Selective Microtubule Polyglutamylation Juliette van Dijk, Krzysztof Rogowski, Julie Miro, Benjamin Lacroix, Bernard Eddé, and Carsten Janke Molecular Cell, Volume 26 Supplemental Data A Targeted Multienzyme Mechanism for Selective Microtubule Polyglutamylation Juliette van Dijk, Krzysztof Rogowski, Julie Miro, Benjamin Lacroix, Bernard Eddé,

Läs mer

Kursplan. JP1040 Japanska III: Språkfärdighet. 15 högskolepoäng, Grundnivå 1. Japanese III: Language Proficiency

Kursplan. JP1040 Japanska III: Språkfärdighet. 15 högskolepoäng, Grundnivå 1. Japanese III: Language Proficiency Kursplan JP1040 Japanska III: Språkfärdighet 15 högskolepoäng, Grundnivå 1 Japanese III: Language Proficiency 15 Higher Education Credits *), First Cycle Level 1 Mål Efter avslutad kurs ska de studerande

Läs mer

1. Varje bevissteg ska motiveras formellt (informella bevis ger 0 poang)

1. Varje bevissteg ska motiveras formellt (informella bevis ger 0 poang) Tentamen i Programmeringsteori Institutionen for datorteknik Uppsala universitet 1996{08{14 Larare: Parosh A. A., M. Kindahl Plats: Polacksbacken Skrivtid: 9 15 Hjalpmedel: Inga Anvisningar: 1. Varje bevissteg

Läs mer

Accomodations at Anfasteröd Gårdsvik, Ljungskile

Accomodations at Anfasteröd Gårdsvik, Ljungskile Accomodations at Anfasteröd Gårdsvik, Ljungskile Anfasteröd Gårdsvik is a campsite and resort, located right by the sea and at the edge of the forest, south west of Ljungskile. We offer many sorts of accommodations

Läs mer

Supplementary Data. Figure S1: EIMS spectrum for (E)-1-(3-(3,7-dimethylocta-2,6-dienyl)-2,4,6-trihydroxyphenyl)butan-1-one (3d) 6'' 7'' 3' 2' 1' 6

Supplementary Data. Figure S1: EIMS spectrum for (E)-1-(3-(3,7-dimethylocta-2,6-dienyl)-2,4,6-trihydroxyphenyl)butan-1-one (3d) 6'' 7'' 3' 2' 1' 6 Supplementary Data H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S1: EIMS spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)-,,-trihydroxyphenyl)butan-1-one (d) H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S:

Läs mer

Besvärliga fjällarter. Difficult mountain species

Besvärliga fjällarter. Difficult mountain species Besvärliga fjällarter Difficult mountain species Lycopodium annotinum ssp alpestre nordlummer. Insnörpta års skott. The shoots are constricted between the yearly shoots Lycopodium annotinum ssp alpestre

Läs mer

CM FORUM. Introduktion till. Configuration Management (CM) / Konfigurationsledning. Tobias Ljungkvist

CM FORUM. Introduktion till. Configuration Management (CM) / Konfigurationsledning. Tobias Ljungkvist Introduktion till Configuration Management (CM) / Konfigurationsledning Tobias Ljungkvist 2017-08-30 1 CM enligt SS-EN ISO 10007_2004 Konfigurationsledning är en ledningsaktivitet som tillämpar teknisk

Läs mer

Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae

Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae S1 of S10 Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae Chenjing Shang, Pierre Rougé and Els J.M. Van Damme Type 1 RIPs 1. Malus domestica (MDP0000918923) MALSFSIKNATTTTYRTFIEALRAQLTAGGSTSHGIPVLRRRQDVKDDQRFVLVNLTNYDSYTITVA

Läs mer

NMR Nuclear Magnetic Resonance = Kärnmagnetisk resonans

NMR Nuclear Magnetic Resonance = Kärnmagnetisk resonans NMR Nuclear Magnetic Resonance = Kärnmagnetisk resonans Nuclear Magnetic Resonance Viktiga kärnor: 1 and 13 NMR används för strukturanalys av organiska föreningar Väteatomer med olika omgivning tar upp

Läs mer

Focus on English 9. Teacher s Guide with Projects

Focus on English 9. Teacher s Guide with Projects Focus on English 9 Teacher s Guide with Projects Focus on English är ett nyskrivet läromedel för åk 7 9. Goda engelskkunskaper är ett av elevernas viktigaste redskap för det livslånga lärandet. I boken

Läs mer

Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:

Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions: Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively

Läs mer

karl andersson & söner

karl andersson & söner mill Design Roger Persson 2012 Mill betyder fräsa på engelska. Mill är ett bord med massiv skiva och ben, där bordsskivans yta är nedfräst till sin karaktäristiska form. Mill finns som rund, kvadratisk

Läs mer

Reservdelskatalog Parts Catalogue COMBI 40 AE /S15 - Season 2017

Reservdelskatalog Parts Catalogue COMBI 40 AE /S15 - Season 2017 2306/S1 - Season 201 Use GLOBAL GARDEN PRODUCT Genuine Spare Parts specified in the parts list for repair and/or replacement. The contents described in the parts list may change due to improvement. The

Läs mer

Day 1: European Cooperation Day 2017

Day 1: European Cooperation Day 2017 Draft agenda for the Annual Event 2017 and European Cooperation Day 2017 Mariehamn, Åland 20-21.9.2017 Day 1: European Cooperation Day 2017 Open for the general public and projects Programme at Alandica

Läs mer

Barley yellow dwarf virus and forecasting BYDV using suction traps

Barley yellow dwarf virus and forecasting BYDV using suction traps Barley yellow dwarf virus and forecasting BYDV using suction traps Associate Professor Roland Sigvald Swedish University of Agricultural Sciences Department of Ecology, Uppsala Workshop at SLU, Alnarp

Läs mer

Kursplan. MT1051 3D CAD Grundläggande. 7,5 högskolepoäng, Grundnivå 1. 3D-CAD Basic Course

Kursplan. MT1051 3D CAD Grundläggande. 7,5 högskolepoäng, Grundnivå 1. 3D-CAD Basic Course Kursplan MT1051 3D CAD Grundläggande 7,5 högskolepoäng, Grundnivå 1 3D-CAD Basic Course 7.5 Higher Education Credits *), First Cycle Level 1 Mål Studenten ska efter avslutad kurs ha inhämtat grunderna

Läs mer

FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP

FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation

Läs mer

Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas

Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private

Läs mer

Observationshotellet. The observation hotel. Fanny Vallo !!! Ersätt bilden med en egen bild. Emma Karlsson Martin Hedenström Ljung.

Observationshotellet. The observation hotel. Fanny Vallo !!! Ersätt bilden med en egen bild. Emma Karlsson Martin Hedenström Ljung. Observationshotellet The observation hotel Fanny Vallo Handledare/ Supervisor B Bojan Boric Emma Karlsson Martin Hedenström Ljung Examinator/ Examiner Erik Wingquist Examensarbete inom arkitektur, grundnivå

Läs mer

Every visitor coming to the this website can subscribe for the newsletter by entering respective address and desired city.

Every visitor coming to the this website can subscribe for the newsletter by entering respective  address and desired city. Every visitor coming to the this website can subscribe for the newsletter by entering respective e-mail address and desired city. Latest deals are displayed at the home page, wheras uper right corner you

Läs mer

Läkemedelsverkets Farmakovigilansdag

Läkemedelsverkets Farmakovigilansdag Swedish Medical Products Agency s Patient- and Consumer Advisory Board Brita Sjöström May 29, 2018 Patientrådet@mpa.se https://lakemedelsverket.se/patient-konsument-rad The vision of the Swedish Medical

Läs mer

ISO general purpose metric screw threads Selected sizes for screws, bolts and nuts

ISO general purpose metric screw threads Selected sizes for screws, bolts and nuts SVENSK STANDARD SS-ISO 262 Fastställd 2003-08-01 Utgåva 1 Metriska ISO-gängor för allmän användning Utvalda storlekar för skruvar och muttrar ISO general purpose metric screw threads Selected sizes for

Läs mer

Questionnaire for visa applicants Appendix A

Questionnaire for visa applicants Appendix A Questionnaire for visa applicants Appendix A Business Conference visit 1 Personal particulars Surname Date of birth (yr, mth, day) Given names (in full) 2 Your stay in Sweden A. Who took the initiative

Läs mer

8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.

8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers. MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:

Läs mer

Exempel på uppgifter från års ämnesprov i matematik för årskurs 3. Engelsk version

Exempel på uppgifter från års ämnesprov i matematik för årskurs 3. Engelsk version Exempel på uppgifter från 2010 2013 års ämnesprov i matematik för årskurs 3 Engelsk version Exempeluppgifter i årskurs 3, 2010, 2011 och 2012 1 Äp3Ma13 Part B 2 Innehåll Inledning... Fel! Bokmärket är

Läs mer

Kursplan. EN1088 Engelsk språkdidaktik. 7,5 högskolepoäng, Grundnivå 1. English Language Learning and Teaching

Kursplan. EN1088 Engelsk språkdidaktik. 7,5 högskolepoäng, Grundnivå 1. English Language Learning and Teaching Kursplan EN1088 Engelsk språkdidaktik 7,5 högskolepoäng, Grundnivå 1 English Language Learning and Teaching 7.5 Higher Education Credits *), First Cycle Level 1 Mål Efter genomgången kurs ska studenten

Läs mer

Displaysystem. Hans Brandtberg Saab Avitronics SAAB AVITRONICS 03-10-06

Displaysystem. Hans Brandtberg Saab Avitronics SAAB AVITRONICS 03-10-06 Displaysystem Hans Brandtberg Saab Avitronics Applikation Drivrutiner (OpenGL) Displaysystem Människa-maskin egenskaper -Kunna förstå och arbeta med information -Kunne se och uppfatta det som visas

Läs mer

Supporting Information. Mechanism and Stereochemistry of Polyketide Chain Elongation and Methyl Group Epimerization in Polyether Biosynthesis

Supporting Information. Mechanism and Stereochemistry of Polyketide Chain Elongation and Methyl Group Epimerization in Polyether Biosynthesis Supporting Information Mechanism and Stereochemistry of Polyketide Chain Elongation and Methyl Group Epimerization in Polyether Biosynthesis Xinqiang Xie, Ashish Garg, Chaitan Khosla, and David E. Cane*,

Läs mer

Par m 328 feet. Lång höger sväng. Korgen står placerad i en skogsglänta OB-linje på vänster sida.

Par m 328 feet. Lång höger sväng. Korgen står placerad i en skogsglänta OB-linje på vänster sida. 1 100 m 328 feet Lång höger sväng. Korgen står placerad i en skogsglänta -linje på vänster sida. Long right turn. Basket are placed in a forrest glade. -line on the left side. Snälla, skräpa ej ner vår

Läs mer

Arbets- och miljömedicin Lund. Arbetsställningar för huvud, nacke och armar hos byggnadselektriker. Rapport nr 10/2013

Arbets- och miljömedicin Lund. Arbetsställningar för huvud, nacke och armar hos byggnadselektriker. Rapport nr 10/2013 Arbets- och miljömedicin Lund Rapport nr 10/2013 Arbetsställningar för huvud, nacke och armar hos byggnadselektriker Gert-Åke Hansson Docent, yrkeshygieniker Arbets- och miljömedicin 2013-03-28 Arbetsställningar

Läs mer

Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5. Skriv svaren på varje fråga på SEPARATA blad.

Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5. Skriv svaren på varje fråga på SEPARATA blad. Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5 Skriv svaren på varje fråga på SEPARATA blad. Skriv namn på VARJE blad. Du kan svara på engelska eller svenska. Motivera eller förklara

Läs mer

Table S1: Oligonucleotides and PCR primers used in this study.

Table S1: Oligonucleotides and PCR primers used in this study. Table S1: Oligonucleotides and PCR primers used in this study. Name 5-3 Sequence Description or Use Reference Strep B ACAAGCCCTGGAAACGGGGT 16S rdna PCR, [23] Strep F ACGTGTGCAGCCCAAGACA 16S rdna PCR, [23]

Läs mer

LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik

LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, EITA50, LP4, 209 Inlämningsuppgift av 2, Assignment out of 2 Inlämningstid: Lämnas in senast kl

Läs mer

Grafisk teknik. Sasan Gooran (HT 2006)

Grafisk teknik. Sasan Gooran (HT 2006) Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively

Läs mer

Gradientbaserad Optimering,

Gradientbaserad Optimering, Gradientbaserad Optimering, Produktfamiljer och Trinitas Hur att sätta upp ett optimeringsproblem? Vad är lämpliga designvariabler x? Tjockleksvariabler (sizing) Tvärsnittsarean hos stänger Längdmått hos

Läs mer

Measuring child participation in immunization registries: two national surveys, 2001

Measuring child participation in immunization registries: two national surveys, 2001 Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of

Läs mer

Övning 5 ETS052 Datorkommuniktion Routing och Networking

Övning 5 ETS052 Datorkommuniktion Routing och Networking Övning 5 TS5 Datorkommuniktion - 4 Routing och Networking October 7, 4 Uppgift. Rita hur ett paket som skickas ut i nätet nedan från nod, med flooding, sprider sig genom nätet om hop count = 3. Solution.

Läs mer

Matthew Thurley Industriell bildanalys (E0005E) Response rate = 65 %

Matthew Thurley Industriell bildanalys (E0005E) Response rate = 65 % Matthew Thurley Industriell bildanalys (E000E) Response rate = % Survey Results Legend Relative Frequencies of answers Std. Dev. Mean Question text Left pole % % Right pole n=no. of responses av.=mean

Läs mer

Utvärdering av IVIG behandling vid post-polio syndrom. Kristian Borg

Utvärdering av IVIG behandling vid post-polio syndrom. Kristian Borg Utvärdering av IVIG behandling vid post-polio syndrom Kristian Borg Div of Rehabilitation Medicine, Karolinska Institutet and Danderyd University Hospital Stockholm Sweden Pågående denervation som kompenseras

Läs mer

F ξ (x) = f(y, x)dydx = 1. We say that a random variable ξ has a distribution F (x), if. F (x) =

F ξ (x) = f(y, x)dydx = 1. We say that a random variable ξ has a distribution F (x), if. F (x) = Problems for the Basic Course in Probability (Fall 00) Discrete Probability. Die A has 4 red and white faces, whereas die B has red and 4 white faces. A fair coin is flipped once. If it lands on heads,

Läs mer

Documentation SN 3102

Documentation SN 3102 This document has been created by AHDS History and is based on information supplied by the depositor /////////////////////////////////////////////////////////// THE EUROPEAN STATE FINANCE DATABASE (Director:

Läs mer

Småprat Small talk (stressed vowels are underlined)

Småprat Small talk (stressed vowels are underlined) Småprat Small talk (stressed vowels are underlined) Vad heter du? Varifrån kommer du? Vad har du för modersmål (1 st language)? Vad studerar du? Var bor du? Hur gammal är du? Cyklar du till universitetet?

Läs mer

Figure S1. The molecular weight of proteins encoded by genes in each sub-region of Chr.20

Figure S1. The molecular weight of proteins encoded by genes in each sub-region of Chr.20 Supplementary Figure legends Figure S1. The molecular weight of proteins encoded by genes in each sub-region of Chr.20 Figure S2. The hydrophobicity of proteins encoded by genes in each sub-region of Chr.20

Läs mer

Nya driftförutsättningar för Svensk kärnkraft. Kjell Ringdahl EON Kärnkraft Sverige AB

Nya driftförutsättningar för Svensk kärnkraft. Kjell Ringdahl EON Kärnkraft Sverige AB Nya driftförutsättningar för Svensk kärnkraft Kjell Ringdahl EON Kärnkraft Sverige AB Innehåll 1.Förändringar i det Svenska energisystemet 2.Nuvarande förutsättningar 3.Internationella studier/erfarenheter

Läs mer

EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09

EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09 EXTENAL ASSESSENT SAPLE TASKS SWEDISH BEAKTHOUGH LSPSWEB/0Y09 Asset Languages External Assessment Sample Tasks Breakthrough Stage Listening and eading Swedish Contents Page Introduction 2 Listening Sample

Läs mer

Bankernas kontonummer Bank Account Numbers in Swedish Banks

Bankernas kontonummer Bank Account Numbers in Swedish Banks 2011-10-07 Bankernas kontonummer Bank Account Numbers in Swedish Banks Bankernas kontonummer Bank Account Numbers in Swedish Banks Bankkontonummer i svenska banker består av ett clearingnummer (fyra siffror)

Läs mer

BÄNKVÅG / BENCH SCALE ANVÄNDARMANUAL / USER MANUAL SW-III www.liden-weighing.com Svenska OBS! Under vågen sitter en justerbar skruv (se bild). Standardinställning är den för vägning. Om ni vill rengöra

Läs mer

Förordning 376/2014. Händelserapportering Ulrika Svensson, flyginspektör

Förordning 376/2014. Händelserapportering Ulrika Svensson, flyginspektör Förordning 376/2014 Händelserapportering Ulrika Svensson, flyginspektör Reglering Förordning 376/2014 samt Genomförandeförordning 2015/1018 Utgivna av EU (ej EASA) Reglerar EASA, nationella myndigheter,

Läs mer

Thesis Production Time plan, preparation and Word templates

Thesis Production Time plan, preparation and Word templates Thesis Production Time plan, preparation and Word templates Service from the University Library Speaker: Jesper Andersson 1. Set a Date 12 weeks 2. Let Us Know Public Defence 6 7 Week Time Plan 1 Carolina

Läs mer

Sannolikhetsteori. Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik,

Sannolikhetsteori. Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik, Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik, 5p. Tid: Lördag den 29 mars, 2008 kl 14.00-18.00 i V-huset. Examinator: Olle Nerman, tel 7723565. Jour: Alexandra Jauhiainen,

Läs mer

**************************************************************

************************************************************** Umeå universitet EMG Barbara Giles Kod nummer: Resultat Del 1 Del 2 Del 3 Del 4 Betyg alla delar 4 Tentamensformalia Kursens namn: 5BI110 Genetik och evolution 15 hp, moment genetik HT10 Datum: 2010-11-25

Läs mer

Översättning av galleriet. Hjälp till den som vill...

Översättning av galleriet. Hjälp till den som vill... Hjälp till den som vill... $txt['aeva_title'] = 'Galleri'; $txt['aeva_admin'] = 'Admin'; $txt['aeva_add_title'] = 'Titel'; $txt['aeva_add_desc'] = 'Beskrivning'; $txt['aeva_add_file'] = 'Fil att ladda

Läs mer

Risk Management Riskhantering i flygföretag

Risk Management Riskhantering i flygföretag Risk Management Riskhantering i flygföretag Nytt krav inom ledningssystemet ORO.GEN.200(a)(3) med vidhängande AMC1 ORO.GEN.200(a)(1);(2);(3);(5) Magnus Molitor Transportstyrelsen 1 Riskhantering i sitt

Läs mer

Webbregistrering pa kurs och termin

Webbregistrering pa kurs och termin Webbregistrering pa kurs och termin 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en länk till Studieöversiktssidan. På den sidan

Läs mer