Supplementary Data. Figure S1: EIMS spectrum for (E)-1-(3-(3,7-dimethylocta-2,6-dienyl)-2,4,6-trihydroxyphenyl)butan-1-one (3d) 6'' 7'' 3' 2' 1' 6
|
|
|
- Monica Lundqvist
- för 5 år sedan
- Visningar:
Transkript
1 Supplementary Data H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S1: EIMS spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)-,,-trihydroxyphenyl)butan-1-one (d)
2 H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S: 1 H NMR spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)-,,-trihydroxyphenyl)butan-1-one (d)
3 H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S: 1 C NMR spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)-,,-trihydroxyphenyl)butan-1-one (d)
4 H 1' 1 ' ' H H Figure S: EIMS spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)ethanone (a)
5 H 1' 1 ' ' H H Figure S: 1 H NMR spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)ethanone (a)
6 H 1' 1 ' ' H H Figure S: 1 C NMR spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)ethanone (a)
7 H 1' 1 ' ' ' H H Figure S7: EIMS spectrum for -methyl-1-(,,-trihydroxy--(-methylbut--enyl)phenyl)propan-1-one (b)
8 H 1' 1 ' ' ' H H Figure S8: 1 H NMR spectrum for -methyl-1-(,,-trihydroxy--(-methylbut--enyl)phenyl)propan-1-one (b)
9 H 1' 1 ' ' ' H H Figure S9: 1 C NMR spectrum for -methyl-1-(,,-trihydroxy--(-methylbut--enyl)phenyl)propan-1-one (b)
10 H 1' 1 ' ' H H Figure S10: EIMS spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)propan-1-one (c)
11 H 1' 1 ' ' H H Figure S11: 1 H NMR spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)propan-1-one (c)
12 H 1' 1 ' ' H H Figure S1: 1 C NMR spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)propan-1-one (c)
13 H ' 1' 1 ' ' H H Figure S1: EIMS spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)butan-1-one (d)
14 H ' 1' 1 ' ' H H Figure S1: 1 H NMR spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)butan -1-one (d)
15 H ' 1' 1 ' ' H H Figure S1: 1 C NMR spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)butan -1-one (d)
16 H ' ' 1' 1 ' ' H H Figure S1: EIMS spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)pentan-1-one (e)
17 H ' ' 1' 1 ' ' H H Figure S17: 1 H NMR spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)pentan-1-one (e)
18 H ' ' 1' 1 ' ' H H Figure S18: 1 C NMR spectrum for 1-(,,-trihydroxy--(-methylbut--enyl)phenyl)pentan-1-one (e)
19 H ' 1' 1 ' ' ' ' 7' H H Figure S19: EIMS spectrum for Cyclohexyl-(,,-trihydroxy--(-methylbut--enyl)phenyl)methanone (f)
20 H ' 1' 1 ' ' ' ' 7' H H Figure S0: 1 H NMR spectrum for Cyclohexyl-(,,-trihydroxy--(-methylbut--enyl)phenyl)methanone (f)
21 H ' 1' 1 ' ' ' ' 7' H H Figure S1: 1 C NMR spectrum for Cyclohexyl-(,,-trihydroxy--(-methylbut--enyl)phenyl)methanone (f)
22 H ' ' ' 1' 1 ' ' 7' 8' 9' H H Figure S: EIMS spectrum for (E)--phenyl-1-(,,-trihydroxy--(-methylbut--enyl)phenyl)prop--en-1-one (g)
23 H ' ' ' 1' 1 ' ' 7' 8' 9' H H Figure S: 1 H NMR spectrum for (E)--phenyl-1-(,,-trihydroxy--(-methylbut--enyl)phenyl)prop--en-1-one (g)
24 H ' ' ' 1' 1 ' ' 7' 8' 9' H H Figure S: 1 C NMR spectrum for (E)--phenyl-1-(,,-trihydroxy--(-methylbut--enyl)phenyl)prop--en-1-one (g)
25 H 9'' 1' 1 ' '' 8'' ' 7'' 10'' HC '' CH ' Figure S8: EIMS spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)--hydroxy-,-dimethoxyphenyl)ethanone (a)
26 H 9'' 1' 1 ' '' 8'' ' 7'' 10'' HC '' CH ' Figure S9: 1 H NMR spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)--hydroxy-,-dimethoxyphenyl)ethanone (a)
27 H 9'' 1' 1 ' '' 8'' ' 7'' 10'' HC '' CH ' Figure S0: 1 C NMR spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)--hydroxy-,-dimethoxyphenyl)ethanone (a)
28 H 9'' ' 1' 1 ' '' 8'' ' ' 7'' 10'' HC '' CH ' Figure S: EIMS spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)--hydroxy-,-dimethoxyphenyl)pentan-1-one (e)
29 H 9'' ' 1' 1 ' '' 8'' ' ' 7'' 10'' HC '' CH ' Figure S: 1 H NMR spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)--hydroxy-,-dimethoxyphenyl)pentan-1-one (e)
30 H 9'' ' 1' 1 ' '' 8'' ' ' 7'' 10'' HC '' CH ' Figure S7: 1 C NMR spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)--hydroxy-,-dimethoxyphenyl)pentan-1-one (e)
31 H 1' 1 ' ' HC '' CH ' Figure S: EIMS spectrum for 1-(-hydroxy-,-dimethoxy--(-methylbut--enyl)phenyl)ethanone (a)
32 H 1' 1 ' ' HC '' CH ' Figure S: 1 H NMR spectrum for 1-(-hydroxy-,-dimethoxy--(-methylbut--enyl)phenyl)ethanone (a)
33 H 1' 1 ' ' HC '' CH ' Figure S: 1 C NMR spectrum for 1-(-hydroxy-,-dimethoxy--(-methylbut--enyl)phenyl)ethanone (a)
34 H ' 1' 1 ' ' ' HC '' CH ' Figure S1: EIMS spectrum for 1-(-hydroxy-,-dimethoxy--(-methylbut--enyl)phenyl)pentan-1-one (e)
35 H ' 1' 1 ' ' ' HC '' CH ' Figure S: 1 H NMR spectrum for 1-(-hydroxy-,-dimethoxy--(-methylbut--enyl)phenyl)pentan-1-one (e)
36 H ' 1' 1 ' ' ' HC '' CH ' Figure S: 1 C NMR spectrum for 1-(-hydroxy-,-dimethoxy--(-methylbut--enyl)phenyl)pentan-1-one (e)
37 LX-1 1 MFSAGHKIKGTVVLMPKNELEVNPDGS-AVDNLNAFLGRSVSLQLISATKADAHG 1IK ----GHKIKGTVVLMRKNVLDVNSVTSVTLDTLTAFLGRSVSLQLISATKADANG LX-1 KGKVGKDTFLEGINTSLPTLGAGESAFNIHFEW-DGSMGIPGAFYIKNYMQVEFF 108 1IK KGKLGKATFLEGIITSLPTLGAGQSAFKINFEWDDGS-GIPGAFYIKNFMQTEFF 10 LX LKSLTLEAISNQGTIRFVCNSWVYNTKLYKSVRIFFANHTYVPSETPAPLVSYRE 1 1IK 10 LVSLTLEDIPNHGSIHFVCNSWIYNAKLFKSDRIFFANQTYLPSETPAPLVKYRE 10 LX-1 1 EELKSLRGNGTGERKEYDRIYDYDVYNDLGNPDKSEKLARPVLGGSSTFPYPRRG 18 1IK 11 EELHNLRGDGTGERKEWERIYDYDVYNDLGDPDKGENHARPVLGGNDTFPYPRRG 1 LX-1 19 RTGRGPTVTDPNTE-KQGEVFYVPRDENLGHLKSKDALEIGTKSLSQIVQPAFES 7 1IK 1 RTGRKPTRKDPNSESRSNDV-YLPRDEAFGHLKSSDFLTYGLKSVSQNVLPLLQS 9 LX-1 7 AFDLKSTPIEFHSFQDVHDLYEGGIKLPRDVISTIIPLPVIKELYRTDGQHILKF 7 1IK 70 AFDLNFTPREFDSFDEVHGLYSGGIKLPTDIISKISPLPVLKEIFRTDGEQALKF LX-1 8 PQPHVVQVSQSAWMTDEEFAREMIAGVNPCVIRGLEEFPPKSNLDPAIYGDQSSK 8 1IK 80 PPPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLKDFPPRSKLDSQVYGDHTSQ 79 LX-1 8 ITADSLD--LDGYTMDEALGSRRLFMLDYHDIFMPYVRQINQLNSAKTYATRTIL 1IK 80 ITKEHLEPNLEGLTVDEAIQNKRLFLLDHHDPIMPYLRRIN-ATSTKAYATRTIL LX-1 FLREDGTLKPVAIELSLPHSAGDLSAAVSQVVLPAKEGVESTIWLLAKAYVIVND 90 1IK FLKNDGTLRPLAIELSLPHPQGDQSGAFSQVFLPADEGVESSIWLLAKAYVVVND 88 LX-1 91 SCYHQLMSHWLNTHAAMEPFVIATHRHLSVLHPIYKLLTPHYRNNMNINALARQS 1IK 89 SCYHQLVSHWLNTHAVVEPFIIATNRHLSVVHPIYKLLHPHYRDTMNINGLARLS * * LX-1 LINANGIIETTFLPSKYSVEMSSAVYKNWVFTDQALPADLIKRGVAIKDPSTPHG 00 1IK LVNDGGVIEQTFLWGRYSVEMSAVVYKDWVFTDQALPADLIKRGMAIEDPSCPHG 98 LX-1 01 VRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKNDSELQHWWKEAVEK 1IK 99 IRLVIEDYPYTVDGLEIWDAIKTWVHEYVFLYYKSDDTLREDPELQACWKELVEV LX-1 GHGDLKDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYGGLIMNRPTA 710 1IK GHGDKKNEPWWPKMQTREELVEACAIIIWTASALHAAVNFGQYPYGGLILNRPTL 708 * * LX SRRLLPEKGTPEYEEMINNHEKAYLRTITSKLPTLISLSVIEILSTHASDEVYLG 7 1IK 709 SRRFMPEKGSAEYEELRKNPQKAYLKTITPKFQTLIDLSVIEILSRHASDEVYLG 7 LX-1 7 QRDNPHWTSDSKALQAFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQLPYTLL 80 1IK 7 ERDNPNWTSDTRALEAFKRFGNKLAQIENKLSERNNDEKLR-NRCGPVQMPYTLL 817 LX-1 81 YPSSEEGLTFRGIPNSISI 89 1IK 818 LPSSKEGLTFRGIPNSIS- 8 Figure S7: Alignment of soybean LX- (1IK) and soybean LX-1 sequences showing 7.1 % identities. Essential sites for iron binding are denoted by asterisk (*) and amino acids at the binding site are shown in red colour.
![[A, B,L] most favoured region; [a,b,l,p] additional allowed regions; [~a,~b,~l,~p]](/docs-images/94/119160586/images/38-1.jpg "generously allowed regions; milky coloured areas are disallowed regions.")
38 Figure S8: Ramachandran Plot of LX-1 model produced by PRCHECK after homology modeling. [A, B,L] most favoured region; [a,b,l,p] additional allowed regions; [~a,~b,~l,~p] generously allowed regions; milky coloured areas are disallowed regions. Figure S9: Total RMSD evolution along the simulation time of a protein-ligand complex of compound e.
39 Figure S0: Total RMSD evolution along the simulation time of a protein-ligand complex of compound e
40 Figure S1: Total RMSD evolution along the simulation time of a protein-ligand complex of thga (a).
41 ns ns 7 ns 8 ns 9 ns 10 ns Figure S: The D representation of the MD simulation result of compound e (snapshots taken during -10ns)
42 ns ns 7 ns 8 ns 9 ns 10 ns Figure S: The D representation of the MD simulation result of compound e (snapshots taken during -10ns)
43 ns ns 7 ns 8 ns 9 ns 10 ns Figure S: The D representation of the MD simulation result of compound e (snapshots taken during -10ns)
44 ns ns 7 ns 8 ns 9 ns 10 ns Figure S: The D representation of the MD simulation result of compound e (snapshots taken during -10ns)
45 ns ns 7 ns 8 ns 9 ns 10 ns Figure S: The D representation of the MD simulation result of thga (a) (snapshots taken during -10ns)
46 ns ns 7 ns 8 ns 9 ns 10 ns Figure S7: The D representation of the MD simulation result of thga (a) (snapshots taken during -10ns)
47 Table 1 Residue-based decomposition of the interaction energies (kcal/mol) for molecular mechanic ( E MM ), polar solvation ( G PB ), non-polar solvation ( G SA ) and free binding energy ( G bind ) between the most active compound e and the residues in the binding pocket of soybean LX-1 model. Residue Number E MM G PB G SA G bind Ser91 -. (0.1). (0.17) -0.1 (0.0) -1. (0.1) His9 -.7 (0.19).78 (0.) -0.1 (0.0) -0.9 (0.) Gln9-1.8 (0.) 1.89 (0.9) (0.0) -0.9 (0.8) His (0.1) 8.08 (0.) -0. (0.0).9 (0.9) Trp (0.11) 0.8 (0.0) -0.1 (0.01) -. (0.11) His (0.09) 1.79 (0.10) (0.01) 0.00 (0.1) Ile8-0.9 (0.0) -0.7 (0.0) -0.0 (0.01) -1.0 (0.0) Leu1-0. (0.01) -0.0 (0.01) 0.00 (0.00) -0.1 (0.0) Leu -.9 (0.1) 1.1 (0.08) -0.9 (0.0) -.0 (0.1) Ile7 -.9 (0.1) 1.01 (0.08) -0. (0.0) -.7 (0.1) Ile -.0 (0.07) 0.7 (0.0) -0.1 (0.01) -1.9 (0.09) Phe (0.17) 1.9 (0.07) (0.0) -7.1 (0.18) Gln (0.) 1.7 (0.) -1.0 (0.0) 1.7 (0.1) Tyr (0.07) 1. (0.11) -0.0 (0.01) -0.8 (0.07) Arg (0.08) 9.91 (0.8) -0.9 (0.01) (0.7) Ser77 -. (0.19).1 (0.1) -0.7 (0.0) 0.0 (0.19) Ile (0.1) 0. (0.07) -0. (0.0) -.1 (0.1) Leu7 -.8 (0.11) 0.9 (0.0) -0.7 (0.0) -.8 (0.1) Ile89 0. (0.01) -1. (0.0) 0.00 (0.00) (0.0)
48 Table Residue-based decomposition of the interaction energies (kcal/mol) for molecular mechanic ( E MM ), polar solvation ( G PB ), non-polar solvation ( G SA ) and free binding energy ( G bind ) between compound e and the residues in the binding pocket of soybean LX-1 model. Residue Number E MM G PB G SA G bind Glu9-9.0 (0.1) 0.18 (0.) (0.0) 9. (0.0) His (0.11) 10.9 (0.7) -0. (0.01). (0.) Trp (0.08) 1. (0.08) -0.0 (0.01) (0.07) His (0.0).0 (0.1) -0.0 (0.0) 1.70 (0.10) Ile (0.0) -0. (0.0) -0.1 (0.01) -.09 (0.07) Ala (0.07) -0.0 (0.0) -0.1 (0.0) -.11 (0.09) Leu -7. (0.1).0 (0.10) -0.7 (0.0) -.1 (0.17) Ile7 -. (0.1) 0.80 (0.0) -0. (0.0) -.18 (0.11) Ile -. (0.11) 0.0 (0.0) -0. (0.01) -.9 (0.11) Phe7 -. (0.1).89 (0.08) -0. (0.0) -.0 (0.1) Gln (0.1) 9.00 (0.7) -0. (0.0).1 (0.) Ile (0.01) 0.01 (0.01) 0.00 (0.00) -0.1 (0.01) Arg (0.08).9 (0.7) -0.0 (0.0). (0.) Ser (0.1). (0.0) -0.0 (0.0) (0.1) Leu (0.0) -0.0 (0.0) (0.00) -0.7 (0.0)
49 Table Residue-based decomposition of the interaction energies (kcal/mol) for molecular Mechanic ( E MM ), polar solvation ( G PB ), non-polar solvation ( G SA ) and free binding energy ( G bind ) between thga (a) and the residues in the binding pocket of soybean LX-1 model. Residue Number E MM G PB G SA G bind Glu -1.8 (0.1) -.90 (0.1) -0.1 (0.01) -.90 (0.1) Thr9 -.9 (0.19) 7.7 (0.11) -0.1 (0.01) 0.1 (0.1) His (0.10) 7.8 (0.1) -0.8 (0.01) -.9 (0.18) Trp (0.10) 0.9 (0.0) -0.0 (0.01) -. (0.11) His0 -.7 (0.1).8 (0.1) -0.0 (0.01) (0.1) Ile (0.19) -0. (0.07) -0. (0.01) -. (0.19) Ala -1.7 (0.1) 0.8 (0.09) -0. (0.01) (0.1) Leu -8.1 (0.17) 1. (0.0) (0.0) -7. (0.1) Ile7 -. (0.08) 1. (0.0) -0. (0.01) -1.1 (0.09) Ile -.99 (0.09) 0. (0.0) -0.0 (0.01) -.0 (0.09) Phe7 -.0 (0.07) 0.0 (0.0) -0.1 (0.01) -1.7 (0.07) Val (0.0) (0.0) (0.01) -.1 (0.07) Ile (0.0) -0.8 (0.0) -0. (0.01) -. (0.08) Leu7-8.8 (0.17) 0.90 (0.07) -1. (0.0) (0.1)
Biochemistry 201 Advanced Molecular Biology (
Biochemistry 201 Advanced Molecular Biology (http://cmgm cmgm.stanford.edu/biochem201/) Bioinformatics: Discovering Function from Sequence Doug Brutlag Departments of Biochemistry June 4, 1999 Discovering
A G M K. Supplemental Figure S1.
G A G M K F I D I G G G L G Supplementl Figure S1. CADC1 MPALGCCVDATVSPPLGYAFSSDSSLPTPEFFSSGVPPMTNAAAGHSHWSPDLSSALYRVD 61 Tocco ADC MPALGCCVDAAVVSPPLSYAFSRDSSLPAPEFFASGVPPTNSAAASHWSPDLSSALYGVD 6 Aridopsis
Elektron-absorbtionspektroskopi för biomolekyler i UV-VIS-området
Elektron-absorbtionspektroskopi för biomolekyler i UV-VIS-området Principer Koncentrationsmätning Detektion Kromoforer, kolorimetriska assays DNA Komparativ analys Proteinrening Jonbindning Peptidgruppens
Elektron-absorbtionspektroskopi för biomolekyler i UV-VIS-området
Elektron-absorbtionspektroskopi för biomolekyler i UV-VIS-området Principer Koncentrationsmätning Detektion Kromoforer, kolorimetriska assays DNA Komparativ analys Jonbindning Spektroskopisk analys av
Protein en livsviktig byggsten
Protein en livsviktig byggsten Ingvar Bosaeus Enheten för klinisk nutrition Sahlgrenska universitetssjukhuset Göteborg KSLA 2015-02-19 Aminosyra Alpha Amino- grupp Fredrik Bertz Karboxyl- grupp 20 aa
SUPPORTING INFORMATION
SUPPORTING INFORMATION Combining Mass Spectrometric Metabolic Profiling with Genomic Analysis: A Powerful Approach for Discovering Natural Products in Cyanobacteria Karin Kleigrewe, Jehad Almaliti, Isaac
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
Biologisk enfald. enheten i mångfalden. Anders Liljas Biokemi och Strukturbiologi
Biologisk enfald enheten i mångfalden Anders Liljas Biokemi och Strukturbiologi Naturen har en enorm mångfald av livsformer. I luften, på land och i vattnet Charles Darwin (1809-1882) Darwin studerade
Föreläsning 5. Stereokemi Kapitel 6
Föreläsning 5 Stereokemi Kapitel 6 1) Introduktion 2) Definition av begrepp 3) Stereokemi i verkligheten 4) Nomenklatur 5) Flera stereocenter 6) Ringsystem 7) Kirala molekyler utan stereocentra 1. Introduktion
Prov Genetik. Max: 8G+7VG+2MVG G: 7G VG: 7G+4VG MVG: 8G+4VG+1MVG
Prov Genetik Namn: Max: 8G+7VG+2MVG G: 7G VG: 7G+4VG MVG: 8G+4VG+1MVG 1. Vad kallas den delning som ger upphov till haploida könsceller (G) (a) Mitos (b) Milos (c) Meilos (d) Meios 3. Polymera gener (polygener)
P-U-Csv-Aminosyror på Biochrom 30+
1(5) P-Aminosyror (NPU09011) U-Aminosyror/Krea (NPU14178) Csv-Aminosyror (NPU09013) Bakgrund, indikation och tolkning Bakgrund: Medfödda metabola sjukdomar är ovanliga genetiska sjukdomar men eftersom
P-U-Csv-Aminosyror på Biochrom 30+
1(6) P-Aminosyror (NPU09011) U-Aminosyror/Krea (NPU14178) Csv-Aminosyror (NPU09013) Bakgrund, indikation och tolkning Bakgrund: Medfödda metabola sjukdomar är ovanliga genetiska sjukdomar men eftersom
VI-1. Proteiner VI. PROTEINER. Källor: - L. Stryer, Biochemistry, 3 rd Ed., Freeman, New York, 1988.
Proteiner VI. PTEINE VI-1 Källor: - L. Stryer, Biochemistry, 3 rd Ed., Freeman, New York, 1988. VI-2 Molekylmodellering VI.1. Aminosyra En aminosyra (rättare: α-aminosyra) har strukturen som visas i figur
Proteinsyntesen. Anders Liljas Biokemi och strukturbiologi Lunds universitet
Proteinsyntesen Anders Liljas Biokemi och strukturbiologi Lunds universitet Ett fundament i proteinsyntesen är strukturen av nukleinsyror. F. Crick, J. Watson & Wilkins Nobelpris i medicin 1962 Wikipedia
Släktskap mellan människa och några ryggradsdjur
Övning: Släktskap mellan människa och några ryggradsdjur sid 1 Övning Släktskap mellan människa och några ryggradsdjur En manuell jämförelse mellan hemoglobinets aminosyrasekvenser hos några organismer
VI MÅSTE PRATA MED VARANDRA CELLENS KOMMUNIKATION
VI MÅSTE PRATA MED VARANDRA CELLENS KMMUNIKATIN CELLENS KMMUNIKATIN MÅL MED DETTA AVSNITT När vi klara med denna lektion skall du kunna: Förklara följande begrepp: replikation, translation, transkription,
Structure of urease inactivated by Ag(I): a new. paradigm for enzyme inhibition by heavy metals
Electronic Supplementary Material (ESI) for Dalton Transactions. This journal is The oyal Society of Chemistry 2018 Structure of urease inactivated by Ag(I): a new paradigm for enzyme inhibition by heavy
Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!!
Exam Molecular Bioinformatics X (MB) - March, - Page of Skriv svar på varje uppgift på separata blad. Lycka till!! Write the answers to each of the questions on separate sheets of paper. ood luck!! ) Sequence
Teknik och diabetes från EASD och ADA 2016
Teknik och diabetes från EASD och ADA 2016 Karin Filipsson Med dr, Specialistläkare VE Endokrin, Skånes universitetssjukhus Teknik och diabetes Blodsockermätning Insulinpumpar ITCA för GLP-1 Blodsockermätning
Tentamen i Biomätteknik SVENSK VERSION. UPPGIFT 1 (10p)
Tentamen i Biomätteknik 2013-10- 30 SVENSK VERSION UPPGIFT 1 (10p) I experimentet nedan har man undersökt om calmodulin binder till en del av estrogenreceptorn, vilket har betydelse för dess samband med
Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae
S1 of S10 Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae Chenjing Shang, Pierre Rougé and Els J.M. Van Damme Type 1 RIPs 1. Malus domestica (MDP0000918923) MALSFSIKNATTTTYRTFIEALRAQLTAGGSTSHGIPVLRRRQDVKDDQRFVLVNLTNYDSYTITVA
SUPPLEMENTARY INFORMATION
doi:10.1038/nature10537 a Binding fraction 1.2 1.0 0.8 0.6 0.4 0.2 b 0.0 1 10 100 1000 [Protein] (nm) Supplementary Figure 1. Stoichiometry of RIG-I helicase-rd bound to dsrna. (a) 14 base pair dsrna binding
Sannolikhetsteori. Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik,
Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik, 5p. Tid: Lördag den 29 mars, 2008 kl 14.00-18.00 i V-huset. Examinator: Olle Nerman, tel 7723565. Jour: Alexandra Jauhiainen,
TABELLSAMLING ATT ANVÄNDA I SAMBAND MED PROV I KEMI B
TABELLSAMLIG ATT AVÄDA I SAMBAD MED PRV I KEMI B ågra fysikaliska konstanter Atommassenheten 1u = 1,66 10 27 kg Elektronens massa m = 9,1096 10 31 kg Protonens massa m p = 1,6726 10 27 kg eutronens massa
INTRODUKTION - TYP 1 DIABETES
INTRODUKTION - TYP 1 DIABETES Erik Moberg Karolinska Universitetssjukhuset, Huddinge 160122 Diagnoskriterier - Diabetes fp-glukos 7,0 mmol/l (8 tim fasta) eller P-glukos (kapillärt) 12,2 mmol/l (venöst
TENTAMEN I STRUKTURBIOLOGI
Molekylär Cellbiologi TENTAMEN I STRUKTURBIOLOGI MÅNDAGEN DEN 26 MARS 2001 EFTERNAMN:... FÖRNAMN:... PERSONNUMMER:... POÄNGSUMMA: RESULTAT: Skriv namn och personnummer på ev. lösa blad. Tentamen innehåller
Centrala Dogmat. DNA RNA Protein
Protein folding Centrala Dogmat DNA RNA Protein Anfinsens klassiska experiment Proteinstrukturer Faktorer som påverkar den nativa strukturen Termodynamisk förklaring G = Η Τ Τ S G = - RT ln K K =
SUPPLEMENTARY FIGURE LEGENDS
SUPPLEMETARY FIGURE LEGEDS Supplementary Fig. 1. Flow cytometric analysis of wildtype, mutant and chimeric protein surface expression. Cells transduced with the individual constructs indicated were stained
Föreläsning 17. Karbonylkolets kemi II Kapitel 17 F17
Föreläsning 17 Karbonylkolets kemi II Kapitel 17 1) Introduktion 2) Addition av starka nukleofiler 3) Estrar 4) Amider 5) Nitriler 6) Syraklorider 7) Praktisk användning 1. Introduktion Aldehyder och ketoner
Supporting Information. Mechanism and Stereochemistry of Polyketide Chain Elongation and Methyl Group Epimerization in Polyether Biosynthesis
Supporting Information Mechanism and Stereochemistry of Polyketide Chain Elongation and Methyl Group Epimerization in Polyether Biosynthesis Xinqiang Xie, Ashish Garg, Chaitan Khosla, and David E. Cane*,
Uppdatering typ 2 diabetes Dr Jarl Hellman
Uppdatering typ 2 diabetes 190206 Dr Jarl Hellman Conflicts of interest Föreläsningar/advisory boards: Lilly, Sanofi, NovoNordisk, Abbot, MSD samt Boehringer Ingelheim Nya riktlinjer EASD/ADA Uppdatering
Supporting Information
Biosynthesis of Novel Statins by Combining Heterologous Genes from Xylaria and Aspergillus Hiroya Itoh, Makoto Matsui, Yuki Miyamura, Itaru Takeda, Jun Ishii, Toshitaka Kumagai, Masayuki Machida, Takashi
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
INTRODUKTION - TYP 1 DIABETES
INTRODUKTION - TYP 1 DIABETES Erik Moberg Karolinska Universitetssjukhuset, Huddinge 140903 Diagnoskriterier - Diabetes fp-glukos 7,0 mmol/l (minst 2 ggr, 8 tim fasta) eller P-glukos (kapillärt) 12,2 mmol/l
A Framework for Understanding Rosetta. Xavier Ambroggio
A Framework for Understanding Rosetta Xavier Ambroggio Origin of Rosetta Introduction to Basic Rosetta Methodology Overview of Rosetta Implementation Rosetta: an algorithm for ab initio structure prediction
Poäng: Godkänt 35 p. Max 70 p.
Stefan Klintström Avd. f. kemi, IFM Tentamen i Modern Biologi för icke-biologer Datum: Måndagen den 14 december 2009 Tid: 09.00-16.00 Plats: Brahe Examinator: Therése Klingstedt och Stefan Klintström,
SUPPLEMENTARY DATA Data in the Relational Database
Probability-Based Scoring Function as a Software Tool Used The Open Bioinformatics Journal, 2009, Volume 3 i SUPPLEMENTARY DATA Data in the Relational Database Table B.1. Amino Acid Information Amino ID
in the inward-facing conformation revealed by single particle electron Supplementary information
Manuscript submitted to: Volume 2, Issue 2, 131-152. AIMS Biophysics Received date 16 February 2015, Accepted date 04 May 2015, Published date 13 May 2015 DOI: 10.3934/biophy.2015.2.131 Research article
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, EITA50, LP4, 209 Inlämningsuppgift av 2, Assignment out of 2 Inlämningstid: Lämnas in senast kl
Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5. Skriv svaren på varje fråga på SEPARATA blad.
Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5 Skriv svaren på varje fråga på SEPARATA blad. Skriv namn på VARJE blad. Du kan svara på engelska eller svenska. Motivera eller förklara
Tentamen Biokemi 2 KEM090
Tentamen Biokemi 2 KEM090 2011 10 28 Max: 70 poäng Godkänt: 35 poäng Väl godkänt: 52 poäng Inga hjälpmedel tillåtna OBS! Besvara inte mer än en fråga per sida! Markera varje sida med personlig kod, datum
SWETHRO. Gunilla Pihl Karlsson, Per Erik Karlsson, Sofie Hellsten & Cecilia Akselsson* IVL Svenska Miljöinstitutet *Lunds Universitet
SWETHRO The Swedish Throughfall Monitoring Network (SWETHRO) - 25 years of monitoring air pollutant concentrations, deposition and soil water chemistry Gunilla Pihl Karlsson, Per Erik Karlsson, Sofie Hellsten
Handels- och industriministeriets förordning
Nr 261 573 Handels- och industriministeriets förordning om ändring av handels- och industriministerits beslut om kosmetiska preparat Given i Helsingfors den 1 april 2003 I enlighet med handels- och industriministeriets
Structural basis for the membrane association of ankyring via palmitoylation
SUPPLEMENTARY INFORMATION Structural basis for the membrane association of ankyring via palmitoylation Yuichiro Fujiwara, Hiroko X. Kondo, Matsuyuki Shirota, Megumi Kobayashi1, Kohei Takeshita, Atsushi
Hydroxyquinone O-Methylation in Mitomycin. Biosynthesis
Supporting Information Hydroxyquinone O-Methylation in Mitomycin Biosynthesis Sabine Grüschow, Leng-Chee Chang, Yingqing Mao, and David H. Sherman Life Sciences Institute, Department of Medicinal Chemistry,
Supplementary information for. MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing
Electronic Supplementary Material (ESI) for Lab on a Chip. This journal is The Royal Society of Chemistry 2019 Supplementary information for MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing Alphonsus
Material lektion 1. HT2 7,5 p halvfart Janne Carlsson
Material lektion 1 HT2 7,5 p halvfart Janne Carlsson Torsdag 17:e November 13:15 15:00 PPU105 Material Eftermiddagens agenda CES Datorövningar och inlämningsuppgift Fortsättning på Mekaniska egenskaper
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION SUPPLEMENTARY METHODS Preparation of the cells for transmission electron microscopy - Cells grown on coverslips were fixed for 45 minutes with 2.5% glutaraldehyde (50 mm cacodylate
Supplementary Figure 1.
Supplementary Figure 1. Electron micrograph of microcrystals of YadA-M. The needle-shaped crystals have a length of 5-10 µm. The crystals are stable in ddh 2 O for long time periods. Please note that electron
MOLECULAR SHAPES MOLECULAR SHAPES
Molecules with 2 electron pair groups around Linear molecules have polar bonds, but are the central atom form a linear shape. usually non-polar. is 180 linear 2 electron pairs around the central atom 1
Aminosyrorper100g.xls. 6 K ursiv\aminosyror i livsmedel
Aminosyror i livsmedel, mg per 100 g ätlig del Kod Livsmedel maträtt Protei n g Grönsaker Kväv e g Fakt or ILE LEU LYS MET CYS PHE TYR THR TRP VAL ARG HIS ALA ASP GLU GLY PRO SER 1201 Alfagroddar 4 0,64
The Arctic boundary layer
The Arctic boundary layer Interactions with the surface, and clouds, as learned from observations (and some modeling) Michael Tjernström Department of Meteorology & the Bert Bolin Center for Climate Research,
Suppl. Figure 1(a) Jur wt DMSO
Suppl. Figure 1(a) Jur wt DMSO Jur wt 6-MP Jur wt 6-TG Jur kd DMSO Jur kd 6-MP Jur kd 6-TG Suppl. Figure 1(b) Jur wt DMSO Jur wt 6-MP Jur wt 6-TG Jur kd DMSO Jur kd 6-MP Jur kd 6-TG Suppl. Figure 2(a)
Ni bereds härmed tillfälle till yttrande över bifogat förslag.
Datum: 2011-09-19 Dnr: 581:2011/512364 Enheten för kosmetika och hygienprodukter Kerstin Kahlén Enligt sändlista Läkemedelsverkets förslag till ändring av Läkemedelsverkets föreskrifter (LVFS 2006:17)
************************************************************** *********************************************************************
Umeå universitet EMG Barbara Giles Kod nummer: Tentamensformalia Kursens namn: 5BI110 Genetik och evolution 15 hp, moment genetik HT11 Datum: 2011-11-28 Tid: 09.00-13.00 Tillåtna hjälpmedel: miniräknare,
COMPARATIVE STUDY OF HYDROLYSIS PERFORMED WITH MODERN MICROWAVE TECHNIQUE AND THE TRADITIONAL METHOD
Institutionen för medicinsk biokemi och mikrobiologi Biomedicinska analytikerprogrammet Examensarbete, 15 hp COMPARATIVE STUDY OF HYDROLYSIS PERFORMED WITH MODERN MICROWAVE TECHNIQUE AND THE TRADITIONAL
Supporting Information
Supporting Information Wiley-VCH 2007 69451 Weinheim, Germany Supporting Information Wiley-VCH 2007 69451 Weinheim, Germany Prediction of Perception: Probing the hor17-4 Olfactory Receptor Model with Sila-Analogs
Moult migration of Latvian Whooper Swans Cygnus cygnus
Ornis Fennica 89:273 280. 2012 Brief report Moult migration of Latvian Whooper Swans Cygnus cygnus 1. Introduction ð ð 274 ORNIS FENNICA Vol. 89, 2012 Table 1. Known moulting sites of Whooper Swan cygnets
Läkemedelsverkets författningssamling
Läkemedelsverkets fattningssamling ISSN 1101-5225 Ansvarig utgivare: Generaldirektör Gunnar Alvan Föreskrifter om ändring i Läkemedelsverkets eskrifter (LVFS 1993:2) om bud och begränsningar vissa ämnen
J. Japan Association on Odor Environment Vol. -1 No. 0,**0 431
J. Japan Association on Odor Environment Vol. -1 No. 0,**0 431 - +, +,, + 0/1 **+/ +, + TEL *12 22, 0+,, FAX *12 22,.0,1 E-mail : nob-sakai@shoin.ac.jp 432-1 0 +2, *.-, + r*.*1-0 /3., -/, +, F p.-43,-40.-4-
) / (c l) -A R ) = (A L. -ε R. Δε = (ε L. Tentamen i Biomätteknik (TFKE37), 9 januari Uppgift 1 (10p)
Tentamen i Biomätteknik (TFKE37), 9 januari 2014. Uppgift 1 (10p) För akronymerna FT- IR, AUC, AFM, UV och MALDI: a) Skriv ut förkortningen! b) Föreslå för varje metod två egenskaper hos biomolekyler som
Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power Networks
DEGREE PROJECT IN ELECTRICAL ENGINEERING, SECOND CYCLE, 30 CREDITS STOCKHOLM, SWEDEN 2017 Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power
TN LR TT mg/l N b) 2,6-Dimethylphenole
TN LR TT 0.5-14 mg/l N b) 2,6-Dimethylphenole 283 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
TN HR TT b) i) 5-140 mg/l N 2,6-Dimethylphenole 284 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the
On the possible biological relevance of HSNO isomers: A computational investigation. Supplementary Information
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is The Royal Society of Chemistry 2014 On the possible biological relevance of HSNO isomers: A computational
Figure S1. The molecular weight of proteins encoded by genes in each sub-region of Chr.20
Supplementary Figure legends Figure S1. The molecular weight of proteins encoded by genes in each sub-region of Chr.20 Figure S2. The hydrophobicity of proteins encoded by genes in each sub-region of Chr.20
In Bloom CAL # 3. Nu ska du göra 8 separata blomblad. Ett mitt på varje sida och ett i varje hörn. Använd nål 3.5 mm.
In Bloom CAL # 3 I del 3 använder du virknål 3.5 mm och 3.0 mm. Efter varje varvsnummer står numret (1-7) för den färg du skall använda för det varvet, se färg/garn-tabellen. Du kommer att repetera varv
Day 1: European Cooperation Day 2017
Draft agenda for the Annual Event 2017 and European Cooperation Day 2017 Mariehamn, Åland 20-21.9.2017 Day 1: European Cooperation Day 2017 Open for the general public and projects Programme at Alandica
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Diagnoskriterier - Diabetes
INTRODUKTION - TYP 1 DIABETES Erik Moberg Karolinska Universitetssjukhuset, Huddinge 140903 Diagnoskriterier - Diabetes fp-glukos 7,0 mmol/l (minst 2 ggr, 8 tim fasta) eller P-glukos (kapillärt) 12,2 mmol/l
Personnummer. DUGGA Molekylärbiologi T3 / HT p (G = 24 p)
KORTSVARSFRÅGOR 1. Restriktionsenzymet HindIII klyver sekvensen 5 -AAGCTT-3 och lämnar ett fyra basers 5 -överhäng. Rita ut hur DNA-ändarna ser ut på ett fragment som klyvts med HindIII. (2p) SV: 5 -A
NMR Nuclear Magnetic Resonance = Kärnmagnetisk resonans
NMR Nuclear Magnetic Resonance = Kärnmagnetisk resonans Nuclear Magnetic Resonance Viktiga kärnor: 1 and 13 NMR används för strukturanalys av organiska föreningar Väteatomer med olika omgivning tar upp
In Bloom CAL # 5. Virka inte v för hårt / don t crochet r to tight. V 35 / r 35 (5) Upprepa v 18. [38 1-lm-bågar / sida och 2 lm / hörn]
![In Bloom CAL # 5. Virka inte v för hårt / don t crochet r to tight. V 35 / r 35 (5) Upprepa v 18. [38 1-lm-bågar / sida och 2 lm / hörn]](/thumbs/85/91841713.jpg "In Bloom CAL # 5. Virka inte v för hårt / don t crochet r to tight. V 35 / r 35 (5) Upprepa v 18. [38 1-lm-bågar / sida och 2 lm / hörn]")
In Bloom CAL # 5 I del 5 använder du virknål 3.0 mm. Efter varje varvsnummer står numret (1-7) för den färg du skall använda för det varvet, se färg/garn-tabellen. Du kommer att repetera varv från del
Könsfördelningen inom kataraktkirurgin. Mats Lundström
Könsfördelningen inom kataraktkirurgin Mats Lundström Innehåll Fördelning av antal operationer utveckling Skillnader i väntetid Effekt av NIKE Skillnader i synskärpa före operation Skillnader i Catquest-9SF
Domain structure of mitochondrial and chloroplast targeting peptides
Eur. J. Biochem. 180, 535-545 (1989) @) FEBS 1989 Domain structure of mitochondrial and chloroplast targeting peptides Gunnar von HEIJNE, Johannes STEPPUHN and Reinhold G. HERRMANN Department of Molecular
Statistical modelling and alignment of protein sequences
Statistical modelling and alignment of protein sequences Martin Weigt Laboratoire de Biologie Computationnelle et Quantitative Université Pierre et Marie Curie Paris ENS Paris 11 July 2016 What is the
Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik,
Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik, 7,5 hp. Tid: Lördag den 18 april 2009, kl 14:00-18:00 Väg och vatten Examinator: Olle Nerman, tel 7723565. Jour: Frank Eriksson,
CUSTOMER READERSHIP HARRODS MAGAZINE CUSTOMER OVERVIEW. 63% of Harrods Magazine readers are mostly interested in reading about beauty
79% of the division trade is generated by Harrods Rewards customers 30% of our Beauty clients are millennials 42% of our trade comes from tax-free customers 73% of the department base is female Source:
Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen
Examensarbete Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen Malin Carlström, Sandra Mårtensson 2010-05-21 Ämne: Informationslogistik Nivå: Kandidat Kurskod: 2IL00E Projektmodell
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
ASES. Active Solar Energy Storage. Thule Brahed ERRIN EUSEW Brussels
ASES Active Solar Energy Storage Thule Brahed ERRIN EUSEW Brussels 2017-06-21 1 Sweden and cold climate 2 Warm summers 3 Heat and electricity free if produced on the property area. Energy input 150 kwh/m
Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands
Skill-mix innovation in the Netherlands dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands m.kroezen@erasmusmc.nl The skill-mix innovation of interest BEFORE AFTER How did the Netherlands
Utfärdad av Compiled by Tjst Dept. Telefon Telephone Datum Date Utg nr Edition No. Dokumentnummer Document No.
Stämpel/Etikett Security stamp/lable RITNINGSKODER FR YTBEHANDLING OCH MÅLNING DRAWING CODES FOR SURFACE TREATMENT AND PAINTING Granskad av Reviewed by Ninl Tjst Dept. GUM2 tb_tvåspråkig 2006-05-09 1 (9)
Supplementary Information
Supplementary Information dynamically regulates group I metabotropic glutamate receptors. Jia Hua Hu, Linlin Yang, Paul J. Kammermeier, Chester G. Moore, Paul R. Brakeman, Jiancheng Tu, Shouyang Yu, Ronald
Nationellt stöd för finansiering av mjukvaruberoende innovation ANDREAS ALLSTRÖM
Nationellt stöd för finansiering av mjukvaruberoende innovation ANDREAS ALLSTRÖM Om Vinnova 200 anställda Stockholm, Bryssel, Silicon Valley, Tel Aviv Myndighet under Näringsdepartementet Tre roller Investeringar
Mapping sequence reads & Calling variants
Universitair Medisch Centrum Utrecht Mapping sequence reads & Calling variants Laurent Francioli 2014-10-28 l.francioli@umcutrecht.nl Next Generation Sequencing Data processing pipeline Mapping to reference
Table S1: Oligonucleotides and PCR primers used in this study.
Table S1: Oligonucleotides and PCR primers used in this study. Name 5-3 Sequence Description or Use Reference Strep B ACAAGCCCTGGAAACGGGGT 16S rdna PCR, [23] Strep F ACGTGTGCAGCCCAAGACA 16S rdna PCR, [23]
Klimat och miljö vad är aktuellt inom forskningen. Greppa Näringen 5 okt 2011 Christel Cederberg SIK och Chalmers
Klimat och miljö vad är aktuellt inom forskningen Greppa Näringen 5 okt 2011 Christel Cederberg SIK och Chalmers Hur mycket nytt (reaktivt) kväve tål planeten? Humanities safe operational space 3 Rockström
Conformational Transition of Glycoprotein Iba Mutants in Flow Molecular Dynamics Simulation
Cellular and Molecular Bioengineering, Vol., No., September (Ó ) pp. 9 DOI:./s9--- Conformational Transition of Glycoprotein Iba Mutants in Flow Molecular Dynamics Simulation QINGSHENG HUANG,, JIZHONG
Modeling of pore pressure in a railway embankment
Modeling of pore pressure in a railway embankment Marcus Vestman Civilingenjör, Väg- och vattenbyggnad 2018 Luleå tekniska universitet Institutionen för samhällsbyggnad och naturresurser 1. INTRODUCTION...
BASÅRET KEMI B BIOKEMI VT 2012
BASÅRET KEMI B BIOKEMI IngMarie Nilsson Biokemi och biofysik Plan 4 Rum 425 Tel. nr: 08-162728 E-post: ingmarie@dbb.su.se LABBAR Lab 11. Amylas lab Rum: K232/242 Huvudansvarig: Gabriela Danielsson Grupp
E4 Sundsvall Sundsvallsbron
E4 Sundsvall Sundsvallsbron E4 Sundsvall LEVERANTÖRSDAG EN NY VÄG. 1000 2009 NYA MÖJLIGHETER One new road. 1000 new opportunities. Ove Malmberg, Assistant Project Manager 2 2014-10-10 Project E4 Sundsvall
Osteoporos & Fragilitetsfrakturer Epidemiologi, utredning och behandling
Osteoporos & Fragilitetsfrakturer Epidemiologi, utredning och behandling Ortopedi Termin 8, december 2014 Kristina Åkesson Ortopediska kliniken SUS 1. Hur många osteoporosfrakturer sker varje år I Sverige?
Tentamen TMS145 Grundkurs i matematisk statistik och bioinformatik, 7,5 hp, kl
Tentamen TMS145 Grundkurs i matematisk statistik och bioinformatik, 7,5 hp, 21-12-14 kl 8.3-12.3. Examinator: Olle Nerman, tel 772 35 65. Jour: Malin Östensson, tel 78347877 Hjälpmedel: valfri miniräknare,
Jonbyteskromatografi
Jonbyteskromatografi Den mest frekvent använda proteinreningsmetoden Bygger på laddad interaktion mellan målproteinet i lösning och en fast matris. Beroende av:! Lösningens ph! Målproteinet och kontaminanternas
NMR en mångsidig biomätteknik
NMR en mångsidig biomätteknik Maria Sunnerhagen, IFM NMR fundamenta Proteinspektra i en och flera dimensioner Resonanstilldelning Strukturbestämning Ligandmappning, SAR-by-NMR Folding och dynamikstudier
Läkemedelsverkets författningssamling
Läkemedelsverkets författssamling ISSN 1101-5225 Ansvarig utgivare: Generaldirektör Gunnar Alvan Föreskrifter om ändring i Läkemedelsverkets föreskrifter (LVFS 1993:2) om förbud och begränsar för vissa
The Effect of Using DMSO as a Cosolvent for Ligand Binding Studies Simon Birgersson
The Effect of Using DMSO as a Cosolvent for Ligand Binding Studies Simon Birgersson Master Thesis in Biophysical Chemistry, 2018 Department of Chemistry Lund University Sweden The Effect of DMSO on Binding
Beräkningsverktyg för arkitekten
Beräkningsverktyg för arkitekten Jouri Kanters, doktorand & arkitekt [NL] Lunds Tekniska Högskola / Energi & ByggnadsDesign Beräkningsverktyg / simuleringsprogram? Varför? Vi vet ju detta: Jönköping 15%
Utmaningar för bioinformatiken inom industri och akademi
Utmaningar för bioinformatiken inom industri och akademi Per Kraulis Biovitrum AB Industriakademin, 27 okt 2005 Landskapet 1 Homo sapiens genomet klart (nåja) Flera mammalie genom, i användbart skick 1000