Supplementary Information

Save this PDF as:
 WORD  PNG  TXT  JPG

Storlek: px
Starta visningen från sidan:

Download "Supplementary Information"

Transkript

1 Supplementary Information dynamically regulates group I metabotropic glutamate receptors. Jia Hua Hu, Linlin Yang, Paul J. Kammermeier, Chester G. Moore, Paul R. Brakeman, Jiancheng Tu, Shouyang Yu, Ronald S. Petralia, Zhe Li, Ping Wu Zhang, Joo Min Park, Xinzhong Dong, Bo Xiao, Paul F. Worley Contents Supplementary Figures 1 13

2 Figure S Human (1) Rat (1) Mouse (1) Chicken (1) Zebrafish (1) Drosophila (1) MLLPSGRSNSDVYPLQNVNTTTASASSVGGSKPLLLTRTSSPQLTTLQTLNGGGIGGGGGANAHTALRTNSSAAFAATLAQETAGSLPGTGTQATATTST Human (1 ) MDVFSFVKIAKLSSHRTKS Rat (1) MRSHSCHRTKS Mouse (1) MRSHSCHRTKS Chicken (1) MEEAEMNPSEKLATSFKVIWFTCVGKGAIAMRRRTDHRNK S Zebrafish (1) MITVCNWVINSSSSFFTRSSFPPQPFVPQCHCSPPPKLQIGRTFERRDGSRRDK S Drosophila (101) TASATTTTTAISTTTTAISTTATATATTAAASVNAVNTDFGAGALYGPILGPSHAGNAPIGNWGEIDRHLDAVQEKLKAGVHLAKDGRLYYCNHLTQ S Human Rat Mouse Chicken Zebrafish Drosophila (20) SG WPPPSGTWGLSQVPPYGWEM TANRDGRDYFINHMTQAIPFDDPRLESCQIIPPAPRKVEMRRDPVLGFGFVAGSE KPVVVR (12) SG WPPPSGTWGLNQVPPYGWEMMTNRDGRDYFINHMTQAIPFDDPRFDSCQIIPPAPRKVEMRRDPVLGFGFVAGSE KPVVVR (12) SG WPPPSGTWGLNQVPPYGWEMMTNRDGRDYFINHMTQAIPFDDPRFDSCQIIPPAPRKVEMRRDPVLGFGFVAGSE KPVVVR (42) SG WPHPSGTWSLNQGTPYGWEMTANRDGRDYFINHMTQSATFEDPRIESCQITPPAPRKVEMRRDPVLGFGFVAGSE KPVVVR (56) FPRLYIVFTSTVLCLNGE CQTCVSNVAVMKEES KSCVICPHGKKKYRSIL HHLSQSSSLEEVRVDVEKFVPPAPRKVEMR RDPVLGFGFVAGSE KPVVVR (201) SG WLPACEDWSKHEELSYGWE RAIDSKGRSYYI NHLNKTTTYEAPECIRWDEHPPEPRLVQLQRSASLGFGFVAGSE RPVIVR Human Rat Mouse Chicken Zebrafish Drosophila (103) SVTPGGPSEGKLIPGDQIVMINDEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKS-----AFISAAKKARLKSNPVKVRFSEEVIIN-----GQVSE (95) SVTPGGPSEGKLIPGDQIVMINDEPVSAAPRERVIDLVRSCKESILFTVI QPYPSPKS-----AFISAAKKARLKSNPVKVRFSEEVIIN-----GQVSE (95) SVTPGGPSEGKLIPGDQIVMINDEAVSAAPRERVIDLVRSCKESILLTVIQPYPSPKS-----AFISAAKKARLKSNPVKVRFSEEVIIN-----GQVSE (125) SVTPGGPSEGKLIPGDQIIMINDEPVSTAPRERVIDLVRSCKESILLTVVQPYPSPKS-----AFISAAKKARLKSNPVKVRFSEEVIIN-----GQVSE (156) SVTPGGPSEGKLIPGDEIVMINEEPVSSAPRERVIDLVRSCKESIILTVVQPYPSPKS-----AFISAAKKAKLKSNPVKVRFAEEVIIN-----GQVPE (284) FVTEGGPSIGKLQPGDQILAVNGEDVKDAPRDHVIQLVRACETQVSLLVC QPMAHCVLPGRKSTLLSAGKRAKLRTRPSRVRFAESVCVNGAPLFPPSAF Human Rat Mouse Chicken Zebrafish Drosophila (193) TVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPK (185) TVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPK (185) TVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLMLEQRIEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPK (215) TVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIK CIEHFSLMLEQRVEGSGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPK (246) SVKDNFLLFMPNVLKVFLENGQTKSFKFDCNTSIK (384) SLGDICVPPMANVLKVFLENGQTKSFKYDATTTVQDVVSSLLDKLCL CCGELFSL VLEHVKSLKRNKLTLLDPQESLARIAARPGAHKLRCLFRITFVPI Human Rat Mouse Chicken (293) DPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTT-KQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQ (285) DPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTT-KQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQ (285) DPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELK YDIALRLAALQMYIATVTT-KQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQ (315) DPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTT-KQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQ Zebrafish (281) EWGLAQFLPPAVLSSMKEKNIKKALTHILKTNQ Drosophila (484) SAAELAQRDLNALDYLYMQCCNDVNQERFAPELQPELALRLAAL HMHQHALANNFAPAKLTVKLVER EFGLERFVPVSLFEGMKRKELRRLISHFLKVNA Human Rat Mouse Chicken Zebrafish Drosophila 601 D-domain 700 (392) NLVPPGKKLSALQAK VHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFSEEESLVRVELHVLDVKP (384) NLVPPGKKLSALQAK VHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEEESLVRVELHVLDVKP (384) NLVPPGKKLSALQAK VHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEEESLVRVELHVLDVKP (414) NLVPPGKKLSALQAK VHYLKFLSDLRLYGGRVFKATLVQGEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEDESSVRVELHVLDVKP (314) NLVPPGKKLTALQAK VHYLKYLSDLRLYGGRVFKSTLVQ GEKHTEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEM YTEDERNVRVELHVLDVKP (584) EMTGSSKVLTQLQAK LHYLDIIASLPSYGAKCFSTNQRE G---MERVLLVSPRFGLS QISSARNSVPQPISAIEDFTHVVVHREDDITCSVSIYMLGDRA

3 Human Rat Mouse Chicken Zebrafish Drosophila Human Rat Mouse Chicken Zebrafish Drosophila Human Rat Mouse Chicken Zebrafish Drosophila Human Rat Mouse Chicken Zebrafish Drosophila (492) ITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTATQETGPENK GKHNLLGPDWNCIPQMTTFIGEGEQEAQITYIDSKQKTVEITDSTM CPKE (484) ITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNAGTQDTG TENK GKHNLLGPDWNCMPQMTTFIGEGEQEAQITYIDSKQKAVEMTDSTLCPKE (484) ITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNAGTQDTG SENK GKHNLLGPDWNCMPQMTTFIGEGEQEAQITYIDSKQKTVEMTDSTLCPKE (514) ITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNAG NRETGIENR GKHNLLASE WNCVPKTTTFLADGDQETQMPFGDPKQKAIDVSESLLCQKE (414) ITLIMESSDAMNLACLTAGYYRLLVDSRRSIFNMANN---- SNTAGHDTR IKHNYQAID WNYG --T----CGGCNEPHPEYAVCGRRECDISPSEIHQAH (681) VKFIMEDRDACEFSLVLG GYYRLLTG---NVLNVLRERE PNEEDNAPAFL SQHTVLPAS WSYL LPFHNRAHSVNFLITPPYHPMPQQAVLSQPQPVQQQQ (592) HRHLYIDNAYSSDGLNQQLSQPGEAPCEADYRSLAQRSLLTLSGPETLKKAQESPRGAKVSFIFGDFALDDGISPPTLGYETLLDEGPEMLEKQRNLYIG (584) HRHLYIDNTYSSDELSQPLTQPGDAPCEADYRSLAQRSLLTLSGPDTLKKAQESPRGAKVSFIFGDLALDDGMSPPTLGYERMLDENPEMLEKQRNLYIS (584) HRHLYIDNSYSSDELNQPLTQPGDAPCEADYRSLAQRSLLTLSGPDTLKKAQESPRGAKVSFIFGDLALDDGMSPPTIGYERMLEENPEMLEKQRNLYIS (614) HRHLYIENTYNSGGFDQHLTKQDPTDAEES-RNFNQHSLLSLSGLESSKKAQDSPRGAKVSFIFGDHNLDG-INPQTLGYERLLDESPEVLEKQRAIYI N (504) HMHGDEKAERQSRGSHMHAQPYFNIPKGKP Q-ESPRSAKVSFIFGDPPLDS-VNPQNLGYHRLMEDIPEVLEEHR-YLY A (778) QLSYATDLDLHSVMATELLEEAAKDSGLSDSSGSNYCSESRTQLAVEA KN EQVLRRVQELQKLVQCSEQYLS EQEQELQHVPLQQLQQQQREQTQQQMGQ (692) SANDMKGLDLTPEAEGIQFVENSVYANIG--DVKSFQAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGE MNQP AILNLSGSSDD (684) SANDMKNLDLTPDTDSIQFVANSVYANIG--DVKNFEAPEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVSEINQP AILDLSGSSDD (684) SANDMKNLDLTPDTDSIQFVANSVYANIG--DVKNFEAPEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGE MNQP AILDLSGSSDD (712) NANDIKGLELSPDAESIQFATNAVYATIN--DGKIFGAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDIMVGE INRP ALLSLSGSSDD (581) QQKDYKPLEASLEVDGFQYGTHMVYG-----DAKIFGTTEGIEEPLLHDICYAETTDDAEEDDDISCEEDMMM MMGEMK------DKAN SLLSLSESSDD (878) SVAMLEFDSDCDSLNSSKVSSTEESNHVSQPSLKHSDSLTLLAETISHELTGITQGLNAIPEPISASAPPTPA TPKRKPSLCSTS- SPRPQRKLNGFSQL 1001 Homer site 1100 (792) IIDLTSLPPPE--GDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFPEDK---EKGSSLQNDEIPVSLIDAVPTSAEGKCEKGLD NAVVSTLG (772) IIDLTTLPPPE--GDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDTQSQATSFHENK---EQGSSLQNEEIPVSLIDAVPTSAEGKCEKGLD PTVVSTLE (772) IIDLTTLPPPE--GDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDTQSQATSFHEDK---EQGSSLQNEEIPVSLIDAVPTSAEGKCEKGLD PAVVSTLE (800) IIDLTSLPPPE--GDDNEDDFLLHTLNMAIAAPPPGFRDSSDEEDSQNQATQPRDDK---EQASNLGS DDIPVSLIDAVPTNTEGKCEKGLDDAVVSTLQ (670) IIDLTSLPPPPEGDYEEDSDDLLESLNLAIAA PPPGFRDSSDEDDHHDRKMSKN DIPVSLIDSVPTQVAGGSEEVFN DAVVSTLQ (977) LSDLQALGTDFSQSESDSESVASPAQSPTTRR PQQLLQAG SKQQQQQQQH QQLAQRSSFGLHSPDGTH FGAETKDYNLREYLQQLKEISNVP DTDVAARQ Human Rat Mouse Chicken Zebrafish (875) ALEALSVSEEQQTS DNSG---VAILRAYSPESSSDSGNETNSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPASKTPAGGLPPKSSHAL (867) ALEALSE--EQQKSENSG---VAILRAYSPESSSDSGNETNSSEMTEGSELAAAQKQSESLSRMFLATHEGYHPLAEEQTEFPTSKTPSVGLPPKSSHGL (867) ALEALSE--EQQKSENSG---VAILRAYSPESSSDSGNETNSSEMTEGSELAAAQKQSESLSRMFLATHEGYHPLAEEQTEFPTSKAPSVGLPPKSSHGL (895) ALEALAASEEQQTNDNSG---VAILRAYSPESSSDSGNETNSSEMTESSELAAAQKHSENTAR MFLTTSEGYQPLVEEQTEFPIAKSQAGGPGMKSSQPL (755) ALEALAASEDQSHPQSDNSSGVEISRSFSPESSSDSGNETNSSEMTESSELAAAQKLSENSLK MFVATAEGYQTLAEEETEFRLAPSLDDPQSS Drosophila (1077) LSEIYGFEVREDTFIETDTDLIDLRAIPPPQTPDELDSLSLLNAAPPKGFEGKAEELDSFLQQ MLVAPPTQKATPAKELTPEEIMSFIIPPPPNLEAQPE Human (972) AAR---PATDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSKRKSKLADGEGKAPPNGNTTGKKQQGTKTAEMEEEASGKFGTV Rat (962) AAR---PATDLPPKVVPSKQILHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSKRKSKLAEGEGKCPLSGNVPGKKQQGTKIAETEEDTKGKVGTV Mouse (962) AAR---PATDLPPKVVPSKQILHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSKRKSKLPEGEGKSPLSGNIPGKKQQGTKIAEIEEDTKGKAGTV Chicken (992) AGC---QAADLQSKVVPSKQILHSDNMEMEPETMETKSVTDYFSKLHMGS LVYSCTSKRKSKM TESEVKAPSDGNATVKKQQGTKKAETDEELKAKFGTI Zebrafish (849) AVAN LRSDHFEMEPETMETKSLTEYFSKMHRDV MRGMAQGKVEEQDS GMKSSAEAAARQLN IAESEDLVGMYSNF Drosophila (1177) Human (1069) Rat (1059) Mouse (1059) Chicken (1089) RPEECLYSNSVQAKREFFQAVANGNNSIQQNNHKDQAAHVIEYPTVERKS KFSCCPTSKKEEAA SLEEAAPLQPPPRTPAIEQTTPPPARPPKSAELLQR SSRDSQHLSTFNLERTAFRKDSQRWYVATEGGMAEKSGLEAATGKTFPRASGLGAREAEGKEEGAPDGETSDGSGLGQGDRFLTDVTCASSAKDLDNPED SSRD NPHLSTFNLERTAFRKDSQRWYVASDGGVVEKSGVEAPAMKAFPRGPGLGNREAEGKEDGTMEGEADDASGLGQGERFLSDMACVASAKDLDNPED SSRD NPHLSTFNLERTAFRKDSQRWYVASDGGVVEKSGMEAPAMKVFPRGPGLGNREAEGKEDGTVEGGADDASVLGQG DRFLTDMACVASAKDLDNPED SARDSQ RLSTFNVERTAFR---QRWYGA DDGAADKPS-PETANGKTFPRVPVRGKTETDCKDEVDPEVDQDDTSGLSQG ENFLSDM TPVSSAKDLNDAED Zebrafish (924) NGRDSQ CSAPFDMESMSYAFQ GSNQRLHMILNNKSEEHIYSEVAGDSAPLHADRVAQ KVSLEDSIDLNASSPAKEQYLV Drosophila (1277) YSPKK QVRIVGHQPVVSVPLRELCPPQLPPRSSPTASSEPATPQTATPATSAVSAPKKPPLPPIANRPRPVNGTPTPV SNTSPPIPATTRLPNAHSNGGQ Human (1169) Rat (1159) Mouse (1159) Chicken (1185) ADSSTCDHPSKLPEADESVARLCDYHLAKRMSSLQSEGHFSLQSSQGSSVDAGCGTGSSGSACATPVESPLCPSLGKHLIPDASGKGVNYIPSEERA PGL TDSPTCDHATKLPEAEDNVARLCDYHLAKRMSSLQSEGHFSLQSSQGSSVDTGCGPGSSSSACATPVESPLCPSMGKHLIPDASGKGGSYISPEERVAGH TDSPSCDHATKLSEAEDNVARLCDYHLAKRMSSLQSEGHFSLQSSQGSSVDTGCGPGSSSSACATPVESPLCPSMGKHMIPDASGKGGRYISPEERAPGH TDLSADDHPSKLPEAEQSVARLCEYHLAKRMSSLQSEGHFSLQSSQCSSVDAGCSTG--SSTCATPVESPLCTS DIKHVISDPSMKGIAYIPADERAAIL Zebrafish (1003) ERARSEHQQSKGASSEQEVTRLYEYHLSKRMSSLQSE GVHSLQSSQCSSI DAGCSTG--SSSCVTPMDSPLCTVD SVHLHTESSMKGLGYTNQNVDGTFL Drosophila (1377) PTLPKKPQQLHGEKLFIKNGHLIDGEALLAKTDVAMA GLLIKLDQVAAQC SAAQSAGGGTSIDEDKFQRARNELTEQTLALVTASKFLVASMSDMTLINL

4 Human (1269) Rat (1259) Mouse (1259) Chicken (1283) PNHGATFKELHPQTE GMCPRMTVPALHTAINTEPLF PNHGATFKELHPQTE GMCPRMTVPALHTAINADPLF PNHGATFEELHPQTE GMCPRMTVPALHTAINADPLF SNHGTTYKDLHQQPE AVCHRMTVPVTHSAINAEPLF Zebrafish (1101) RKHHGQAGAESGREGSQRLPKIRETTVVFFIATVYMLSSPCLVDICSDAADGDKRGFALTECPSSSSSRAQLVLCQARG DGTSRMLPCLLVHSASVH PLW Drosophila (1477) PDHLTSCLTAIRRITELAQDMTR HTSAP LQTRNIVLKVHDVASSFREL Human (1305) GTLRDGCHRLPKIKETTV Rat (1295) GTLRDGCHRLPKIKETTV Mouse (1295) GTLRDGCHRLPKIKETTV Chicken (1319) GTLREGCHRIPKIKETTV Zebrafish (1201) LPQGGGKGILNKTTMGSGSIHTFYGNEMAVIIQAVVR Drosophila (1525) VGVQIGPIGAGQLALQAECLANVLATLLRSLRVFSP- Supplementary Figure 1: The amino acid sequence alignment of from various creatures. Red residues shaded in yellow are identical in all the predicted proteins, dark blue residues shaded in light blue are identical in > 50% of the predicted proteins, similar residues are shown in black shaded in green. D domain and Homer binding site are indicated.

5 Figure S h (1) MDVFSFVKIAKLSSHRTKSSGWPPPSGTWGLSQVPPYGWEMTANRDGRDYFINHMTQAIPFDDPRLESCQIIPPAPRKVEMR RDPVLGFGFVAGSEKPVV hpreso2 (1) METLDSQRVQDRLLAAPGCSSPSGQQELFSSHVMQEES ANDMECEQLPAEILRQVTV HRDPIYGFGFVAGSERPVV hpreso3 (1) -----MEELETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADG PARNPTQTLIPVRHTVKIDKDTLLQDYGFHISESLPLT h (101) VRSVTPGGPSEGKLIPGDQIVMINDEPVSAAPRERVIDLVRSCKESILLTVIQPYPSP-KSAFISAAKKARLKSNPVKVRFSEEVIINGQVSETVKDNSL hpreso2 (77) VRSVRPGGPSENKLLAGDQIVAINEEDVSEAPRERLIELIRSAKEFIVLTVLHTHQSP-KSAFISAAKKAKLRSNPVKVRFSEQVAVGETDA KMMKKEAL hpreso3 (81) VVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDSLSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLISGHS----QGNSL h (200) LFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLR hpreso2 (176) LLIPNVLKVFLENGQIKSFTFDGRTTVKDVMLTLQDRLSLRFIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLR hpreso3 (177) LCMPNVLKLYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSIEYFALALEEQYSIS--RLHLLHEEELIQQVVEREESHDYRCLFRVCFVPKDPLDLLK h (300) RDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKK hpreso2 (276) RDPAAFEYLYIQSRNDVIRERFGMDPKPEMLLGLAALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQVIKEKNLRKSLSQQLKAHQTHPSCGTK hpreso3 (275) EDPVAFEYLYLQSCSDVLQERFAVEMKCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISFHMKRNQNLLEPRQK 401 D-domain 500 h (400)--LSA LQAKVHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFSEEESLVRVELHVLDVKPITLLME hpreso2 (376)--GSA IQAKLQYLRILNELPTFTGVLFNTVGLD- EKQSATTLLVGPRHGISHVIDLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLME hpreso3 (375) QLISA AQLRLNYLQILGELKTYGGRIFNATLMLQDRESYIALLVGAKYGISQVINSKLNIMSTLAEFANISRVELTEESEKVSVVKVYLQDVKVLTLLLE h (498) SSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTATQETGPENKGKHNLLGPDWN CIPQMTTFIGEGEQEAQITYIDSKQKTVEITDSTMCPKEHRHLYI hpreso2 (473) WPEATNFACLIAGYCRLLLDSRKMVFSRPASQPLPPPMIKADYMHSAHRPVTGGH LGKKESSYVG hpreso3 (475) SNSAKDLACLIAGYYRLLVDPVTSIFLWPGNKQQAHRVSAEEGYESRACSDSEES SEVDCVLEPLSDRRLVKLAPCRSLIK h (598) DNAYSSDGLNQQLSQPGEAPCEADYRSLAQRSLLTLSGPETLKKAQESPRGAKVS FIFGDFALDDGISPPTLGYETLLDEGPEMLEKQRNLYIGSANDMK hpreso2 (538) ----SVGTSPRKSSRCTPPPADSELVSFCYLHMREQ------RKEQESRTDVNENLIFFEETRPRTKSDPTS hpreso3 (556) EEQPPGNSPTPEVARRGPSTCGASSTTDSAESEASDSANTESRGYRTSGSSESMD ALEEDDLDTCSSSRSTFFHFGSPGLAESIDSDSQEERSGIETSGF h (698) GLDLTPEAEGIQFVENSVYANIGDVKSFQAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILN LS GSSDDIIDLTS hpreso2 (600) KSSGQGYEVVPDDFDAASLDHEPCASRARSYTLDNSLGAEALNFYCDSC KAKLQEQLGPRKGGKPGSS RDNIVDLMS hpreso3 (656) LCLLDLAQRANPQCQKTEFSESAALETFGWAPELSTVRLDPRLYEGSHADYYSLCSSVSPASYLSDSSESTASRQGGAPPAWGQQGEAQPSSMLEPLA 801 Homer site 900 h (786) LPPP-EGDDNEDDFLLRSLNMAIAAP--PPGFRDSSDEEDS-QSQAASFPEDKEKG------SSLQNDEIPVSLIDAVPTSAEGKCEKGLDNAVVSTLGA hpreso2 (677) LPPPGSEEEEEEEDETTSLLPAIAAP--PPGFRDNSSDEDDPKRRAVQSQEQGRHL------RGLLYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQA hpreso3 (756) LHPPLAFEDGSSDEEYYDAADKLTPPGPPSGPRDVSTAEPSATSLQNKASTSSPENSLPCGPDGRQPSRRGGVKKYAKTLRKRRSFLQTDDTSQVSFPLV h (876) LEALS VSEE---QQTSDNSGVAILRAYSPESSSDSGNETNSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPASKTPAGGLPPKSSHALA hpreso2 (768) LEALA ASEDGPHPPPPQTAGLIVLATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFLAQHLNKDSLLARKDLPFRIQSCAAQAVLTAPYSLGR hpreso3 (856) PSASLESVDDVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETKALGLLAPLRETKSTNPASRVMEMEPETMETKSVIDSRVSSISAIRFRIDPNNKEN h (973) ARPATDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSKRKSKLADGEGKAPP NGNTTGKKQQGTKTAEMEEEA hpreso2 (868) PDPNPSLQPIATGQSPGPPGARRKLPQSEGQVQGERTYSLAVHPALSPQLSEQKNLSLLSPVPEDKGPGHTRAGLEMSLRAATSSLSEEQVSELRDNLPK hpreso3 (956) SGVVPAASSSASTPHCSNPGSSGPDTAQARPSQ-ILPLSQDLDGIAPKEPTIEHGDSSFSLSSGDPNPDRACLAS----NPGLNNVSQGDTLELQLEPHV h (1062) SGKFGTVSSRDSQHLSTFNLERTAFRKDSQRWYVATEGGMAE----KS--GLEAATG------KTFPRASGLGAREAEGKEEGAPDGETSDGSGLGQGDR hpreso2 (968) EVRLSPKLILDPKSSVTPAIISAALQQVVHNKSLVTAGGALGNPPSRGERRLEASMGRPEVSMMSSSASKNLKFKISPSAPETSWNSQHQLGAEVSSSPR hpreso3 (1052) QLEMGLESFCTNHIQETAPKYTEPLLSPRDEPRSDECGINPGEK-IASIPTKEEPQGQLSLERDREVTNKNGTNVFQEESRKDSGDSPGDVSNNVSQTLD

6 h (1150) FLTDVTCASSAKDLDNPEDADSSTCDHPSKLPEA--DESVARLCDYHLAKRMSSLQSEGHFSLQ--SS-QGSSVDAGCGTGSS G---- hpreso2 (1068) APTGSRADSLHLSQQEDSLPVQNFPPKSYLLRTS--RESVGKQATGEVAGKGGPVGGKPTLQKQGTISSQGEKAQLESTPKRSKLEETSLVPRATYPMAL hpreso3 (1152) ISSPAGKIVTSLSLDAPVTGTEQIPPHPPRDPQGQSREPPGQGCQAQEQKLFVELDLDPDFFLGKQTVSPAVPPEGIKAEAPNHVTGQDIAPRDSPEWVC h (1229) SACATPVESPLCPSLGKHLIPDASGKGVNYIPSEE-----RAPGLPNHGATFKELHPQTEGMCPRMTVPALHTAINTEPLFGTLRDGCHRLP hpreso2 (1166) QS------PSCQSRSHSPSCQPHGHSPSSQSRGQSPSCQPRGQSPLRSQAASRQVSTMPSRKLETTLNGAHSTSEGPAKPKSSRGPFRLRNLFSATFPTR hpreso3 (1252) FNPEPSLPEPLPCPQEDPHLETSNHCLLSEGKSDSSSICLSAEKSFLCFAPESHPEVSASLRVATSLGFAGMNEMVAPRIGMDQCSCQFSYATCFRGPQP h (1316) KIKETTV hpreso2 (1260) QK KETDERQAQLQKVKQYELEFLEELLKPPSQGELPGTEYLQPPAPGRCSCQLRS SPVQQGPGMSREQRRSCDCKRICRGGRPQATQTPVPSLRGRERDR hpreso3 (1352) E----TEEEDR--DLEAHPMAPLTS---PPSAGSPVVLPWRPARAHSCTTAPLSR KSHIWPEYCSRALRQLKATPASTPEGFIQLMESLLELQDILETSW h (1316) hpreso2 (1360) VLPSQRQPEAGPGVSLSSPINVQRIRSTSLESRECRSDPESGVSCLTTCASGGEC LGAPNYRKLMRRYSISELDQGDRASLTSDVYPHPPLGMLPREAKE hpreso3 (1443) GVGNKHPPEKCTWHFTESRSRLCMGSQKLLSSCRHVIRMDQSPEEMQGAVRDTFQ HLVQLAGLCFQFTDCSRCSARHREAAGNLRDVVYTYHQFIEAAKS h (1316) hpreso2 (1460) VEASLPIA LGPKSRSLESPTLGDPSYVQVAPETKGPRQMAVFSLPEEVYRKPAELDEDSESSKCCSIRYCFYYRKCDMADDASDGKDELSYSIPMKILPG hpreso3 (1541) TCERGYHD LSVKLLARQCTALTAAVFCLTQKFRASTAL h (1316) hpreso2 (1560) MKLDEQVVPVVSRTLQVLDAATCSSSSPEASRTQEIDLRVSTFEGSLAKINALRAHAYGLPDGFLAARLDTNELLTVLRQCVASPEARAPKPYVSQISEY hpreso3 (1541) h (1316) hpreso2 (1660) KLELALKFKELRASCRRVANVDKSPTHMLAAITGSFQVLSSLIETFVRLVFIVRSEAQRQELLAKVEEVVRNYTFLLRAAEESTARNLNQQQQQQQQQQQ hpreso3 (1541) h (1316) hpreso2 (1760) QQQQQQQQQQQQQQQQVAAAAGAATEHPPGSPTSATVMSTFTHSLKTLIK hpreso3 (1541) Supplementary Figure 2: The amino acid sequence alignment of human Preso family. Red residues shaded in yellow are identical in all the predicted proteins, dark blue residues shaded in light blue are identical in > 50% of the predicted proteins, similar residues are shown in black shaded in green. D domain and Homer binding site are indicated.

7 Figure S3 Preso2 Preso3 Supplementary Figure 3: Preso family expression patterns by in situ hybridization. 1Kb C terminal coding region of each gene was used for antisense and sense probes that were labeled with [35S].

8 Figure S4 a Myc : Myc Preso2: Myc Preso3: Myc Homer1c: b Lysate IP: anti HA mglur5: Myc : IP: Homer1c anti HA Lysate anti Myc c Blot with anti myc d Lysate IP: anti Lysate IP: anti mglur2: Myc : mglur4: Myc : anti mglur2 anti mglur4 anti Myc anti Myc e mglur5 C term: S1126A S1126A λ Phosphatase: ps mglur 50 KD mglur5 50 KD

9 Supplementary Figure 4: Preso family: co IP assays with Homer and mglurs. a, and Preso2 co IP with Homer1c, but Preso3 does not. Myc Homer1 and Myc Presos were transfected into HEK293T cells. Detergent lysates of the cells were incubated with anti Homer1c antibody and then analyzed by Western blotting with anti Myc antibody. b, mglur5 co IPs with. Myc and HA mglur5 were transfected into HEK293T cells. Detergent lysates were incubated with anti antibody and blotted with anti Myc and anti HA antibody. c, mglur2 does not co IP with. Myc and mglur2 were transfected into HEK293T cells. Detergent lysates were incubated with anti antibody and precipitates analyzed by Western blotting with anti Myc and anti mglur2 antibody. d, mglur4 does not co IP with. Myc and mglur4 were transfected into HEK293T cells. Detergent lysates were incubated with anti antibody and precipitates analyzed by Western blotting with anti Myc and anti mglur4 antibody. e, Characterization of mglur5 phosphorylation antibody. The phosphorylation site specific anti mglur5 ps1126 antibody detects wild type mglur5 C terminus from transfected HEK293 cells, but not mglur5(s1126a) mutant. λ phosphatase treatment of the immunoblot abolishes reactivity of wild type mglur5 C terminus. A phosphorylation independent anti mglur5 C terminus antibody is used to detect expression of wild type and mutant mglur5 C terminus.

10 Figure S5 a protein WW PDZ RA FERM Homer Ligand PDZ Ligand PPPGFRD ETTV locus 90kb EX2 EX3 EX4 EX3 Targeting vector LoxP frt PGK-neo frt EX3 LoxP Nhe I NheI Short Arm Long Arm LoxP frt frt LoxP 90kb floxed EX2 PGK-neo EX3 EX4 allele - allele EX2 LoxP Cre-recombinase expression 90kb EX4 b Cortex Cerebellum Cortex Cerebellum / / / / / / / / / / / / 517 bp 353 bp 409 bp 245 bp c Actin / d e Cortex Hippocampus Striatum Cerebellum Actin / Homer1 Homer2 Homer3 GluN1 GluA1 W1 W2 K1 K2 W1 W2 K1 K2 W1 W2 K1 K2 W1 W2 K1 K2 GluA2/3 Actin

11 Supplementary Figure 5: PKAP1 knockout mice generation. a, Schematic representation of the gene targeting strategy. The relevant portion of the locus Exon 3 was inserted in the LoxP/PGK neo cassette to make a conditional knockout. CMV CRE mice were employed to generate / mice. b, RT PCR analysis after CMV CRE expression. Two independent primer sets in different exons were used. c, Western blot analysis shows absence of immunoreactivity in / mouse brain. d, Western blot analysis shows absence of immunoreactivity in / cortical neurons. e, Western blot analysis showing no significant difference of Homer1, Homer2, Homer3, NMDA receptor GluN1, GluA1 and GluA2/3 protein expression between 8 week old and / mouse brain. W: ; K: /.

12 Figure S6 a Duration of response (s) Grm5 / / MPEP Grm5 / / MPEP b Duration of response (s) Grm5 / / MPEP Grm5 / / MPEP * ** Time after formalin injection (min) min 10-60min Supplementary Figure 6: Grm5 / mice show reduced response to formalin induced inflammatory pain. a, b, Formalin induce inflammatory pain in Grm5 / mice. a, The duration of behavioral responses to hind paw formalin injection in 5 min intervals in Grm5 / mice and their littermates with or without MPEP (30mg/kg, i.p.) pre injection. b, Results from a grouped into two phases. *P < 0.05, **P < 0.01, n = 7 11 for each group.

13 Figure S7 a / 20 mv 20 ms 300 na b 10 / 8 Spike number Injected current (na) Supplementary Figure 7: Excitability of DRG neurons is not different between and / mice. The small diameter DRG neurons were cultured and injected with depolarizing currents stepwise from 100 to 900 na with 100 na interval. Each injected current lasted 200 ms and was separated by an interval of 4 s. The excitability was evaluated by the number of action potentials. and / DRG neurons do not show a significant difference of excitability. Eight neurons from 3 mice and 10 neurons from 3 / littermates were recorded.

14 Figure S8 a b Duration of response (s) Homer2 / Homer3 / 800 Homer2 / Homer3 / * * * * * Time after formalin injection (min) Duration of response (s) min ** 10-60min Duration of response (s) c 140 Grm5 120 R/R Time after formalin injection (min) * d Duration of response (s) Grm5 R/R 0-10min ** 10-60min Duration of response (s) e Homer1a / Time after formalin injection (min) Duration of response (s) f 400 * 350 Homer1a / min 10-60min

15 Supplementary Figure 8: Formalin induced inflammatory pain responses in Homer2 / Homer3 / mice, Grm5 R/R mice and Homer1a / mice. a, b, Formalin induce inflammatory pain is increased in Homer2 / Homer3 / mice. a, The duration of behavioral responses to hind paw formalin injection in 5 min intervals in Homer2 / Homer3 / mice and their controls. b, Results from a, grouped into two phases. *P < 0.05, **P < 0.01, n = 12 and 8 for and Homer2 / Homer3 / mice. c, d, Formalin induced inflammatory pain is increased in Grm5 R/R mice. c, The duration of behavioral responses to hind paw formalin injection in 5 min intervals in Grm5 R/R mice and their littermates. d, Results from c grouped into two phases. *P < 0.05, **P < 0.01, n = 8 for each group. e, f, Formalin induce inflammatory pain is reduced in Homer1a / mice. e, The duration of behavioral responses to hind paw formalin injection in 5 min intervals in Homer1a / mice and their littermates. f, Results from e, grouped into two phases. *P < 0.05, n = 9 for each group.

16 Figure S9 b c Lysate PI IP HA : F806R HA Homer1c: G89N W24A Homer3 Homer1c mglur1 IP 3 R IP: anti- Shank Homer1c Lysate PSD95 IP: anti Supplementary Figure 9: Full length western blot for Figure 1. Samples were loaded on a 4 12% gel and blotted for the antibodies indicated in the figure. Dotted lines indicated that the bands were used for inclusion in Figure 1.

17 Figure S10 Myc mglur5: F8 06 R Δ FL HA : Δ W W b PD Z Δ FE RM F8 06 R a Myc FERM: HA mglur5: F1128R mglur5 / co IP mglur5 / co IP mglur5 / Lysate mglur5 / Lysate / IP FERM / IP FERM / Lysate Myc : W T ~ Myc : 1~ W T ~ ~ W T HA mglur5: HA mglur5: FR e c IP: anti-myc IP: anti YV F YV / Lysate mglur5 / co IP mglur5 / Lysate mglur5 / co IP mglur5 / Lysate / IP / Lysate / IP / Lysate IP: anti Myc IP: anti Myc

18 Supplementary Figure 10: Full length western blot for Figure 2. Samples were loaded on a 4 12% gel and blotted for the antibodies indicated in the figure. Dotted lines indicated that the bands were used for inclusion in Figure 2.

19 Figure S11 a b Homer1c: mglur5: : Homer1c IP Lysate Lysate Homer1c IP Homer1c: mglur5: mglur5tsaa: FR: Lysate Homer1c IP Lysate mglur5 mglur5 ps mglur Homer1c Homer1c Supplementary Figure 11: Full length western blot for Figure 3. Samples were loaded on a 4 12% gel and blotted for the antibodies indicated in the figure. mglur5 dimers were used for mglur5 band quantification. Dotted lines indicated that the bands were used for inclusion in Figure 3.

20 Figure S12 a b c HA mglur5: HA CDK5/P35: HA MEK DD: mglur5 ps mglur mglur5 ps mglur Control UO126 Purvalanol A HA : HA CDK5: d CDK5 IP: anti Lysate HA : HA ERK1: MEK DD P35 CDK5 ERK1 e HA mglur5: HA : HA ERK1: mglur5 dimer mglur5 monomer ERK1 f Lysate PI IP CDK5 IP: anti Lysate g Lysate PI IP ERK1/2 IP: anti mglur5 Lysate IP: anti CDK5 IP: anti ERK Supplementary Figure 12: Full length western blot for Figure 4. Samples were loaded on a 4 12% gel and blotted for the antibodies indicated in the figure. mglur5 dimers were used for mglur5 band quantification. Dotted lines indicated that the bands were used for inclusion in Figure 4.

21 Figure S13 a Cx Sc c / / / / Ctl DH Ctl DH Ctl BD Ctl BD mglur5 / co IP mglur5 / co IP mglur5 / Lysate ps mglur ps mglur mglur5 / Lysate Actin / Lysate Homer / IP Homer / IP b / Lysate / ERK1/2 / co IP mglur5 / IP d mglur5 / Total mglur5 / Surface Actin / Total / / Ctl D5 Ctl D5 Ctl D30 Ctl D30 ERK1/2 / Lysate Actin / Surface mglur5 / Lysate

22 Supplementary Figure 13: Full length western blot for Figure 5. Samples were loaded on a 4 12% gel and blotted for the antibodies indicated in the figure. mglur5 dimers were used for mglur5 band quantification. Dotted lines indicated that the bands were used for inclusion in Figure 5.

SUPPLEMENTARY FIGURE LEGENDS

SUPPLEMENTARY FIGURE LEGENDS SUPPLEMETARY FIGURE LEGEDS Supplementary Fig. 1. Flow cytometric analysis of wildtype, mutant and chimeric protein surface expression. Cells transduced with the individual constructs indicated were stained

Läs mer

Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG

Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP

Läs mer

Personnummer. DUGGA Molekylärbiologi T3 / HT p (G = 24 p)

Personnummer. DUGGA Molekylärbiologi T3 / HT p (G = 24 p) KORTSVARSFRÅGOR 1. Restriktionsenzymet HindIII klyver sekvensen 5 -AAGCTT-3 och lämnar ett fyra basers 5 -överhäng. Rita ut hur DNA-ändarna ser ut på ett fragment som klyvts med HindIII. (2p) SV: 5 -A

Läs mer

DUGGA Molekylärbiologi T2 / VT p (G = 25 p)

DUGGA Molekylärbiologi T2 / VT p (G = 25 p) KORTSVARSFRÅGOR 1. Restriktionsenzymet BamHI klyver sekvensen 5 -G*GATCC-3 och lämnar 4 basers 5' överhäng. Rita upp det längsta DNA-fragmentet som bildas efter klyvning av nedanstående given sekvens med

Läs mer

Supplemental Figure S1.

Supplemental Figure S1. A 1 -----------------------------------MASKKMTKSYFDVLGICCTSEVPLIENILNSMDGVKEFSVIVPSRTVIVVHDTLILSQFQIVKALNQAQLEANVRVTG--ETNFK 1 -------------------------MALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLEANVRVNG--ETSFK

Läs mer

Supplementary Data. Figure S1: EIMS spectrum for (E)-1-(3-(3,7-dimethylocta-2,6-dienyl)-2,4,6-trihydroxyphenyl)butan-1-one (3d) 6'' 7'' 3' 2' 1' 6

Supplementary Data. Figure S1: EIMS spectrum for (E)-1-(3-(3,7-dimethylocta-2,6-dienyl)-2,4,6-trihydroxyphenyl)butan-1-one (3d) 6'' 7'' 3' 2' 1' 6 Supplementary Data H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S1: EIMS spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)-,,-trihydroxyphenyl)butan-1-one (d) H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S:

Läs mer

Supplemental Data. Antony et al. (2010). Plant Cell /tpc

Supplemental Data. Antony et al. (2010). Plant Cell /tpc Sb05g018110 MAG--LSLQHPMAFAFGLLGNIISFMTYLAPLYRPTFYRIYKSKSTQGFQSVPYVVALF 57 Zm100194326 MAG--LSLQHPMAFAFGLLGNIISFMTYLAPL--PTFCRIYRNKSTEGFQSVPYVVALF 55 Zm100192602 MAG--LSLLHPMAFAFGLLGNIISFMTYLAPL--PTFYRIYKNKSTEGFQSVPYVVALF

Läs mer

Supplemental Information. P-TEFb Activation by RBM7 Shapes a Pro-survival. Transcriptional Response to Genotoxic Stress

Supplemental Information. P-TEFb Activation by RBM7 Shapes a Pro-survival. Transcriptional Response to Genotoxic Stress Molecular Cell, Volume 74 Supplemental Information P-TEFb Activation by RBM7 Shapes a Pro-survival Transcriptional Response to Genotoxic Stress Andrii Bugai, Alexandre J.C. Quaresma, Caroline C. Friedel,

Läs mer

CUSTOMER READERSHIP HARRODS MAGAZINE CUSTOMER OVERVIEW. 63% of Harrods Magazine readers are mostly interested in reading about beauty

CUSTOMER READERSHIP HARRODS MAGAZINE CUSTOMER OVERVIEW. 63% of Harrods Magazine readers are mostly interested in reading about beauty 79% of the division trade is generated by Harrods Rewards customers 30% of our Beauty clients are millennials 42% of our trade comes from tax-free customers 73% of the department base is female Source:

Läs mer

Tentamen i Biomätteknik SVENSK VERSION. UPPGIFT 1 (10p)

Tentamen i Biomätteknik SVENSK VERSION. UPPGIFT 1 (10p) Tentamen i Biomätteknik 2013-10- 30 SVENSK VERSION UPPGIFT 1 (10p) I experimentet nedan har man undersökt om calmodulin binder till en del av estrogenreceptorn, vilket har betydelse för dess samband med

Läs mer

Isolda Purchase - EDI

Isolda Purchase - EDI Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language

Läs mer

Beijer Electronics AB 2000, MA00336A, 2000-12

Beijer Electronics AB 2000, MA00336A, 2000-12 Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this

Läs mer

Omtentamen Biomätteknik, TFKE augusti 2014

Omtentamen Biomätteknik, TFKE augusti 2014 Omtentamen Biomätteknik, TFKE37 29 augusti 2014 Kursansvarig: Professor Maria Sunnerhagen, Molekylär bioteknik, IFM Tillåtna hjälpmedel: linjal, räknedosa (krävs dock ej för tentan). Var noga med att förklara

Läs mer

Exempel på uppgifter från 2010, 2011 och 2012 års ämnesprov i matematik för årskurs 3. Engelsk version

Exempel på uppgifter från 2010, 2011 och 2012 års ämnesprov i matematik för årskurs 3. Engelsk version Exempel på uppgifter från 2010, 2011 och 2012 års ämnesprov i matematik för årskurs 3 Engelsk version 2 Innehåll Inledning... 5 Written methods... 7 Mental arithmetic, multiplication and division... 9

Läs mer

CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018

CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018 CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om

Läs mer

Bilaga 5 till rapport 1 (5)

Bilaga 5 till rapport 1 (5) Bilaga 5 till rapport 1 (5) EEG som stöd för diagnosen total hjärninfarkt hos barn yngre än två år en systematisk litteraturöversikt, rapport 290 (2018) Bilaga 5 Granskningsmallar Instruktion för granskning

Läs mer

for Selective Microtubule Polyglutamylation Juliette van Dijk, Krzysztof Rogowski, Julie Miro, Benjamin Lacroix, Bernard Eddé, and Carsten Janke

for Selective Microtubule Polyglutamylation Juliette van Dijk, Krzysztof Rogowski, Julie Miro, Benjamin Lacroix, Bernard Eddé, and Carsten Janke Molecular Cell, Volume 26 Supplemental Data A Targeted Multienzyme Mechanism for Selective Microtubule Polyglutamylation Juliette van Dijk, Krzysztof Rogowski, Julie Miro, Benjamin Lacroix, Bernard Eddé,

Läs mer

Table S1: Oligonucleotides and PCR primers used in this study.

Table S1: Oligonucleotides and PCR primers used in this study. Table S1: Oligonucleotides and PCR primers used in this study. Name 5-3 Sequence Description or Use Reference Strep B ACAAGCCCTGGAAACGGGGT 16S rdna PCR, [23] Strep F ACGTGTGCAGCCCAAGACA 16S rdna PCR, [23]

Läs mer

Session: Historieundervisning i högskolan

Session: Historieundervisning i högskolan Session: Historieundervisning i högskolan Ansvarig: David Ludvigsson, Uppsala universitet Kommentator: Henrik Ågren, Högskolan i Gävle Övriga medverkande: Lena Berggren, Umeå universitet Peter Ericsson,

Läs mer

Arctic. Design by Rolf Fransson

Arctic. Design by Rolf Fransson Arctic Design by Rolf Fransson 2 Endless possibilities of combinations. Oändliga kombinationsmöjligheter. 3 4 5 If you are looking for a range of storage furniture which limits of combination is set by

Läs mer

HT 2011. En farmakologs syn på. Biologisk variation. Orsaker & konsekvenser Läkemedelsanvändning. I Nylander. Medicin & Farmaci

HT 2011. En farmakologs syn på. Biologisk variation. Orsaker & konsekvenser Läkemedelsanvändning. I Nylander. Medicin & Farmaci HT 2011 En farmakologs syn på Biologisk variation Orsaker & konsekvenser Läkemedelsanvändning I Nylander Medicin & Farmaci Individrelaterade faktorer Vad händer i veckan? Introduktion Miljöns inverkan

Läs mer

Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:

Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller: Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock

Läs mer

Accomodations at Anfasteröd Gårdsvik, Ljungskile

Accomodations at Anfasteröd Gårdsvik, Ljungskile Accomodations at Anfasteröd Gårdsvik, Ljungskile Anfasteröd Gårdsvik is a campsite and resort, located right by the sea and at the edge of the forest, south west of Ljungskile. We offer many sorts of accommodations

Läs mer

A study of the performance

A study of the performance A study of the performance and utilization of the Swedish railway network Anders Lindfeldt Royal Institute of Technology 2011-02-03 Introduction The load on the railway network increases steadily, and

Läs mer

Lösningar till Tentamen i Reglerteknik AK EL1000/EL1100/EL

Lösningar till Tentamen i Reglerteknik AK EL1000/EL1100/EL Lösningar till Tentamen i Reglerteknik AK EL/EL/EL 9-6- a. Ansätt: G(s) = b s+a, b >, a >. Utsignalen ges av y(t) = G(iω) sin (ωt + arg G(iω)), ω = G(iω) = b ω + a = arg G(iω) = arg b arg (iω + a) = arctan

Läs mer

2.1 Installation of driver using Internet Installation of driver from disk... 3

2.1 Installation of driver using Internet Installation of driver from disk... 3 &RQWHQW,QQHKnOO 0DQXDOÃ(QJOLVKÃ'HPRGULYHU )RUHZRUG Ã,QWURGXFWLRQ Ã,QVWDOOÃDQGÃXSGDWHÃGULYHU 2.1 Installation of driver using Internet... 3 2.2 Installation of driver from disk... 3 Ã&RQQHFWLQJÃWKHÃWHUPLQDOÃWRÃWKHÃ3/&ÃV\VWHP

Läs mer

Mapping sequence reads & Calling variants

Mapping sequence reads & Calling variants Universitair Medisch Centrum Utrecht Mapping sequence reads & Calling variants Laurent Francioli 2014-10-28 l.francioli@umcutrecht.nl Next Generation Sequencing Data processing pipeline Mapping to reference

Läs mer

Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET

Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET National Swedish parental studies using the same methodology have been performed in 1980, 2000, 2006 and 2011 (current study). In 1980 and 2000 the studies

Läs mer

Country report: Sweden

Country report: Sweden Country report: Sweden Anneli Petersson, PhD. Swedish Gas Centre Sweden Statistics for 2006 1.2 TWh produced per year 223 plants 138 municipal sewage treatment plants 60 landfills 3 Industrial wastewater

Läs mer

A QUEST FOR MISSING PULSARS

A QUEST FOR MISSING PULSARS LOFAR A QUEST FOR MISSING PULSARS Samayra Straal Joeri v. Leeuwen WHAT ARE MISSING ~ half of PWN are associated with a pulsar (32/56) PULSARS? less than 25% of all SNRs are associated with a pulsar (60/294)

Läs mer

Examples on Analog Transmission

Examples on Analog Transmission Examples on Analog Transmission Figure 5.25 Types of analog-to-analog modulation Figure 5.26 Amplitude modulation Figure 5.29 Frequency modulation Modulation och demodulation Baudrate = antal symboler

Läs mer

The present situation on the application of ICT in precision agriculture in Sweden

The present situation on the application of ICT in precision agriculture in Sweden The present situation on the application of ICT in precision agriculture in Sweden Anna Rydberg & Johanna Olsson JTI Swedish Institute for Agricultural and Environmental Engineering Objective To investigate

Läs mer

KARL ANDERSSON & SÖNER

KARL ANDERSSON & SÖNER LOLLIPOP DESIGN MALIN LUNDMARK 2014 Malins inspiration till Lollipop kommer från det klassiska kaffefatet där bordet blir fatet till koppen. Lollipop bildar en yta för det lilla fikat eller används där

Läs mer

Chapter 2: Random Variables

Chapter 2: Random Variables Chapter 2: Random Variables Experiment: Procedure + Observations Observation is an outcome Assign a number to each outcome: Random variable 1 Three ways to get an rv: Random Variables The rv is the observation

Läs mer

Immunteknologi, en introduktion. Hur man använder antikroppar för att mäta eller detektera biologiska händelser.

Immunteknologi, en introduktion. Hur man använder antikroppar för att mäta eller detektera biologiska händelser. Immunteknologi, en introduktion Hur man använder antikroppar för att mäta eller detektera biologiska händelser. Antikroppar genereras av b-lymphocyter, som är en del av de vita blodkropparna Varje ursprunglig

Läs mer

Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00. English Version

Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00. English Version Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling

Läs mer

Chapter I. Identification and Sequence analysis of largest Subunit of Origin Recognition Complex, PfORC1

Chapter I. Identification and Sequence analysis of largest Subunit of Origin Recognition Complex, PfORC1 Chapter I Identification and Sequence analysis of largest Subunit of Origin Recognition Complex, PfORC1 Results: ChapterI 1.1 In siliico analysis of PfORC1 DNA replication is poorly understood in P. Jalciparum.

Läs mer

PRESS FÄLLKONSTRUKTION FOLDING INSTRUCTIONS

PRESS FÄLLKONSTRUKTION FOLDING INSTRUCTIONS PRESS FÄLLKONSTRUKTION FOLDING INSTRUCTIONS Vänd bordet upp och ner eller ställ det på långsidan. Tryck ner vid PRESS och fäll benen samtidigt. Om benen sitter i spänn tryck benen mot kortsidan före de

Läs mer

Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance?

Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance? r Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance? - A pilot study Susan Sarwari and Mohammed Fazil Supervisors: Camilla Ahlgren Department of

Läs mer

Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting

Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting Salil Chanroj a, Yongxian Lu a, Senthilkumar Padmanaban a, Kei Nanatani c, Nobuyuki

Läs mer

FIX LED-LYSRÖRSARMATUR MED AKRYLKÅPA IP44

FIX LED-LYSRÖRSARMATUR MED AKRYLKÅPA IP44 FIX LED-LYSRÖRSARMATUR MED AKRYLKÅPA IP44 N R 0 Med akrylkåpa FIX IP44 LED-LYSRÖRSARMATUR MED AKRYLKÅPA Armatur byggd och godkänd för LED-lysrör av T8-typ, 00 mm. Vårt T8 LED-lysrör har väsentligt längre

Läs mer

FIX LED-LYSRÖRSARMATUR MED AKRYLKÅPA IP44

FIX LED-LYSRÖRSARMATUR MED AKRYLKÅPA IP44 FIX LED-LYSRÖRSARMATUR MED AKRYLKÅPA IP44 N R 0 5 Med akrylkåpa LED-LYSRÖRSARMATUR MED AKRYLKÅPA Armatur byggd och godkänd för LED-lysrör av T8-typ, 00 mm. Vårt T8 LED-lysrör har väsentligt längre livstid

Läs mer

Strategy of TCR sequencing by 454

Strategy of TCR sequencing by 454 Strategy of TCR sequencing by 44 mrna --CCC XXXXX Universal Oligo Forward Primer (Universal Mix) Forward Primer RT st PCR Va/b ~4bp CDR3 N/nDn ~bp Ja/b ~6bp

Läs mer

Personnummer. DUGGA Molekylärbiologi T3 / HT p (G = 28 p)

Personnummer. DUGGA Molekylärbiologi T3 / HT p (G = 28 p) KORTSVARSFRÅGOR 1. Restriktionsenzymet KpnI klyver sekvensen 5 -GGTACC-3 och lämnar ett fyra basers 3 -överhäng. Enzymet BamHI klyver sekvensen 5 -GGATCC-3 och lämnar ett fyra basers 5 överhäng. Ange det

Läs mer

Read Texterna består av enkla dialoger mellan två personer A och B. Pedagogen bör presentera texten så att uttalet finns med under bearbetningen.

Read Texterna består av enkla dialoger mellan två personer A och B. Pedagogen bör presentera texten så att uttalet finns med under bearbetningen. ! Materialet vill ge en gemensam bas av användbara fraser för dialoger i klassrummet. skapa dialoger mellan elever på engelska. skapa tydliga roller för två personer, och. presentera meningsfulla fraser

Läs mer

Episerver Advance Introducing: Episerver Advance. Episerver

Episerver Advance Introducing: Episerver Advance. Episerver Advance Introducing: Advance 83% 83% 83% of marketers say creating personalized content is their biggest challenge - Rapt Media 83% 83% lower average response rates for marketing campaigns that lack relevant

Läs mer

ARC 32. Tvättställsblandare/Basin Mixer. inr.se

ARC 32. Tvättställsblandare/Basin Mixer. inr.se ARC 32 Tvättställsblandare/Basin Mixer inr.se SE Användning och skötsel Manualen är en del av produkten. Bevara den under hela produktens livscykel. Vi rekommenderar er att noggrant läsa igenom manualen

Läs mer

Från idé till läkemedel Synpunkter från akademi och läkemedelsindustri

Från idé till läkemedel Synpunkter från akademi och läkemedelsindustri Från idé till läkemedel Synpunkter från akademi och läkemedelsindustri Leg läkare 1971 Med dr 1974, docent 1975 Kliniskt verksam 1975-1986 invärtes medicin Verksam inom läkemedelsindustri sedan1986 18

Läs mer

BANNERS PÅ KINGSIZE.NO OCH KINGSIZEMAGAZINE.SE

BANNERS PÅ KINGSIZE.NO OCH KINGSIZEMAGAZINE.SE BANNERS PÅ KINGSIZE.NO OCH KINGSIZEMAGAZINE.SE ANNONSERA PÅ KINGSIZEMAGAZINE.SE OCH KINGSIZE.NO Kingsizemagazine.se och Kingsize.no är Skandinaviens största digitala urbana livsstils-sajter. Vi fokuserar

Läs mer

Discovery FSQ, IAA Utgåva/Edition 11. SE Habo. Klass 2 IAA FSQ-I 26W. 4 mm c c mm N L

Discovery FSQ, IAA Utgåva/Edition 11. SE Habo. Klass 2 IAA FSQ-I 26W. 4 mm c c mm N L Discovery FQ, IAA E - 566 80 Habo 3 4 4 mm c c mm 5 IAA Klass FQ-I 6W För armatur klass II,eller armatur för IAA/FQ-I 6W skall medföljande skyddsslang användas. For luminaire of Class II,or luminaire for

Läs mer

Sannolikhetsteori. Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik,

Sannolikhetsteori. Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik, Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik, 5p. Tid: Lördag den 29 mars, 2008 kl 14.00-18.00 i V-huset. Examinator: Olle Nerman, tel 7723565. Jour: Alexandra Jauhiainen,

Läs mer

Collaborative Product Development:

Collaborative Product Development: Collaborative Product Development: a Purchasing Strategy for Small Industrialized House-building Companies Opponent: Erik Sandberg, LiU Institutionen för ekonomisk och industriell utveckling Vad är egentligen

Läs mer

Windlass Control Panel v1.0.1

Windlass Control Panel v1.0.1 SIDE-POWER Windlass Systems 86-08950 Windlass Control Panel v1.0.1 EN Installation manual Behåll denna manual ombord! S Installations manual SLEIPNER AB Kilegatan 1 452 33 Strömstad Sverige Tel: +46 525

Läs mer

Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power Networks

Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power Networks DEGREE PROJECT IN ELECTRICAL ENGINEERING, SECOND CYCLE, 30 CREDITS STOCKHOLM, SWEDEN 2017 Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power

Läs mer

Utfärdad av Compiled by Tjst Dept. Telefon Telephone Datum Date Utg nr Edition No. Dokumentnummer Document No.

Utfärdad av Compiled by Tjst Dept. Telefon Telephone Datum Date Utg nr Edition No. Dokumentnummer Document No. Stämpel/Etikett Security stamp/lable RITNINGSKODER FR YTBEHANDLING OCH MÅLNING DRAWING CODES FOR SURFACE TREATMENT AND PAINTING Granskad av Reviewed by Ninl Tjst Dept. GUM2 tb_tvåspråkig 2006-05-09 1 (9)

Läs mer

Molecular marker application in breeding of self- and cross- compatible sweet cherry ( (P. P. avium L.) varieties. Silvija Ruisa, Irita Kota

Molecular marker application in breeding of self- and cross- compatible sweet cherry ( (P. P. avium L.) varieties. Silvija Ruisa, Irita Kota Molecular marker application in breeding of self- and cross- compatible sweet cherry ( (P. P. avium L.) varieties Gun rs L cis, Silvija Ruisa, Irita Kota Introduction Sweet cherry (Prunus avium L.) collection

Läs mer

Isometries of the plane

Isometries of the plane Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för

Läs mer

GOLD SD 50-80. Fläkt 2/ Fan 2. Fläkt 1/ Fan 1. Fläkt/ Fan. Utan filter/ Without filter. Fläkt 1/ Fan 1. Fläkt 2/ Fan 2. Med filter/ With filter Filter

GOLD SD 50-80. Fläkt 2/ Fan 2. Fläkt 1/ Fan 1. Fläkt/ Fan. Utan filter/ Without filter. Fläkt 1/ Fan 1. Fläkt 2/ Fan 2. Med filter/ With filter Filter SE/G.ELSD5080.0803 GOLD SD 50-80 Med styrenhet/with control unit Skiss visar styrenhet för aggregat med inspektionssida vänster, styrenhet för aggregat med inspektionssida höger ser något annorlunda ut,

Läs mer

Styrteknik: Binära tal, talsystem och koder D3:1

Styrteknik: Binära tal, talsystem och koder D3:1 Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder

Läs mer

Exempel på uppgifter från års ämnesprov i matematik för årskurs 3. Engelsk version

Exempel på uppgifter från års ämnesprov i matematik för årskurs 3. Engelsk version Exempel på uppgifter från 2010 2013 års ämnesprov i matematik för årskurs 3 Engelsk version Exempeluppgifter i årskurs 3, 2010, 2011 och 2012 1 Äp3Ma13 Part B 2 Innehåll Inledning... Fel! Bokmärket är

Läs mer

Role of interleukin-15 and interleukin-18 in the secretion of sil-6r and sgp130 by human neutrophils

Role of interleukin-15 and interleukin-18 in the secretion of sil-6r and sgp130 by human neutrophils Short Communication Mediators of Inflammation, 12(3), 179/183 (June 2003) BACKGROUND: Available data indicate that neutrophils (PMN) produce a wide range of cytokines with the potential to modulate immune

Läs mer

The reception Unit Adjunkten - for newly arrived pupils

The reception Unit Adjunkten - for newly arrived pupils The reception Unit Adjunkten - for newly arrived pupils Shortly on our work Number of received pupils: - 300 for school year 2014-2015 - 600 for school year 2015-2016 - 220 pupils aug-dec 2016 - ca. 45

Läs mer

8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.

8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers. MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:

Läs mer

Documentation SN 3102

Documentation SN 3102 This document has been created by AHDS History and is based on information supplied by the depositor /////////////////////////////////////////////////////////// THE EUROPEAN STATE FINANCE DATABASE (Director:

Läs mer

Measuring void content with GPR Current test with PaveScan and a comparison with traditional GPR systems. Martin Wiström, Ramboll RST

Measuring void content with GPR Current test with PaveScan and a comparison with traditional GPR systems. Martin Wiström, Ramboll RST Measuring void content with GPR Current test with PaveScan and a comparison with traditional GPR systems Martin Wiström, Ramboll RST Hålrum med GPR SBUF-projekt pågår för att utvärdera möjligheterna att

Läs mer

Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands

Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands Skill-mix innovation in the Netherlands dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands m.kroezen@erasmusmc.nl The skill-mix innovation of interest BEFORE AFTER How did the Netherlands

Läs mer

AbD Serotec Focus Immunohistokemi. Sydsvenska Immunogruppens möte, Malmlö 22/3 2007

AbD Serotec Focus Immunohistokemi. Sydsvenska Immunogruppens möte, Malmlö 22/3 2007 AbD Serotec Focus Immunohistokemi Sydsvenska Immunogruppens möte, Malmlö 22/3 2007 10 minuters presentation om ô Om oss ô CD3 ô CD19 ô Cd4 ô S-100 och ER-beta ô HISTAR Vilka är AbD Serotec? É Serotec É

Läs mer

Aktivitetsschemaläggning för flerkärninga processorer

Aktivitetsschemaläggning för flerkärninga processorer Lunds Tekniska Högskola Datorarkitekturer med Operativsystem EDT621 Aktivitetsschemaläggning för flerkärninga processorer Tobias Lilja 5 december 2016 Innehåll 1 Inledning 3 1.1 Syfte................................

Läs mer

Bridging the gap - state-of-the-art testing research, Explanea, and why you should care

Bridging the gap - state-of-the-art testing research, Explanea, and why you should care Bridging the gap - state-of-the-art testing research, Explanea, and why you should care Robert Feldt Blekinge Institute of Technology & Chalmers All animations have been excluded in this pdf version! onsdag

Läs mer

GOLD SD 80-2. Med styrenhet/with control unit. Fläkt 1A/B/ Fan 1A/B. Fläkt 2A/B/ Fan 2A/B. Fläkt/ Fan. Utan filter/ Without filter

GOLD SD 80-2. Med styrenhet/with control unit. Fläkt 1A/B/ Fan 1A/B. Fläkt 2A/B/ Fan 2A/B. Fläkt/ Fan. Utan filter/ Without filter SE/G.ELS80E.3095 GOL S 80- Med styrenhet/with control unit Skiss visar styrenhet för vänster, styrenhet för höger ser något annorlunda ut, men principen är lika./ The sketch shows control unit for HU with

Läs mer

Kursplan. NA1032 Makroekonomi, introduktion. 7,5 högskolepoäng, Grundnivå 1. Introductory Macroeconomics

Kursplan. NA1032 Makroekonomi, introduktion. 7,5 högskolepoäng, Grundnivå 1. Introductory Macroeconomics Kursplan NA1032 Makroekonomi, introduktion 7,5 högskolepoäng, Grundnivå 1 Introductory Macroeconomics 7.5 Higher Education Credits *), First Cycle Level 1 Mål Det övergripande målet med kursen är att studenterna

Läs mer

Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas

Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private

Läs mer

Alla Tiders Kalmar län, Create the good society in Kalmar county Contributions from the Heritage Sector and the Time Travel method

Alla Tiders Kalmar län, Create the good society in Kalmar county Contributions from the Heritage Sector and the Time Travel method Alla Tiders Kalmar län, Create the good society in Kalmar county Contributions from the Heritage Sector and the Time Travel method Goal Bring back the experiences from the international work of Kalmar

Läs mer

OBS! Under rubriken lärares namn på gröna omslaget ange istället skrivningsområde, ex allmän farmakologi. Totalt ska du använda två gröna omslag.

OBS! Under rubriken lärares namn på gröna omslaget ange istället skrivningsområde, ex allmän farmakologi. Totalt ska du använda två gröna omslag. Medicin C, Farmakologi Kurskod: MC1701 Kursansvarig: Mikael Ivarsson Datum: 2015 03 25 Skrivtid: 4 timmar Totalpoäng: 64.5 p Allmän farmakologi, 29.5 p Speciell farmakologi, 35 p OBS! Under rubriken lärares

Läs mer

Technique and expression 3: weave. 3.5 hp. Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2.

Technique and expression 3: weave. 3.5 hp. Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2. Technique and expression 3: weave 3.5 hp Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2 ExamCode: February 15 th 9-13 Means of assistance: Calculator, colorpencils,

Läs mer

EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09

EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09 EXTENAL ASSESSENT SAPLE TASKS SWEDISH BEAKTHOUGH LSPSWEB/0Y09 Asset Languages External Assessment Sample Tasks Breakthrough Stage Listening and eading Swedish Contents Page Introduction 2 Listening Sample

Läs mer

Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae

Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae S1 of S10 Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae Chenjing Shang, Pierre Rougé and Els J.M. Van Damme Type 1 RIPs 1. Malus domestica (MDP0000918923) MALSFSIKNATTTTYRTFIEALRAQLTAGGSTSHGIPVLRRRQDVKDDQRFVLVNLTNYDSYTITVA

Läs mer

Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!!

Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!! Exam Molecular Bioinformatics X (MB) - March, - Page of Skriv svar på varje uppgift på separata blad. Lycka till!! Write the answers to each of the questions on separate sheets of paper. ood luck!! ) Sequence

Läs mer

HYDRAULIK Rörströmning IV

HYDRAULIK Rörströmning IV HYDRAULIK Rörströmning IV Rolf Larsson, Tekn Vattenresurslära För VVR145, 31mars, 2014 NASA/ Astronaut Photography of Earth - Quick View 24 mar VVR015 Hydraulik/ Rörströmning IV 31 mar 2014 / 2 Innehåll

Läs mer

Utvärdering av IVIG behandling vid post-polio syndrom. Kristian Borg

Utvärdering av IVIG behandling vid post-polio syndrom. Kristian Borg Utvärdering av IVIG behandling vid post-polio syndrom Kristian Borg Div of Rehabilitation Medicine, Karolinska Institutet and Danderyd University Hospital Stockholm Sweden Pågående denervation som kompenseras

Läs mer

Webbregistrering pa kurs och termin

Webbregistrering pa kurs och termin Webbregistrering pa kurs och termin 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en länk till Studieöversiktssidan. På den sidan

Läs mer

Kombinerad träning kan muskeln bli snabb, stark och uthållig på samma gång?

Kombinerad träning kan muskeln bli snabb, stark och uthållig på samma gång? OMT/FYIM Kongress/Årsmöte 20-21 mars 2015 Kombinerad träning kan muskeln bli snabb, stark och uthållig på samma gång? Tommy Lundberg Karolinska Institutet Acknowledgements Inst. för hälsovetenskap, Mittuniversitetet

Läs mer

Typografi, text & designperspektiv

Typografi, text & designperspektiv Typografi, text & designperspektiv Serif Hårstreck Stapel Heplx x-höjd Baslinje Grundstreck Serif Underhäng Inre form I dag Lite bakgrund Övergripande grunder inom typografi Text hantering Elva Synlig

Läs mer

Datasäkerhet och integritet

Datasäkerhet och integritet Chapter 4 module A Networking Concepts OSI-modellen TCP/IP This module is a refresher on networking concepts, which are important in information security A Simple Home Network 2 Unshielded Twisted Pair

Läs mer

Cancersmärta ett folkhälsoproblem?

Cancersmärta ett folkhälsoproblem? Cancersmärta ett folkhälsoproblem? Åsa Assmundson Nordiska högskolan för folkhälsovetenskap Master of Public Health MPH 2005:31 Cancersmärta ett folkhälsoproblem? Nordiska högskolan för folkhälsovetenskap

Läs mer

Preschool Kindergarten

Preschool Kindergarten Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound

Läs mer

INVESTIGATION OF LAKE HÖRNTRÄSKET, LYCKSELE KOMMUN

INVESTIGATION OF LAKE HÖRNTRÄSKET, LYCKSELE KOMMUN 2005/01/20 INVESTIGATION OF LAKE HÖRNTRÄSKET, LYCKSELE KOMMUN Prepared by: Audrone Zaliauskiene Repport No 0501K50 Telefon: +46706441166 Passive water sampling using DGT Passive water sampling is a sampling

Läs mer

GOLD SD 14-40. Med styrenhet/with control unit. Fläkt/ Fan. Utan filter/ Without filter. Fläkt/Fan. Fläkt/ Fan. Med filter/ With filter.

GOLD SD 14-40. Med styrenhet/with control unit. Fläkt/ Fan. Utan filter/ Without filter. Fläkt/Fan. Fläkt/ Fan. Med filter/ With filter. GOLD SD 4-40 Med styrenhet/with control unit Skiss visar styrenhet för aggregat med inspektionssida vänster, styrenhet för aggregat med inspektionssida höger ser något annorlunda ut, men principen är lika./

Läs mer

Rev No. Magnetic gripper 3

Rev No. Magnetic gripper 3 Magnetic gripper 1 Magnetic gripper 2 Magnetic gripper 3 Magnetic gripper 4 Pneumatic switchable permanent magnet. A customized gripper designed to handle large objects in/out of press break/laser cutting

Läs mer

KARL ANDERSSON & SÖNER LOLLIPOP DESIGN MALIN LUNDMARK 2014

KARL ANDERSSON & SÖNER LOLLIPOP DESIGN MALIN LUNDMARK 2014 KARL ANDERSSON & SÖNER LOLLIPOP DESIGN MALIN LUNDMARK 2014 Malins inspiration till Lollipop kommer från det klassiska kaffefatet där bordet blir fatet till koppen. Lollipop bildar en yta för det lilla

Läs mer

Anvisning för Guide for

Anvisning för Guide for Anvisning för Guide for PRISMA SENSOR 1 96243235zPC Montering i tak/installation in the ceiling Byte av kupa/change of diffuser 2 Installation Installation från gavel / Installation from the end Installationskabel

Läs mer

Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm

Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering

Läs mer

Moult migration of Latvian Whooper Swans Cygnus cygnus

Moult migration of Latvian Whooper Swans Cygnus cygnus Ornis Fennica 89:273 280. 2012 Brief report Moult migration of Latvian Whooper Swans Cygnus cygnus 1. Introduction ð ð 274 ORNIS FENNICA Vol. 89, 2012 Table 1. Known moulting sites of Whooper Swan cygnets

Läs mer

Workplan Food. Spring term 2016 Year 7. Name:

Workplan Food. Spring term 2016 Year 7. Name: Workplan Food Spring term 2016 Year 7 Name: During the time we work with this workplan you will also be getting some tests in English. You cannot practice for these tests. Compulsory o Read My Canadian

Läs mer

IE1206 Embedded Electronics

IE1206 Embedded Electronics E1206 Embedded Electronics Le1 Le3 Le4 Le2 Ex1 Ex2 PC-block Documentation, Seriecom, Pulse sensor,, R, P, series and parallel KC1 LAB1 Pulse sensors, Menu program Start of program task Kirchhoffs laws

Läs mer

Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version

Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and

Läs mer

D-RAIL AB. All Rights Reserved.

D-RAIL AB. All Rights Reserved. 2 3 4 5 6 Photo: Svante Fält 7 8 9 ägare ägare /förvaltare huvudman mätning operatör DATA underhållare underhållare 9 The hardware 10 SENSORS: Cutting edge technology designed for minimum maintenance and

Läs mer

Scratch Junior. makeandshape.com. by MIT. Gränssnitt Scratch Junior

Scratch Junior. makeandshape.com. by MIT. Gränssnitt Scratch Junior Scratch Junior by MIT Gränssnitt Scratch Junior 1. Spara 2. Scen 3. Presentationsläge (fullskärm) 4. Rutnät 5. Byt bakgrund 6. Lägg till text 7. Återställ figur (till sin ursprungliga position) 8. Grön

Läs mer

MAP Modified Atmosphere Packaging CA Controlled Atmosphere + .* +0 +* +1. MA Modified Atmosphere MA MA

MAP Modified Atmosphere Packaging CA Controlled Atmosphere + .* +0 +* +1. MA Modified Atmosphere MA MA 271 MA MA + + +, + : 20-., : /1+. - : --./ 33. 2 + a, MAP Modified Atmosphere Packaging CA Controlled Atmosphere + b + c.* +0 +* +1 +,//*,*** t +,.1-,*** t +, - MA Modified Atmosphere -*/ 20.,, + +, Email

Läs mer

Parking garage, Gamletull. MDM-piles, pre-installation testing RÄTT FRÅN GRUNDEN!

Parking garage, Gamletull. MDM-piles, pre-installation testing RÄTT FRÅN GRUNDEN! Parking garage, Gamletull MDM-piles, pre-installation testing Gamletull, MDM-pålar 1 CPT tests Gamletull, MDM-pålar 2 CPT test results Cone resistance Undrained shear strength Gamletull, MDM-pålar 3 Interpretation

Läs mer