Hidden Markov Models and other Multiple-sequence Profile approaches
|
|
- Lars-Göran Forsberg
- för 5 år sedan
- Visningar:
Transkript
1 Hidden Markov Models and other Multiple-sequence Profile approaches Mount, Chapter 4, pp Durbin et al, Chapter 5 (also earlier chapters) taken from Sean Eddy Dept. of Genetics Washington U., St. Louis HMMs, PSSMs, Motifs, and consensus representing conserved positions HMMs (Hidden Markov Models), PSSMs (Position Specific Scoring Matrices), BLOCKS and Profiles seek to effectively represent conserved positions in homologous sequences. Functional conservation after divergence Some (but not all) motifs and consensus sequences represent conserved positions in non-homologous sequences (promoters, modification sites, regulatory sites). Functional acquisition by convergence. 1
2 The best scores are: s-w bits E(14548) % id alen PWHU6 H+-trans. ATP syn. - human mito e PWBO6 H+-trans. ATP syn. - cow mito e PWMS6 H+-trans. ATP syn. - mouse mito e PWXL6 H+-trans. ATP syn. - frog mito e PWFF6 H+-trans. ATP syn. - D. melanog e PWBY3 H+-trans. ATP syn. - yeast mito e PWAS6N H+-trans. ATP syn. - E. nidulans e PWKQ6 H+-trans. ATP syn. - H. maydis e PWWT6 H+-trans. ATP syn. - wheat mito e PWNT6M H+-trans. ATP syn. - tobacco e PWZM6M H+-trans. ATP syn. - corn mito e LWEC6 H+-trans. ATP syn. - E. coli e LWRZ6 H+-trans. ATP syn. - rice chloro PWPMA6 H+-trans. ATP syn. - pea chloro PWYBAA H+-trans. ATP syn. - Cyano. syn PWSPA6 H+-trans. ATP syn. - spinach PWYCA6 H+-trans. ATP syn. - Synecho LWNT6 H+-trans. ATP syn. - tobacco LWLV6 H+-trans. ATP syn. - liverwort PWEGAC H+-trans. ATP syn. - euglena JQ0026 ATP/ADP translocase tlc1 - Ricket S17420 ubiquinol--cytochrome-c reductase QXBO2M NADH dehydrogenase (ubiquinone) S17415 ubiquinol--cytochrome-c reductase S17417 ubiquinol--cytochrome-c reductase DNHUN2 NADH dehydrogenase (ubiquinone) CBHU ubiquinol--cytochrome-c reductase QRECAA aromatic amino acid trans. prot S17419 ubiquinol--cytochrome-c reductase Human mito Bovine mito Mouse mito Frog mito Dros. mito / / / / /0.003 Yeast mito /10-8 Cochliobolus mito /10-5 Aspergillus mito /10-6 Rice chloro. Tobacco chloro. Spinach chloro. Pea chloro. March. chloro. Cyanobacteria Synechocystis Euglena chloro. E. coli Corn mito /10-9 Wheat mito / / / / / / / / / /
3 sxl_drome (1sxl) PSI-Blast E() iteration 1: <7 iteration 2: 10-8 ru1a_human (u1a) SXL_DROME/ LIVNYL----PQDMTDRELYALFRA-IGPINTCRIMRD----YKTGYSFGYAFVDFTSEMDSQRAIKVLNG-ITVRNKRLKV U2AF_HUMAN/ LFIGGL----PNYLNDDQVKELLTS-FGPLKAFNLVKD----SATGLSKGYAFCEYVDINVTDQAIAGLNG-MQLGDKKLLV U2AF_SCHPO/ IYISNL----PLNLGEDQVVELLKP-FGDLLSFQLIKN----IADGSSKGFCFCEFKNPSDAEVAISGLDG-KDTYGNKLHA SXLF_DROME/ LYVTNL----PRTITDDQLDTIFGK-YGSIVQKNILRD----KLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLS ROC_HUMAN/18-82 VFIGNL---NTLVVKKSDVEAIFSK-YGKIVGCSVHK GFAFVQYVNERNARAAVAGEDG-RMIAGQVLDI RU1A_HUMAN/12-84 IYINNLNEKIKKDELKKSLYAIFSQ-FGQILDILVSR SLKMRGQAFVIFKEVSSATNALRSMQG-FPFYDKPMRI RU2B_HUMAN/9-81 IYINNMNDKIKKEELKRSLYALFSQ-FGHVVDIVALK TMKMRGQAFVIFKELGSSTNALRQLQG-FPFYGKPMRI SQD_DROME/ IFVGGL----TTEISDEEIKTYFGQ-FGNIVEVEMPLD----KQKSQRKGFCFITFDSEQVVTDLLK-TPK-QKIAGKEVDV SQD_DROME/ LFVGGL----SWETTEKELRDHFGK-YGEIESINVKTD----PQTGRSRGFAFIVFTNTEAIDKVSA-ADE-HIINSKKVDP SFR2_CHICK/16-87 LKVDNL----TYRTSPDTLRRVFEK-YGRVGDVYIPRD----RYTKESRGFAFVRFHDKRDAEDAMDAMDG-AVLDGRELRV SFR1_HUMAN/17-85 IYVGNL----PPDIRTKDIEDVFYK-YGAIRDIDLKNR RGGPPFAFVEFEDPRDAEDAVYGRDG-YDYDGYRLRV SR55_DROME/5-68 VYVGGL----PYGVRERDLERFFKG-YGRTRDILIKN GYGFVEFEDYRDADDAVYELNG-KELLGERVVV SFR3_HUMAN/12-78 VYVGNL----GNNGNKTELERAFGY-YGPLRSVWVARN PPGFAFVEFEDPRDAADAVRELDG-RTLCGCRVRV RNP1_YEAST/ LYVGNL----PKNCRKQDLRDLFEPNYGKITINMLKKK----PLKKPLKRFAFIEFQEGVNLKKVKEKMNG-KIFMNEKIVI PES4_YEAST/ IFIKNL----PTITTRDDILNFFSE-VGPIKSIYLSN------ATKVKYLWAFVTYKNSSDSEKAIKRYNN-FYFRGKKLLV YHH5_YEAST/ ILVKNL----PSDTTQEEVLDYFST-IGPIKSVFISEK------QANTPHKAFVTYKNEEESKKAQKCLNK-TIFKNHTIWV YHC4_YEAST/34815 IFVGQL----DKETTREELNRRFST-HGKIQDINLIFK PTNIFAFIKYETEEAAAAALESENH-AIFLNKTMHV SFR1_HUMAN/ VVVSGL----PPSGSWQDLKDHMRE-AGDVCYADVYRD GTGVVEFVRKEDMTYAVRKLDN-TKFRSHEGET RU1A_HUMAN/ LFLTNL----PEETNELMLSMLFNQ-FPGFKEVRLVPG RHDIAFVEFDNEVQAGAARDALQG-FKITQNNAMK RU2B_HUMAN/ LFLNNL----PEETNEMMLSMLFNQ-FPGFKEVRLVPG RHDIAFVEFENDGQAGAARDALQGFKITPSHAMKI RU1A_YEAST/ LLIQNL----PSGTTEQLLSQILGN-EALV-EIRLVSV RNLAFVEYETVADATKIKNQLGS-TYKLQNNDVT PR24_YEAST/ VLVKNL----PKSYNQNKVYKYFKH-CGPIIHVDVAD------SLKKNFRFARIEFARYDGALAAIT-KTH-KVVGQNEIIV PR24_YEAST/ IMIRNL---STELLDENLLRESFEG-FGSIEKINIPAG---QKEHSFNNCCAFMVFENKDSAERALQ-MNR-SLLGNREISV SSB1_YEAST/ IFIGNV----AHECTEDDLKQLFVEEFGDEVSVEIPIK-EHTDGHIPASKHALVKFPTKIDFDNIKENYDT-KVVKDREIHI RN12_YEAST/ IVIKFQ----GPALTEEEIYSLFRR-YGTI--IDIFP------PTAANNNVAKVRYRSFRGAISAKNCVSG-IEIHNTVLHI U2AG_HUMAN/ CAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDN-----LGDHLVGNVYVKFRREEDAEKAVIDLNN-RWFNGQPIHA LA_DROME/ AYAKGF----PLDSQISELLDFTAN-YDKVVNLTMRNSYDKPTKSYKFKGSIFLTFETKDQAKAFLE-QEK-IVYKERELLR LA_HUMAN/ VYIKGF----PTDATLDDIKEWLED-KGQVLNIQMRR-----TLHKAFKGSIFVVFDSIESAKKFVE-TPG-QKYKETDLLI 3
4 Alignments show conservation Profiles Profiles invented in the late eighties Barton and Sternberg Gribskov Taylor Uses a multiple alignment and rules to convert frequencies to scores 4
5 Profiles the problems Could not compare between two profiles user had to be involved in interpretation Gap penalties again the user had to be involved HMMs Hidden Markov Models have been successfully used for speech recognition passive sonar work other signal detection problems 5
6 profile-hmms Anders Krogh in David Haussler s group. Takes the standard profiles and uses HMM based standard mathematics to solve two problems Profile-HMM scores are comparable (*) Setting gap costs Theoretical framework for what we are doing. (* this is not really true. see later) Pairwise Alignment RU1A_HUMAN rrm2 PABP_DROME rrm3 VQAGAAR EAAEAAV score matrices: 20x20, 210 parameters positionindependent Cys 12 Ser 0 2 Thr Pro Ala Gly Asn Asp Glu Gln C S T P A G N D E Q 6
7 Profile Alignment RU1A_HUMAN rrm1 RU1A_HUMAN rrm2 SFR1_HUMAN rrm1 SXLF_DROME rrm1 PABP_DROME rrm3 SSATNAL VQAGAAR RDAEDAV MDSQRAI EAAEAAV query target profile: 20 scores per column position-dependent Where pairwise scores come from score(aa)=log P(A A) f(a) probability of A given an A the observed probability of seeing an A aligned to an A in real alignments frequency of A the expected frequency of A in any sequence Sc(AA) = log = +4 2 Sc(AE) = log =
8 Where profile scores (should) come from score(a x)=log P(A position x) f(a) probability of A at position x the observed probability of seeing an A in the consensus column x Sc(A 6) = log = +4.6 Sc(A 5) = log = 0 2 Sc(N 6) = log = -inf Sc(N 5) = log = what about position-specific gap penalties? 2. how to estimate parameters from small numbers of observations? Hidden Markov Models (HMMs) t 1,1 t 2,2 t 1,2 t 2,end 1 2 end HMM p 1 (a) p 1 (b) p 2 (a) p 2 (b) end hidden state sequence, π a b a observed symbol sequence, x t 1,1 t 1,2 t 2,end p 1 (a) p 1 (b) p 2 (a) = P(x,π HMM) 8
9 Figure 1 A simple hidden Markov model. A two-state HMM describing DNA sequence with a heterogeneous base composition is shown, following work by Churchill [10]. (a) State 1 (top left) generates AT-rich sequence, and state 2 (top right) generates CG-rich sequence. State transitions and their associated probabilities are indicated by arrows, and symbol emission probabilities for A,C,G and T for each state are indicated below the states. (For clarity, the begin and end states and associated state transitions necessary to model sequences of finite length have been omitted.) (b) This model generates a state sequence as a Markov chain and each state generates a symbol according to its own emission probability distribution (c). The probability of the sequence is the product of the state transitions and the symbol emissions. For a given observed DNA sequence, we are interested in inferring the hidden state sequence that 'generated' it, that is, whether this position is in a CG-rich segment or an AT-rich segment. Profile (protein family) HMMs C X FY i0 i1 i2 i C C C C C A G D V K F W Y F Y B X X X X M1 M2 M3 d1 d2 d3 E 9
10 HMM transitions and emissions are probabilities a - c g a - t a a - c c a t t t a - c a 1.0 c 0.0 g 0.0 t 0.0 a 0.0 c 0.4 g 0.0 t 0.6 a.25 c.25 g.25 t.25 Figure 2 An HMM-based profile. An example of an HMM-based profile of three positions is shown, following the model introduced by Krogh et al. [7 ]. Each important column of a multiple sequence alignment (top) is modeled by a triplet of states: match (M), insert (I), and delete (D). For each modeled column of the alignment, there are 49 parameters: nine state transition probabilities (arrows), 20 match state symbol emission probabilities (corresponding to the bracketed amino acid residues [single letter code]), and 20 insert state symbol emission probabilities (usually not learned from the alignment, but instead kept fixed at some background distribution). For the sake of clarity in this example, all the insert symbol emissions are shown set equally to 0.05, underlining the point that the inserts generate essentially 'random' residue sequence. The state transition probabilities will generally tend to favor a 'main line' through the match states (bold arrows) over the rarer paths containing insertions and deletions (dashed arrows). 10
11 HMMER- Plan 7 profile HMM S N B I1 I2 I3 M1 M3 M3 M4 D1 D2 D3 D4 E C T J Many approaches are HMM-based (or HMM-like) BLOCKS PSI-Blast Meta-MEME Profile HMM Pfam HMMER2 - Plan 7 11
12 HMM Algorithms 1. The scoring problem: P(seq model) "Forward" algorithm (sums over all alignments) 2. The alignment problem: max P(seq, statepath model) "Viterbi" algorithm 3. The training problem: "Forward-backward" algorithm and Baum-Welch expectation maximization For profile HMMs, all three algorithms use O(MN) dynamic programming -- same as "standard" Smith/Waterman and Needleman/Wunsch. Global Global and Local Alignment Paths A B D D E F G H I A \ \ \ \ \ \ \ \ \ 1 _ B \! \ \ \ \ \ \ \ -1 2 _ 0 _ D \! \ \ \ \ \ \ _ 1 _-1 _ E \ \!! \ \ \ \ _ 0 _-2 _ G \ \! \! \ \ \ _-1 _-3 K \ \ \! \! \! \ \ \ \ _-2 H \ \ \ \! \! \! \ \ \ _-1 I \ \ \ \ \! \! \!! \ Local A B D D E F G H I A \ B \ 0 2 _ D! \ \ _ E! \ \ _ G \! \ \ \ K \ \ \ H \ I \ Optimum global alignment ( score: 2) A B D D E F G H I (top) A B D - E G K H I (side) or A B - D E G K H I Optimal local alignment (score 3): A B D (top) A B D (side) 12
13 +1 : match 1 : mis-match 2 : gap A C G T A C G G T
14 Algorithms for Global and Local Similarity Scores Global: Local: HMM Alignment a t a 24 a s a Needleman-Wunsch max log likelihood HMM Viterbi alignment a a M I 20 D F M j (i) = log e M j (x i ) + log[a M q j 1 M j exp(f M j 1 (i 1)) xi I +a I j 1 M j exp(f j 1 (i 1)) + a D j 1 M j exp(f D j 1 (i 1))] HMM Forward (score) Σ probabilities 13
15 HMMER usage 4 hmmalign Alignment 1 hmmbuild hmmcalibrate Matches HMM 3 extractp.pl/ CHAPS OUTPUT 2 hmmsearch 1. Building HMMER models Can use HMMER as a black box! Usage: hmmbuild <hmm> <align> Usage: hmmcalibrate <hmm> 14
16 1. Global and Local models HMMER provides two main styles of model ls - Match whole model within sequence Most sensitive mode. Good for whole domains Default mode fs - Match part of model to part of sequence Good when you don t know domain structure ls mode HMM fs mode HMM Sequence 2. HMMER searches Search protein database Usage: hmmsearch <hmm> <database> Option -A Use to limit size of output Option -E Raise to get more distant matches Will take > 20 minutes Specialized hardware exists (TimeLogic, Paracel, Compugen) 15
17 Domains and Repeats A - Domain B - Metal stabilised domain C - 7 repeats form domain D - 9 repeats form domain could be unlimited number 3. Choosing a threshold HMMER has two types of threshold: per-sequence per-domain Per-domain per-sequence scores score 22 16
18 3. HMMER output Header information hmmsearch - search a sequence database with a profile HMM HMMER (May 1999) Copyright (C) Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL) HMM file: /nfs/somewhere/cbs/hmm [SEED] Sequence database: /nfs/somewhere/pfamseq per-sequence score cutoff: [none] per-domain score cutoff: [none] per-sequence Eval cutoff: 1e+03 per-domain Eval cutoff: [none] Query HMM: SEED [HMM has been calibrated; E-values are empirical estimates] 3. HMMER output Per-sequence scores Scores for complete sequences (score includes all domains): Sequence Description Score E-value N YC25_METJA Q58622 HYPOTHETICAL PROTEIN MJ e-58 4 O27291 O27291 INOSINE-5'-MONOPHOSPHATE DEHYDROGEN e-55 4 O27292 O27292 INOSINE-5'-MONOPHOSPHATE DEHYDROGEN e-53 4 Q9YDY4 Q9YDY4 HYPOTHETICAL 70.0 KDA PROTEIN APE e-51 7 O29410 O29410 CONSERVED HYPOTHETICAL PROTEIN e-51 4 YE04_METJA Q58799 HYPOTHETICAL PROTEIN MJ e9 4 AAKG_HUMAN P '-AMP-ACTIVATED PROTEIN KINASE, GA e9 4 YR33_THEPE P15889 HYPOTHETICAL 33.4 KDA PROTEIN IN RI e9 4 AAKG_RAT P '-AMP-ACTIVATED PROTEIN KINASE, GA e7 4 Q9V1T3 Q9V1T3 HYPOTHETICAL 32.1 KDA PROTEIN e6 4 Q9YFL7 Q9YFL7 HYPOTHETICAL 31.7 KDA PROTEIN APE e6 4 17
19 3. HMMER output Per-domain scores Parsed for domains: Sequence Domain seq-f seq-t hmm-f hmm-t score E-value O / [] e-17 O / [] e-17 Q9X0M4 2/ [] e-16 YE26_METJA 2/ ] 1 54 [] e-16 Q9X175 2/ [] e-16 Q9UY49 2/ [] e-16 IMDH_PYRFU 2/ [] e-16 P / [] e-16 IMDH_METKA 2/ [] e-15 IMDH_PYRHO 2/ [] e-15 YC32_METJA 2/ [] e-15 O / [] e-15 O / [] e-15 IMDH_AQUAE 1/ [] e-15 ACUB_BACSU 1/ [] e-15 O / [] e-15 Q9UYR4 3/ [] e Making an alignment HMMER can be used to align all the matches Usage: hmmalign <hmm> <sequences> Much faster compared to other methods 18
20 Profile-HMM alignments It is hard to manually align a large number of sequences ( ) Solution (The Pfam way): Build a good quality manual alignment of representative members Build profile-hmm Align all members automatically Pitfalls of HMMER More complex to run than PSI-BLAST, you must iterate yourself Slow compared to PSI-BLAST 19
21 Pitfalls of all profile methods Iterative scoring schemes Once a false positive is included all its friends come too! Limit to modeling For large families some members will be missed Profile wander Matches from earlier rounds can be lost Multiple Sequence/Profile/HMMs Identify larger fraction of protein family with 1 sequence (model) Position-specific gap penalties better alignments Rigorous statistical/ mathematical model fast/automatic (in PSI- Blast) Many parameters to estimate (100+ sequences preferred) Poor multiple alignments Accurate statistical estimates? Misled by nonhomologs 20
22 Conclusions Profile-HMMs formalise profile technology There are four steps in HMMER use build model search database choose threshold build alignment Learning more HMMs HMMER Includes links to documentation and other software packages. The HMMER User's Guide (and tutorial) "Profile hidden Markov models" S.R. Eddy, Bioinformatics 14: , "Multiple-alignment and -sequence searches" S.R. Eddy, Trends Guide to Bioinformatics, pp.15-18, Biological Sequence Analysis: Probabilistic Models of Proteins and Nucleic Acids Durbin, Eddy, Krogh, and Mitchison; Cambridge Univ. Press,
Biochemistry 201 Advanced Molecular Biology (
Biochemistry 201 Advanced Molecular Biology (http://cmgm cmgm.stanford.edu/biochem201/) Bioinformatics: Discovering Function from Sequence Doug Brutlag Departments of Biochemistry June 4, 1999 Discovering
Support Manual HoistLocatel Electronic Locks
Support Manual HoistLocatel Electronic Locks 1. S70, Create a Terminating Card for Cards Terminating Card 2. Select the card you want to block, look among Card No. Then click on the single arrow pointing
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!!
Exam Molecular Bioinformatics X (MB) - March, - Page of Skriv svar på varje uppgift på separata blad. Lycka till!! Write the answers to each of the questions on separate sheets of paper. ood luck!! ) Sequence
Hur fattar samhället beslut när forskarna är oeniga?
Hur fattar samhället beslut när forskarna är oeniga? Martin Peterson m.peterson@tue.nl www.martinpeterson.org Oenighet om vad? 1.Hårda vetenskapliga fakta? ( X observerades vid tid t ) 1.Den vetenskapliga
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
F ξ (x) = f(y, x)dydx = 1. We say that a random variable ξ has a distribution F (x), if. F (x) =
Problems for the Basic Course in Probability (Fall 00) Discrete Probability. Die A has 4 red and white faces, whereas die B has red and 4 white faces. A fair coin is flipped once. If it lands on heads,
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
Mapping sequence reads & Calling variants
Universitair Medisch Centrum Utrecht Mapping sequence reads & Calling variants Laurent Francioli 2014-10-28 l.francioli@umcutrecht.nl Next Generation Sequencing Data processing pipeline Mapping to reference
CUSTOMER READERSHIP HARRODS MAGAZINE CUSTOMER OVERVIEW. 63% of Harrods Magazine readers are mostly interested in reading about beauty
79% of the division trade is generated by Harrods Rewards customers 30% of our Beauty clients are millennials 42% of our trade comes from tax-free customers 73% of the department base is female Source:
1. Unpack content of zip-file to temporary folder and double click Setup
Instruktioner Dokumentnummer/Document Number Titel/Title Sida/Page 13626-1 BM800 Data Interface - Installation Instructions 1/8 Utfärdare/Originator Godkänd av/approved by Gäller från/effective date Mats
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
EXPERT SURVEY OF THE NEWS MEDIA
EXPERT SURVEY OF THE NEWS MEDIA THE SHORENSTEIN CENTER ON THE PRESS, POLITICS & PUBLIC POLICY JOHN F. KENNEDY SCHOOL OF GOVERNMENT, HARVARD UNIVERSITY, CAMBRIDGE, MA 0238 PIPPA_NORRIS@HARVARD.EDU. FAX:
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Schenker Privpak AB Telefon VAT Nr. SE Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr Säte: Borås
Schenker Privpak AB Interface documentation for web service packageservices.asmx 2012-09-01 Version: 1.0.0 Doc. no.: I04304b Sida 2 av 7 Revision history Datum Version Sign. Kommentar 2012-09-01 1.0.0
Stad + Data = Makt. Kart/GIS-dag SamGIS Skåne 6 december 2017
Smart@Helsingborg Stadsledningsförvaltningen Digitaliseringsavdelningen the World s most engaged citizens Stad + Data = Makt Kart/GIS-dag SamGIS Skåne 6 december 2017 Photo: Andreas Fernbrant Urbanisering
Authentication Context QC Statement. Stefan Santesson, 3xA Security AB stefan@aaa-sec.com
Authentication Context QC Statement Stefan Santesson, 3xA Security AB stefan@aaa-sec.com The use case and problem User identities and user authentication is managed through SAML assertions. Some applications
Webbregistrering pa kurs och termin
Webbregistrering pa kurs och termin 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en länk till Studieöversiktssidan. På den sidan
Sannolikhetsteori. Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik,
Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik, 5p. Tid: Lördag den 29 mars, 2008 kl 14.00-18.00 i V-huset. Examinator: Olle Nerman, tel 7723565. Jour: Alexandra Jauhiainen,
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM
Rastercell Digital Rastrering Hybridraster, Rastervinkel, Rotation av digitala bilder, AM/FM rastrering Sasan Gooran (VT 2007) Önskat mått * 2* rastertätheten = inläsningsupplösning originalets mått 2
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
This exam consists of four problems. The maximum sum of points is 20. The marks 3, 4 and 5 require a minimum
Examiner Linus Carlsson 016-01-07 3 hours In English Exam (TEN) Probability theory and statistical inference MAA137 Aids: Collection of Formulas, Concepts and Tables Pocket calculator This exam consists
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, EITA50, LP4, 209 Inlämningsuppgift av 2, Assignment out of 2 Inlämningstid: Lämnas in senast kl
Consumer attitudes regarding durability and labelling
Consumer attitudes regarding durability and labelling 27 april 2017 Gardemoen Louise Ungerth Konsumentföreningen Stockholm/ The Stockholm Consumer Cooperative Society louise.u@konsumentforeningenstockholm.se
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Hidden Markov Model. Definition: V, X,{T k },π. hidden Markov model. X is an output alphabet. V is a finite set of states
Hidden Markov Model Definition: hidden Markov model V, X,{T k },π X is an output alphabet V is a finite set of states {T k }={T k k X} are transition matrices T k is an V V matrix, T k j [,], j,k Tk j
Mönster. Ulf Cederling Växjö University Ulf.Cederling@msi.vxu.se http://www.msi.vxu.se/~ulfce. Slide 1
Mönster Ulf Cederling Växjö University UlfCederling@msivxuse http://wwwmsivxuse/~ulfce Slide 1 Beskrivningsmall Beskrivningsmallen är inspirerad av den som användes på AG Communication Systems (AGCS) Linda
Theory 1. Summer Term 2010
Theory 1 Summer Term 2010 Robert Elsässer 1 Introduction Summer Term 2010 Robert Elsässer Prerequisite of Theory I Programming language, such as C++ Basic knowledge on data structures and algorithms, mathematics
EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09
EXTENAL ASSESSENT SAPLE TASKS SWEDISH BEAKTHOUGH LSPSWEB/0Y09 Asset Languages External Assessment Sample Tasks Breakthrough Stage Listening and eading Swedish Contents Page Introduction 2 Listening Sample
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Statistical Quality Control Statistisk kvalitetsstyrning. 7,5 högskolepoäng. Ladok code: 41T05A, Name: Personal number:
Statistical Quality Control Statistisk kvalitetsstyrning 7,5 högskolepoäng Ladok code: 41T05A, The exam is given to: 41I02B IBE11, Pu2, Af2-ma Name: Personal number: Date of exam: 1 June Time: 9-13 Hjälpmedel
Automation Region. Affärsdriven systemutveckling genom agila metoder. Stefan Paulsson Thomas Öberg
Automation Region Affärsdriven systemutveckling genom agila metoder Stefan Paulsson Thomas Öberg Frontit Frontit är ett svenskt konsultföretag i gränslandet mellan Management & IT, som stärker sina kunders
Bridging the gap - state-of-the-art testing research, Explanea, and why you should care
Bridging the gap - state-of-the-art testing research, Explanea, and why you should care Robert Feldt Blekinge Institute of Technology & Chalmers All animations have been excluded in this pdf version! onsdag
Webbreg öppen: 26/ /
Webbregistrering pa kurs, period 2 HT 2015. Webbreg öppen: 26/10 2015 5/11 2015 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en
Översättning av galleriet. Hjälp till den som vill...
Hjälp till den som vill... $txt['aeva_title'] = 'Galleri'; $txt['aeva_admin'] = 'Admin'; $txt['aeva_add_title'] = 'Titel'; $txt['aeva_add_desc'] = 'Beskrivning'; $txt['aeva_add_file'] = 'Fil att ladda
2.1 Installation of driver using Internet Installation of driver from disk... 3
&RQWHQW,QQHKnOO 0DQXDOÃ(QJOLVKÃ'HPRGULYHU )RUHZRUG Ã,QWURGXFWLRQ Ã,QVWDOOÃDQGÃXSGDWHÃGULYHU 2.1 Installation of driver using Internet... 3 2.2 Installation of driver from disk... 3 Ã&RQQHFWLQJÃWKHÃWHUPLQDOÃWRÃWKHÃ3/&ÃV\VWHP
Om oss DET PERFEKTA KOMPLEMENTET THE PERFECT COMPLETION 04 EN BINZ ÄR PRECIS SÅ BRA SOM DU FÖRVÄNTAR DIG A BINZ IS JUST AS GOOD AS YOU THINK 05
Om oss Vi på Binz är glada att du är intresserad av vårt support-system för begravningsbilar. Sedan mer än 75 år tillverkar vi specialfordon i Lorch för de flesta olika användningsändamål, och detta enligt
12.6 Heat equation, Wave equation
12.6 Heat equation, 12.2-3 Wave equation Eugenia Malinnikova, NTNU September 26, 2017 1 Heat equation in higher dimensions The heat equation in higher dimensions (two or three) is u t ( = c 2 2 ) u x 2
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
MÅLSTYRNING OCH LÄRANDE: En problematisering av målstyrda graderade betyg
MÅLSTYRNING OCH LÄRANDE: En problematisering av målstyrda graderade betyg Max Scheja Institutionen för pedagogik och didaktik Stockholms universitet E-post: max.scheja@edu.su.se Forskning om förståelse
Annonsformat desktop. Startsida / områdesstartsidor. Artikel/nyhets-sidor. 1. Toppbanner, format 1050x180 pxl. Format 1060x180 px + 250x240 pxl.
Annonsformat desktop Startsida / områdesstartsidor 1. Toppbanner, format 1050x180 pxl. Bigbang (toppbanner + bannerplats 2) Format 1060x180 px + 250x240 pxl. 2. DW, format 250x240 pxl. 3. TW, format 250x360
RUP är en omfattande process, ett processramverk. RUP bör införas stegvis. RUP måste anpassas. till organisationen till projektet
RUP är en omfattande process, ett processramverk RUP bör införas stegvis RUP måste anpassas till organisationen till projektet Volvo Information Technology 1 Även RUP har sina brister... Dåligt stöd för
Kurskod: TAMS11 Provkod: TENB 28 August 2014, 08:00-12:00. English Version
Kurskod: TAMS11 Provkod: TENB 28 August 2014, 08:00-12:00 Examinator/Examiner: Xiangfeng Yang (Tel: 070 2234765) a. You are permitted to bring: a calculator; formel -och tabellsamling i matematisk statistik
Datasäkerhet och integritet
Chapter 4 module A Networking Concepts OSI-modellen TCP/IP This module is a refresher on networking concepts, which are important in information security A Simple Home Network 2 Unshielded Twisted Pair
Installation av F13 Bråvalla
Website: http://www.rbdesign.se Installation av F13 Bråvalla RBDESIGN FREEWARE - ESCK Norrköping-Bråvalla 1. Ladda ner och packa upp filerna i en mapp som du har skapat på ett lättöverskådligt ställe utanför
Every visitor coming to the this website can subscribe for the newsletter by entering respective address and desired city.
Every visitor coming to the this website can subscribe for the newsletter by entering respective e-mail address and desired city. Latest deals are displayed at the home page, wheras uper right corner you
EBBA2 European Breeding Bird Atlas
Methodology Sergi Herrando, Verena Keller, Petr Voříšek et al. objectives 1. To document breeding evidence for all bird species at a resolution of 50x50 km 2. To estimate abundance for all bird species
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
Schenker Privpak AB Telefon 033-178300 VAT Nr. SE556124398001 Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr 033-257475 Säte: Borås
Schenker Privpak AB Interface documentation for Parcel Search 2011-10-18 Version: 1 Doc. no.: I04306 Sida 2 av 5 Revision history Datum Version Sign. Kommentar 2011-10-18 1.0.0 PD First public version.
Questionnaire for visa applicants Appendix A
Questionnaire for visa applicants Appendix A Business Conference visit 1 Personal particulars Surname Date of birth (yr, mth, day) Given names (in full) 2 Your stay in Sweden A. Who took the initiative
Second handbook of research on mathematics teaching and learning (NCTM)
Second handbook of research on mathematics teaching and learning (NCTM) The effects of classroom mathematics teaching on students learning. (Hiebert & Grouws, 2007) Inledande observationer Undervisningens
BÄNKVÅG / BENCH SCALE Modell : SW-III / Model : SW-III ANVÄNDARMANUAL / USER MANUAL SW-III WWW.LIDEN-WEIGHING.SE 2014-03-26 OBS! Under vågen sitter en justerbar skruv (se bild). Standardinställning är
Discovering!!!!! Swedish ÅÄÖ. EPISODE 6 Norrlänningar and numbers 12-24. Misi.se 2011 1
Discovering!!!!! ÅÄÖ EPISODE 6 Norrlänningar and numbers 12-24 Misi.se 2011 1 Dialogue SJs X2000* från Stockholm är försenat. Beräknad ankoms?d är nu 16:00. Försenat! Igen? Vad är klockan? Jag vet inte.
Quick Start Guide Snabbguide
Quick Start Guide Snabbguide C Dictionary Quick Start Thank you for choosing C Dictionary and C-Pen as your translation solution. C Dictionary with its C-Pen connection will make translation easy and enable
Här kan du sova. Sleep here with a good conscience
Här kan du sova med rent samvete Sleep here with a good conscience MÅNGA FRÅGAR SIG hur man kan göra en miljöinsats. Det är egentligen väldigt enkelt. Du som har checkat in på det här hotellet har gjort
Health café. Self help groups. Learning café. Focus on support to people with chronic diseases and their families
Health café Resources Meeting places Live library Storytellers Self help groups Heart s house Volunteers Health coaches Learning café Recovery Health café project Focus on support to people with chronic
The Arctic boundary layer
The Arctic boundary layer Interactions with the surface, and clouds, as learned from observations (and some modeling) Michael Tjernström Department of Meteorology & the Bert Bolin Center for Climate Research,
Klicka här för att ändra format
på 1 på Marianne Andrén General Manager marianne.andren@sandviken.se Sandbacka Park Högbovägen 45 SE 811 32 Sandviken Telephone: +46 26 24 21 33 Mobile: +46 70 230 67 41 www.isea.se 2 From the Off e project
The Finite Element Method, FHL064
The Finite Element Method, FHL064 Division of Solid Mechanics Course program, vt2, 20 Course description The finite element method (FEM) is a numerical method able to solve differential equations, i.e.
Kursplan. NA3009 Ekonomi och ledarskap. 7,5 högskolepoäng, Avancerad nivå 1. Economics of Leadership
Kursplan NA3009 Ekonomi och ledarskap 7,5 högskolepoäng, Avancerad nivå 1 Economics of Leadership 7.5 Higher Education Credits *), Second Cycle Level 1 Mål Studenterna skall efter genomgången kurs: kunna
Protokoll Föreningsutskottet 2013-10-22
Protokoll Föreningsutskottet 2013-10-22 Närvarande: Oliver Stenbom, Andreas Estmark, Henrik Almén, Ellinor Ugland, Oliver Jonstoij Berg. 1. Mötets öppnande. Ordförande Oliver Stenbom öppnade mötet. 2.
Motif-based Hidden Markov Models for Multiple Sequence Alignment
Motif-based Hidden Markov Models for Multiple Sequence Alignment William N. Grundy Charles P. Elkan Dept. of Computer Science & Engineering University of California, San Diego Abstract Protein families
Documentation SN 3102
This document has been created by AHDS History and is based on information supplied by the depositor /////////////////////////////////////////////////////////// THE EUROPEAN STATE FINANCE DATABASE (Director:
Kursplan. MT1051 3D CAD Grundläggande. 7,5 högskolepoäng, Grundnivå 1. 3D-CAD Basic Course
Kursplan MT1051 3D CAD Grundläggande 7,5 högskolepoäng, Grundnivå 1 3D-CAD Basic Course 7.5 Higher Education Credits *), First Cycle Level 1 Mål Studenten ska efter avslutad kurs ha inhämtat grunderna
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 17 August 2015, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 17 August 2015, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 2234765). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
How to format the different elements of a page in the CMS :
How to format the different elements of a page in the CMS : 1. Typing text When typing text we have 2 possible formats to start a new line: Enter - > is a simple line break. In a paragraph you simply want
INSTALLATION INSTRUCTIONS
INSTALLATION - REEIVER INSTALLATION INSTRUTIONS RT0 RF WIRELESS ROOM THERMOSTAT AND REEIVER MOUNTING OF WALL MOUTING PLATE - Unscrew the screws under the - Pack contains... Installation - Receiver... Mounting
1. Förpackningsmaskin / Packaging machine
1. örpackningsmaskin / Packaging machine venska: En förpackningsmaskin ser ut enligt nedanstående skiss. Den inkommande tuben matas fram med motorn. otorn går så länge som dess styrsignal är sann. Om tuben
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik Kurs: MA152G Matematisk Analys MA123G Matematisk analys för ingenjörer Tentamensdag: 2012-03-24 kl 14.30-19.30 Hjälpmedel : Inga hjälpmedel
Kvalitetsarbete I Landstinget i Kalmar län. 24 oktober 2007 Eva Arvidsson
Kvalitetsarbete I Landstinget i Kalmar län 24 oktober 2007 Eva Arvidsson Bakgrund Sammanhållen primärvård 2005 Nytt ekonomiskt system Olika tradition och förutsättningar Olika pågående projekt Get the
Klyvklingor / Ripping Blades.
Klyvklingor / Ripping Blades. Sågresultatet är beroende av att klingan är avsedd för den tjocklek och det material som ska sågas, med rätt kombination av spånvinkel, skärtyp och tanddelning. Generellt
STORSEMINARIET 3. Amplitud. frekvens. frekvens uppgift 9.4 (cylindriskt rör)
STORSEMINARIET 1 uppgift SS1.1 A 320 g block oscillates with an amplitude of 15 cm at the end of a spring, k =6Nm -1.Attimet = 0, the displacement x = 7.5 cm and the velocity is positive, v > 0. Write
Measuring child participation in immunization registries: two national surveys, 2001
Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of
SUPPLEMENTARY FIGURE LEGENDS
SUPPLEMETARY FIGURE LEGEDS Supplementary Fig. 1. Flow cytometric analysis of wildtype, mutant and chimeric protein surface expression. Cells transduced with the individual constructs indicated were stained
Mid-Semester Evals. CS 188: Artificial Intelligence Spring Outline. Contest. Conditional Independence. Recap: Reasoning Over Time
CS 88: Artificial Intelligence Spring 2 Lecture 2: HMMs and Particle Filtering 4/5/2 Pieter Abbeel --- UC Berkeley Many slides over this course adapted from Dan Klein, Stuart Russell, Andrew Moore Mid-Semester
Eternal Employment Financial Feasibility Study
Eternal Employment Financial Feasibility Study 2017-08-14 Assumptions Available amount: 6 MSEK Time until first payment: 7 years Current wage: 21 600 SEK/month (corresponding to labour costs of 350 500
Här kan du checka in. Check in here with a good conscience
Här kan du checka in med rent samvete Check in here with a good conscience MÅNGA FRÅGAR SIG hur man kan göra en miljöinsats. Det är egentligen väldigt enkelt. Du som har checkat in på det här hotellet
BÄNKVÅG / BENCH SCALE ANVÄNDARMANUAL / USER MANUAL SW-III www.liden-weighing.com Svenska OBS! Under vågen sitter en justerbar skruv (se bild). Standardinställning är den för vägning. Om ni vill rengöra
Technique and expression 3: weave. 3.5 hp. Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2.
Technique and expression 3: weave 3.5 hp Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2 ExamCode: February 15 th 9-13 Means of assistance: Calculator, colorpencils,
Ett hållbart boende A sustainable living. Mikael Hassel. Handledare/ Supervisor. Examiner. Katarina Lundeberg/Fredric Benesch
Ett hållbart boende A sustainable living Mikael Hassel Handledare/ Supervisor Examinator/ Examiner atarina Lundeberg/redric Benesch Jes us Azpeitia Examensarbete inom arkitektur, grundnivå 15 hp Degree
För att justera TX finns det ett tool med namnet MMDVMCal. t.ex. /home/pi/applications/mmdvmcal/mmdvmcal /dev/ttyacm0
Justering av repeater med MMDVM-Modem På det senaste har det varit många frågor kring hur man justerar en repeater med ett MMDVM- Modem. Da det inte finns mycket dokumentation kring hur man justerar ett
Robust och energieffektiv styrning av tågtrafik
1 Robust och energieffektiv styrning av tågtrafik - CATO - Forskning inom OnTime - Vidareutveckling och möjligheter KAJT, temadag om punktlighet 2014-11-13 Tomas Lidén Transrail Sweden AB Dagens trafikledning
Normalfördelning. Modeller Vi har alla stött på modeller i olika sammanhang. Ex:
Normalfördelning 1 Modeller Vi har alla stött på modeller i olika sammanhang. Ex: Leksaksbilar Modelljärnvägar Dockskåp 2 En leksaksbil är i vissa avseenden en kopia av en riktig bil. Men den skiljer sig
Typografi, text & designperspektiv
Typografi, text & designperspektiv Serif Hårstreck Stapel Heplx x-höjd Baslinje Grundstreck Serif Underhäng Inre form I dag Lite bakgrund Övergripande grunder inom typografi Text hantering Elva Synlig
Att fastställa krav. Annakarin Nyberg
Att fastställa krav Annakarin Nyberg Disposition Del 1 Varför samla in krav? Typer av krav Interaktionsdesign och krav Del 2 Analys, tolkning och presentation Scenarios Use cases Task analysis Avslutning
denna del en poäng. 1. (Dugga 1.1) och v = (a) Beräkna u (2u 2u v) om u = . (1p) och som är parallell
Kursen bedöms med betyg, 4, 5 eller underänd, där 5 är högsta betyg. För godänt betyg rävs minst 4 poäng från uppgifterna -7. Var och en av dessa sju uppgifter an ge maximalt poäng. För var och en av uppgifterna