Development of a method for the analysis of serglycin proteoglycan gene expression in canine blood samples
|
|
- Ulf Lundberg
- för 6 år sedan
- Visningar:
Transkript
1 Faculty of Veterinary Medicine and Animal Science Department of Biomedical Sciences and Veterinary Public Health Development of a method for the analysis of serglycin proteoglycan gene expression in canine blood samples Kristin Löfqvist Independent project 15 hec First cycle, G2E Biology with Specialization in Biotechnology - Bachelor programme,department of Biomedical Sciences and Veterinary Public Health Uppsala 2018
2 Development of a method for the analysis of serglycin proteoglycan gene expression in canine blood samples Kristin Löfqvist Supervisor: Assistant supervisor: Magnus Åbrink, SLU, Department of Biomedical Sciences and Veterinary Public Health Claudia Lützelschwab, SLU,Department of Biomedical Sciences and Veterinary Public Health Zhiqiang Li, SLU, Department of Biomedical Sciences and Veterinary Public Health Examiner: Caroline Fossum, SLU, Department of Biomedical Sciences and Veterinary Public Health Credits: 15 hec Level: Frist cycle, G2E Course title: Independent project in Biology Bachelor project Course code: EX0689 Programme/education: Biology with Specialization in Biotechnology- Bachelor programme Place of publication: SLU, Uppsala Year of publication: 2018 Title of series: Biology with Specialization in Biotechnology, Degree Project for bachelor s Degree Online publication: Keywords: Canine cancer, serglycin, biomarker, qpcr, reference genes, blood sample Sveriges lantbruksuniversitet Swedish University of Agricultural Sciences Faculty of Veterinary Medicine and Animal Science Department of Biomedical Sciences and Veterinary Public Health
3
4 Abstract Cancer is a highly prevalent disease among canine breeds. Nowadays, mainly histology parameters are used to determine the prognosis and for selecting treatment strategies. Due to the high degree of morbidity and mortality in cancer affected dogs, there is a strong need to identify additional diagnostic methods and biomarkers. Serglycin is an intracellular proteoglycan found to be overexpressed in several types of cancer, including aggressive canine mammary cancer. High expression levels of serglycin in cancer cells are considered to correlate with cancer metastases and a poor prognosis for the patient. Detection of serglycin expression may, therefore, be a potential diagnostic marker for metastatic cancer in canine breeds. A known molecular technology used daily in medical diagnostics is quantitative polymerase chain reaction (qpcr). QPCR is primarily used to identify the expression pattern of specific genes. The aim of this study was to establish a qpcr assay that could be used for detection of serglycin expression in canine blood. The focus of the study was to validate potential reference genes as well as optimization of a functional qpcr assay. For this purpose, blood samples from canine donors with unknown disease history were chosen. Total RNA from each blood sample was extracted it an optimized TRIzol protocol. The samples were first tested in a step-down PCR, and then further tested in three different qpcr optimization steps. Both the step-down PCR and the qpcr included four genes;; SRGN and three references genes EEF2, HPRT and ACTIN B. The qpcr assays showed high specificity and sensitivity for two of the genes, SRGN and EEF2.Primer pairs for each of the two genes showed efficiency values within the range of 90 % to 105%, and their reflection of linearity was R 2 > The optimal annealing temperature for the SRGN and EEF2 gene was set as 62 C with a 300 nm primer concentration. Unfortunately, the published primer-design for two of the reference genes, i.e. HPRT and ACTIN B were poorly designed resulted in amplification of unwanted DNA and primer dimer formation. In conclusion, the presented method in this study showed evidence that serglycin could be detected in small amounts of canine blood utilizing the described qpcr assay. We concluded that the EEF2 gene is a stable reference gene for studying gene expression in dog blood with qpcr. However, in order to be able to apply our method in further studies, additional suitable reference genes need to be identified, tested and further validated.
5 Keywords: Canine cancer, serglycin, biomarker, qpcr, reference genes, blood sample.
6 Sammanfattning Elakartad cancer förkommer med hög frekvens bland många hundraser. Olika histologiska och histopatologiska parametrar används huvudsakligen idag för att bestämma prognos och välja behandlingsstrategi. På grund av den höga graden av sjuklighet och mortalitet inom elakartad cancer hos hund, behövs ytterligare diagnostiska metoder och biomarkörer behöver utvärderas för användning på kliniken. Serglycin är en intracellulär proteoglykan som har visat sig vara överuttryckt i flera typer av cancer, inklusive aggressiva juvertumörer hos hund. Höga expressionsnivåer av serglycin i cancerceller anses vara korrelerade med cancermetastaser och en dålig prognos för patienten. Detektion av serglycin-uttryck kan därmed vara en potentiell diagnostisk metod för att bedöma risk för cancermetastaser hos olika hundraser. En känd molekylärteknik som används dagligen inom medicinsk diagnostik är kvantitativ polymeras kedjereaktion (qpcr). qpcr används främst för att identifiera uttrycksmönstret av specifika gener. Syftet med studien var att etablera en qpcr-analysmetod för att kunna detektera serglycin- (SRGN-) uttryck i hundblod, med målet att metoden sedan ska kunna användas för prognostisk screening av hundpatienter. Studiens fokus lades vid validering av potentiella referensgener samt optimering av en funktionell qpcr-analys. För detta ändamål valdes blodprover från hundar med okänd sjukdomshistoria. Totala mängden RNA isolerades med hjälp av ett eget designat TRIzol-protokoll. Först testades proverna i en step-down PCR för att sedan testats vidare i totalt tre olika qpcr optimeringsanalyser. Både step-down PCR och qpcr inkluderade fyra gener;; SRGN och tre referensgener EEF2, HPRT och ACTIN B. qpcr-analysen visade sig ha hög specificitet och känslighet för två av generna SRGN och EEF2. Primerparen för var och en av de två generna visade sig ha effektivitesvärden inom intervallet 90% till 105% och deras R 2 värden låg över 0,980. Den optimala annealing-temperaturen för SRGN och EEF2 generna sattes till 62 C med 300 nm primerkoncentration. Tyvärr, den publicerade primer-designen för två av de valda referensgenerna HPRT och ACTIN B visade sig vara sämre vilket ledde till amplifiering av oönskat DNA och bildning av primerdimerer. Som slutsats, metodutvecklingen i denna studie visade att serglycin-uttrycket kunde detekteras i små volymer av hundblod med hjälp av qpcr-analys, samt att EEF2 är en stabil referensgen för att kvantifiera genuttryck i hundblod med qpcr. Men för att kunna tillämpa metoden i fortsatta studier behöver ytterligare lämpliga referensgener identifieras och valideras. Nyckelord: Elakartad cancer hos hund, Serglycin, biomarkör, qpcr, referensgener, blodprov.
7 Table of contents Abbreviations 8 1 Introduction 9 2 Materials and Methods Blood collection and RNA isolation DNase I treatment and cdna synthesis Primer design and validation of primer pairs Real-Time PCR (qpcr) 21 3 Results Total RNA extraction Step down PCR qpcr optimization 25 4 Discussion 34 Acknowledgments 40 References 41 Appendix 1 45
8 Abbreviations ACT B b eta-actin EFF2 Eukaryotic elongation factor 2 HPRT RT-PCR SRGN qpcr Hypoxanthine phosphoribosyl transferase Reverse Transcription polymerase chain reaction Serglycin Quantitative polymerase chain reaction 8
9 1 Introduction One of today s leading causes of death in canine breeds is cancer. High rates of cancer and aggressive tumor development can be found in several canine breeds, e.g. around 50% of the mammary tumors found in bitches are malignant tumors (Pawłowski et al., 2013). The spread of malignant tumors through metastases are often difficult to treat, which unfortunately often leads to the death of the animal (Bonnett et al., 2005). Prognostic parameters being used today to evaluate tumor status are mainly based on histological variables including tumor size, lymph node status, lymphatic or vascular invasion and, the grade of differentiation (Manuali et al., 2012). Poor diagnostic methods and inefficient treatment strategies can partly account for the high morbidity and mortality rates of malignant tumours found in canine breeds (Manuali et al., 2012). As of today, a few biomarkers have been evaluated for diagnosing canine lymphomas (Bryan, 2016) but, there are still no measurable indicators available to use in the canine clinical practice capable of a prompt detection and prediction of cancer malignancy in blood samples. To improve the survival rate for the cancer patient there is, therefore, a need for the development of suitable and reliable 9
10 biomarkers for the early detection of metastatic cancer. Serglycin is an intracellular proteoglycan consisting of a core protein which carries long glycosaminoglycan chains (GAGs) (Korpetinou et al., 2013). In different cell types, serglycin is decorated with highly divergent structural GAGs, which depends on the glycosylation machinery at work in respective cell type. The GAGs have the capacity to interact with several important biological molecules through highaffinity binding (Korpetinou et al., 2014). It is primarily the negative charge of the GAGs chains that form hydrogen bonds and electrostatic interactions, thus becoming the biologically activate part of the protein (Pejler et al., 2009). The serglycin gene is well conserved and the protein is expressed in several animal species e.g. in human, horses, mice and dogs (Kolset and Tveit, 2008). The serglycin gene is expressed in multiple cell types such as in hematopoietic cells including mast cells, neutrophils and macrophages as wells as in non-hematopoietic cells, for example, endothelial cells (Pejler et al., 2009). In most hematopoietic cells serglycin is involved in granular retention of preformed mediators. For example, in mast cells serglycin is stored intracellularly in the secretory granules, where it seems to play an important intracellular role by regulating the correct storage and secretion of numerous inflammatory mediators such as proteases, histamine, cytokines, and chemokines (Kolset and Tveit, 2008). 10
11 Serglycin has also shown to be present and expressed in several cancer types, e.g. myeloma, acute myeloid leukemia, breast and glioma (Roy et al., 2017). In tumor cells, serglycin can appear on the tumor cell surface where it plays a role in mediating interactions between the tumor cells and the microenvironment (Korpetinou et al., 2014). The secreted serglycin presented within the tumor microenvironment has been proposed to interact with a cell-surface adhesion receptor called CD44 (Guo et al. 2017). The interaction between the serglycin proteoglycan and CD44 results in triggering the CD44 signal pathway, and this will induce epithelial to mesenchymal transition (EMT), enhance invasiveness and promote metastasis. Recent studies have demonstrated that serglycin expression is essential for metastatic growth and dissemination (Roy et al., 2016). In addition, serglycin seems to play an important role in regulating the protein cargo in tumor-derived exosomes by generating more enriched exosomes. The enriched exosome will deliver its protein cargo to either nearby or distant cells resulting in tumor progression (Purushothaman et al., 2017). Several scientific studies performed on human tumor cells have concluded that serglycin over-expression correlates with an aggressive tumor cell phenotype, which normally indicates a poor survival prognostic for the patient (Roy et al., 2017;; Korpetinou et al., 2013). Some of the more recent studies have supported serglycin as a potential prognostic biomarker for human malignancy (Roy et al., 2017). Importantly, serglycin expression has also been shown to be up-regulated in aggressive canine mammary cancer patients (Pawłowski et al.,2013). 11
12 There are several molecular techniques available today that are used to evaluate potential biomarkers. Quantitative polymerase chain reaction, qpcr, also known as Real Time PCR, is one molecular technique commonly used in cancer diagnostics to identify expression patterns of specific genes (Bustin et al., 2005). qpcr is considered to be an accurate, sensitive and high throughput technique for detection of gene expression. qpcr monitors gene expression in real time using fluorescent reporter molecules. It is possible, then, to quantify simultaneously a specific gene transcript number in several clinical samples (Wong and Medrano, 2005). During each PCR cycle in the qpcr run, the fluorescence signal will increase over the background fluorescence and reach a point known as threshold cycle (Ct) or quantification cycle (Cq) (Bustin and Mueller, 2005). The Cq-value marks where the target amplification is first detected, and it also represents the starting copy number of mrna in the original sample (Walker, 2002). Highly expressed target genes will have a more rapid fluorescence signal increase and will reach the threshold value sooner compared to lower expressed genes (Bustin and Mueller, 2005). A standard qpcr run is normally around 40 cycles, highly expressed target genes will, therefore, have Cq-values between while lower expressed genes will have Cq-values between cycles. Lower expressed genes will have higher Cq-values because more amplification is needed to detect the fluorescence signal if the amount of mrna present is low (Walker, 2002). The Cq-values are logarithmic and can, therefore, be used to calculate a quantitative result using either direct (comparative Ct method) or indirect (interpolation to standard curves to create linear values) methods (Wong and Medrano, 2005). 12
13 Furthermore, factors that may influence the gene expression output always need to be controlled, e.g. cdna concentration, RNA integrity, enzymatic efficiencies, amplification efficiency and differences between clinical sample types in their overall transcriptional activity (Brinkhof et al., 2006). These factors are often controlled with the help of normalization to internal standards, also known as reference genes or housekeeping genes (Bustin et al., 2005). Reference genes are often used for normalization purposes because their equal expression in each cell of a specific tissue despite of the individual. Reference genes often encode for proteins needed for cell survival, and the ideal gene should have a stable expression pattern under various conditions. There is seldom one gene that is able to meet all criteria, more than one reference gene should, therefore, be included for the normalization control to obtain a correct and reliable end result (Wong and Medrano, 2005). Moreover, some studies have concluded that the expression of commonly used reference genes vary between individuals, tissue type, species and, that the choice of reference genes can have an impact on the outcoming result (Ohl et al., 2005). To obtain good and reliable quantitative result, optimization of the qpcr assay is a very important step before the assay can be applied to clinical material. qpcr optimization can be performed by establishing the optimal concentration of template, annealing temperatures and primer concentration (Gene-quantification, 2018). Important characteristics of an optimized qpcr assay are: low variability across assay replicates, high amplification efficiency from 90% to 105 % and linear regression line of a strand curve (R 2 13
14 >0.980). These values are calculated from a standard curve, obtained by plotting Cq-values from the amplification against the log of chosen dilution series (1/dilution). An optimized qpcr assay will have a amplification efficiency value (E) at 2, where 2 is equal to 100 % efficiency (Hui and Feng, 2013). So, if the amplification of the template is perfect, duplication will occur after each cycle generating a 2-fold increase. So far, no qpcr assay has been established for the purpose of detecting serglycin expression in canine blood. It has been shown that qpcr is a sensitive method for detection and characterization of serglycin expression in malignant tumors (Roy et al., 2017), which allows serglycin to function as a prognostic marker for human tumors. The value of detection of serglycin in blood samples via qpcr is based on the fact that malignant tumor cells detach from their primary tissue and circulates in the blood stream (Joosse et al., 2015). Assumptions can, therefore, be made that blood samples from patients with aggressive tumors would show higher expression levels of the serglycin gene than blood samples from patients without metastatic prone cancer. The consistent association pattern between high expression levels of serglycin and aggressive cancer forms, in both animals and humans, suggests that serglycin has the capacity to function as a good biomarker for metastatic cancer. Therefore, the purpose of this study was to determine if serglycin expression could be detected in a small volume of canine blood, while the aim is to develop a functional assay for screening of canine patients. We here present a potential screening method for detection of serglycin in blood from canine patients utilizing qpcr. We fo- 14
15 cused on establishing and validating a model system method, the first step towards a functional qpcr assay that could be useful for detecting serglycin expression in canine cancer patients. Because of the importance of qpcr optimization, several optimization steps were included in the study. For this purpose, we used blood samples from canine donors with unknown disease history with the intention to detect serglycin gene expression and to test published primer pairs for reference genes. 15
16 2 Materials and Methods. The clinical material was provided by the Clinical Pathology Laboratory at the University Animal Hospital located at SLU, Uppsala. The clinical material was collected during the period between April 2018 and May No experimental animals were included for the purpose of this study. 2.1 Blood collection and RNA isolation Canine blood samples were collected from patients at the University Animal Hospital. Clinical history of all patients was masked. The blood samples were collected with EDTA as anticoagulant and 100 µl of blood was processed for total RNA isolation by immediate addition of 500 µl of TRIzol Reagent (Invitrogen, Life Technologies). Total RNA isolation was performed using a modified protocol (see Appendix 1, page 45). Briefly, the RNA was obtained after phenol-chloroform extraction, as a µl aqueous phase, and precipitated with an equal volume of isopropanol. To achieve a more efficient precipitation and a higher yield of total RNA, the incubation time after addition of isopropanol 16
17 was changed from the proposed 10 minutes to 30 minutes. RNA pellets were resuspended in 30 µl RNase free water (Autoclaved Milli-Q water). All RNA concentrations were further quantified using NanoDrop 8000 (Thermo Fisher Scientific, CA, USA). The dissolved RNA pellets were frozen and stored at -80 C until further use. 2.2 DNase I treatment and cdna synthesis To prevent genomic DNA contamination, a DNase treatment step was included after total RNA extraction. The reaction was performed with the RQ RNase-free DNase I kit (Promega) following the manufacture s protocol. Approximately 1.2 µg of total RNA was treated with DNase I, in a maximum dilution volume of 13.2 µl. Reverse transcription from RNA to cdna was then carried out using the SuperScript TM III Reverse Transcriptase kit (Invitrogen, CA, USA). The DNase pre-treated RNA was further mixed with 1.2 µl of dntp mix [10mM] and 1.2 µl of reverse gene-specific primers [2 µm] in a total reaction volume of 15.6 µl. The samples were incubated at 65 C for 5 minutes, and immediately placed on ice for at least 1 minute. A fraction of each reaction mixture (2.6 µl) was then transferred to new tubes as RT-minus controls (i.e., cdna reaction without addition of Supercript II RT enzyme). The RT-minus controls were included to provide negative controls for the corresponding PCR reactions. Then, 7 µl of the reverse strand reaction master mix (5x First Strand reaction buffer, 0.1 M DTT) with the SuperScript TM III RT enzyme 17
18 were thereafter added to each sample tube (RT plus samples). In the corresponding RT-minus controls, 1.4 µl master mixture without SuperScript III RT enzyme was added. The cdna reactions have been scaled up 1.2 times from the original protocol to include the RT-minus controls. The final reaction volume for RT-plus reactions was 20 µl and 4 µl for RT-minus reactions. The samples were incubated at 55 C for 1 hour and then immediately transferred to 70 C for 15 minutes for inactivation of the reverse transcriptase enzyme. All samples were placed on ice for additional 5 minutes after the cdna synthesis was completed and, either used immediately for the PCR reactions or placed at -20 C for long term storage. 2.3 Primer design and validation of primer pairs The selection of references genes was based on a previous study describing the use of b -actin (ACT B), hypoxanthine phosphoribosyltransferase (HPRT) and eukaryotic elongation factor 2 (EEF2) as reference genes for metastatic canine mammary cancer (Bulkowska et al., 2017). Serglycin primers were selected based on a known Canis lupus familiaris serglycin sequence, available at NCBI Genebank (Reference Sequence: XM_ ). Primer pairs used in the study are shown in Table 1. To verify the sequences, an alignment search was constructed in BLAST among human, mouse and canine serglycin sequences( Primer design was performed using the software Snap Gene 4.1 ( Primers chosen were positioned between different exons to avoid amplification of genomic DNA. Furthermore, an oligo analysis was performed on the chosen primers 18
19 using two different software s, the Oligo analyzer 3.1 ( and the Beacon designer ( Table 1. Primers for Canis lupus familiaris used in qpcr and step-down PCR, the primers were designed using the software Snap Gene 4.1 TARGET GENES SEQUENCE TM Amplicon size EEF2 ACGCCTTTGGTCGTGTATTC fwd 58 C 173 bp GTTCCCACAAGGCACATCTT rev 58 C ACTB TGTGTTATGTGGCCCTGGAC fwd 58 C 164 bp TTCCATGCCCAGGAAGGAAG rev 57 C HPRT AAGCTTGCTGGTGAAAAGGA fwd 55 C 219 bp CAATGGGACTCCAGATGCTT rev 58 C Zhiqiang pair 9 fwd GTGAAGAGAGCCACGTACCA fwd 59.2 C 147 bp Zhiqiang pair 9 rev TCTTGACATTGAAGAACGGTCAG rev 59.2 C Claudia primer 1 fwd Claudia Primer 3 rev TCCAGGGCAGTAGGCTTGTA fwd 55 C 85 bp GTGGCTCTCTTCACAGGAGA rev 56 C Furthermore, to verify and test the quality of the primer design, a step-down PCR was constructed using cdna obtained from isolated canine RNA which had been collected from both blood and septal heart wall tissue samples. Total RNA was therefore isolated from a range of 10 µl-100 µl blood to optimize the amount of canine blood needed for the analysis. 19
20 Approximately 1 µg of the total RNA was used for cdna synthesis following the RT2 First Strand kit manufactures instructions (Qiagen). One modification was added to the protocol, RNase free water in the reverse transcriptase mixture was replaced with 3 µl of pooled gene-specific reverse primers [10 µm]. Combining random hexamer and Oligo(dT)-primers with the gene-specific primers ensured coverage of the total mrna pool, together with the verification of the specific cdna product expected length and an optimal yield. The cdna obtained was later used in a step-down PCR (see settings in table 2). To visualize the RT-PCR products, 2.5% agarose gel was prepared in 1x TAE buffer containing 30 µl of GelRed reagent and 5 µl of a 1 kb plus DNA ladder was used to determine the size of the products. Table 2. PCR settings used for the step-down PCR, no 72 C extension step was included Step Temp ( C) Time Note min sec Repeat step 3x min sec Repeat step 3x min sec Repeat step 3x min sec Repeat step 26x min min
21 2.4 Real-Time PCR (qpcr) Each qpcr reaction was performed with a CFX 96 Real-time System (BioRad), using the iq SYBR Green Supermix according to manufacturer s protocol (BioRad, CA, USA) in a total volume of 25 µl, containing 2 µl of cdna. In addition, all qpcr runs included no template controls (negative control) and, RT-minus controls were included for sample quality check. All samples were run in duplicates, including negative controls and the RT-minus control samples for each gene. Before initializing running, the qpcr plates were centrifuged at 3000 rpm for 2 minutes. The qpcr was performed on four occasions with cdna obtained from 100 µl of blood. At first, the quality of each cdna sample and the designed primer pairs of each gene were checked in a preliminary qpcr assay. This first assay included four individuals, i.e. number 8, 9, 10 and 11. cdna from each individual was diluted 1:5 with nuclease free water. The chosen PCR cycling conditions included a 95 C heating step of 3 minutes (initial denaturation/enzyme activation). The samples were then cycled 40 times at 95 C for 15 seconds (denaturation), 59 C for 30 seconds (annealing) and 72 C for 30 seconds (extension). This procedure was then repeated with three of the primer pairs for genes, EEF2, SRGN, and HPRT. 21
22 To optimize the template concentration, the best performed sample, individual 11, was chosen and a 1:4 cdna dilution series (1:4, 1:16, 1:64 and 1:256) was prepared for amplification of EEF2 and SRGN transcripts. This second qpcr reaction was performed under the same PCR cycling conditions as the previous run, described above. Next, a primer concentration and annealing temperature optimization for the amplification of EEF2, SRGN and HPRT transcripts was performed. cdna from individual 11 diluted 1:64 was tested against three different concentrations, 200 nm, 300 nm and 400 nm for each primer pair. To optimize the annealing temperature, a gradient approach was used: 63 C, 62.7 C, 62.2 C, 61.2 C, 59 C, 58.5 C and 58 C. Furthermore, at the end of each run a melting curve from 65 C to 95 C was obtained in a 0.5 C increment for 0.05 seconds while all the other cycling parameters were kept the same as in previous assays. 22
23 3 Results 3.1 Total RNA extraction A modified protocol of the TRIzol Reagent (Invitrogen, Life Technologies) was applied. Table 3 is showing the total extraction RNA result before (sample 1, 3, 6, 7) and after (sample 8, 9, 10, 11) the modification was added to the original protocol. The NanoDrop measurement reveled a higher yield and quality of RNA obtained with the modified protocol for the majority of the samples. Notably, optimal 260/230 and 260/280 ratios should have values between 1.8 to 2.0 to be considered as pure RNA. In this case, 260/230 and 260/280 ratios were both lower despite the modifications introduced in the protocol, suggesting that phenolic reagents and genomic DNA might have been present. As a precaution a DNase treatment step was therefore included in the cdna protocol to avoid amplification of unwanted DNA. 23
24 Table 3. RNA concentration and quality measurements performed on a Nanodrop Sample ID Concentration (ng/µl) 260/ / Step-down PCR To investigate the potential to detect serglycin in blood and to verify the primer design of each primer pair, total RNA extracted from 100 µl of a canine blood sample and septal heart wall tissue total RNA (kindly provided by Åsa Olsson, HGEN Dept, SLU) was used in down step PCR. By using gel electrophoresis analysis, the size and overall quality of the PCR products were determined. This analysis revealed that serglycin transcripts (ZSGRN and CSRGN primer pairs) together with the three reference genes transcripts (ACTB, EEF2 and HPRT primer pairs) could be successfully amplified in a normal PCR assay with the designed primer pairs. Figure 1 shows products within the expected size range for each of the transcripts. The ZSRGN primer pair did not generate a good quality product in the septal heart wall PCR run and was therefore excluded from further experiments. 24
25 Figure % agarose gel analysis of the amplicons produced from the serglycin and four reference gene transcripts. The left image represents RNA obtained from septal heart wall tissue, and the right image RNA from the100 µl canine blood sample. Both PCR products were generated by a step-down PCR reaction. 3.3 qpcr optimization The first qpcr assay provided data with different Cq-values for the four tested individuals i.e. number 8, 9, 10 and 11. Individual 11 had the lowest mean Cq-value for each gene and was thereby selected as the best performing sample (see Table 4). The qpcr test included no template controls (NTC) and RT-minus controls for each gene. Table 4 shows no significant differences between the RT-minus and RT-plus Cq-values obtained for the reference genes ACT B and HPRT. In addition, the NTC (No Template Control) for both genes also showed amplification of unwanted products that generated signals in the qpcr assay. 25
26 A BLAST analysis constructed for both the ACT B and HPRT primer pairs gave multiple hits for several different species, posing a higher risk for amplification of genomic DNA or potential pseudogenes. Furthermore, all the HPRT qpcr products were further analyzed with both a melt curve and agarose gel analysis (see Figure 2). Both analytical methods revealed unwanted product amplification. The melt curve analysis showed a peak that did not correspond to the HPRT product. Furthermore, the gel analysis revealed amplicons with a molecular weight under 100 bp, much smaller than the HPRT amplicon expected size (219 bp). This unwanted amplification product could either be an indication of primer-dimer formation, or a DNA contamination of the primer stock solution. The qpcr result obtained for both the ACT B and HPRT genes were therefore regarded as inconclusive and were excluded from further experiments. Table 4. Average quantification values (Cq-values) obtained from the first qpcr assay, showing both RT-plus and RT-minus for each gene and for individuals 8 to 11 INDIVIDUAL SRGN EEF2 HPRT ACT B 8 (+) RT (-) RT (+) RT (-) RT (+) RT (-) RT (+) RT (-) RT
27 Figure 2. Melt-curve and 2.5% agarose gel analysis of the HPRT reaction products obtained from the preliminary qpcr assay. A, the melt curve analysis showing two peaks with melting temperatures at 75.5 C and 80.5 C. B, Agarose gel analysis of the amplification products including both plus-rt, minus-rt and NTC controls for each of the individual samples. Bands under 100 bp corresponds to the first peak and bands over 200 bp corresponds to the second peak in the melting curve (A). To adjust the template amount necessary to give an appropriate Cq-value for the clinical application a 4-fold dilution series of cdna from individual 11 were prepared to use for amplification reactions, including primer pairs for the SRGN and EEF2 genes. To estimate the qpcr assays efficiency, regression curves were plotted for both genes as mean Cq-values against the log (1/dilution), (Figures 3 and 4). The R 2 values were then calculated, and the slope of the linear regression line was used to determine the amplification efficiency, E, for each of the genes (E=10-1/slope ). In addition, the percentage ampli- 27
28 fication efficiency was calculated for both genes using the following formula: %Efficiency = (10-1/slope -1) x 100 %. The plotted regression curve showed that both the SRGN and EEF2 genes had a R 2 >0.980, a reflection of linearity. Notably, the 1:64 dilution points did fit perfectly into the linear regression line between two dilution points. An accurate %E value should lie between 90%-105%, this if the qpcr assay should be considered as robust and reproducible. When looking at the data, both the SRGN and EFF2 had values within this range (see table 5). At the end of each cycle, SRGN showed 2.03-fold increase while EFF2 showed 2.04-fold increase of amplicon copy number. Figure 3. The plotted regression curve as, mean Cq-value vs log(1/dilution) for the EEF2 gene. Generated from the second qpcr assay with a 1:4 serial dilution of cdna template from sample individual 11. The calculated equation for the regression line and R 2 value is shown. 28
29 Figure 4. The plotted regression curve as, mean Cq-value vs log(1/dilution) for the SRGN gene. Generated from the second qpcr assay with a 1:4 serial dilution of cdna template from sample individual 11. The calculated equation for the regression line and R 2 value is shown. Table 5. Calculated amplification efficiencies values (E) for both the SRGN and EEF2 genes GENES E=10-1/SLOPE %E= (10-1/slope -1) x 100 %. EFF % SRGN % The qpcr assay was further optimized for annealing temperatures and concentration for each primer pair both for SRGN and EEF2. For this purpose, a range of annealing temperatures (5 C range) based on the primer pairs Tm values were selected together with three different primer concentrations: 200 nm, 300 nm and 400 nm. An annealing at 62.7 C with a primer concentration of 300 nm gave 29
30 the lowest Cq value (28.78) for the EFF2 gene, while for the SRGN gene, the lowest Cq-value (27.36) was obtained at 62.2 C with a primer concentration of 400 nm, (see Figure 5). Notably, for both SRGN and EEF2 no significant difference between Cq-values was observed using this temperature range and primer concentration, see Figure 6 and 7. However, the Cq-values for SRGN increased a little with a decreasing annealing temperature and the 400 nm primer concentration for EEF2 had a tendency to be least effective. Therefore, the optimal annealing temperature and primer concentration selected for further assays was 62 C with a 300 nm primer concentration for both genes. Moreover, a melt-curve analysis was analyzed to exclude potential co-amplification of nonspecific product or primer dimer formation. Figure 6 shows two separate single peaks, one with Tm at 81.0 C corresponding to SRGN and one with Tm at 84.5 C corresponding to EEF2, thus revealing that only the specific products had been successfully amplified. 30
31 Figure 5. Annealing temperature optimization, showing an annealing temperature gradient from 58 C to 62.7 C performed with SRGN and EEF2 primer pairs at three different concentrations. EEF2 gave the lowest Cq value at 62.7 C with a 300 nm primer concentration and SRGN had the lowest Cq-value at 62.2 C with a 400 nm primer concentration. 31
32 Figure 6.Mean Cq-values for EEF2 at different temperatures and primer concentrations. Figure 7. Mean Cq-values for SRGN at different temperatures and primer concentrations. 32
33 Figure 8. Melt-curve analysis, showing two separate melting peaks at 81.0 C and 84.5 C. The first peak represents the SRGN gene while the second peak represents the EFF2 genes. 33
34 4 Discussion Canine cancer is one of the most common causes of death in certain dog breeds (Pawłowski et al., 2013). The high mortality rates of malignant tumours have been correlated with poor diagnostic predictions and inefficient treatment strategies (Manuali et al., 2012). The possibility of using serglycin as potential biomarker for detection of canine cancer was therefore evaluated, with the aim to develop a functional qpcr assay that in the future could detect serglycin expression levels in a small sample volume of blood from canine cancer patients. The focus of this study has been to test important parameters for a functional qpcr assay, e.g. the RNA extraction method, primer design, concentration of cdna and primers, and optimal annealing temperatures. To extract RNA from small volumes of canine blood samples a modified TRIzol method was established. This method proved to be a more efficient method for canine blood RNA extraction than the original method. The result shows that with our optimized protocol we could increase the concentration of total RNA yield, and that 100 µl of canine blood is enough to isolate a sufficient amount of RNA. Although, RNA could be successfully extracted from most of the in- 34
35 dividual samples, the 260/230 and 260/280 ratios were not optimal suggesting contamination of phenolic compounds or DNA. Therefore, DNase treatment is recommended after the RNA extraction to avoid contamination that might affect the interpretation of results. For this reason, a DNase treatment step has been included in our standard protocol. Furthermore, more sensitive methods are available for checking the RNA integrity e.g. lab-on-chip technologies like Agilent 2100 Bioanalyzer (Agilent Technologies, USA) and the Experion (Bio-Rad Laboratories, USA)(Fleige and Pfaffl, 2006). These technologies have proven to be stable and less sensitive against contamination, providing better information about the RNA integrity than a NanoDrop measurement. This kind of method could, therefore, be included as an extra RNA quality check for more accurate values. Two of the four primer pairs tested in the qpcr assay showed sufficiently good efficiency to obtain validated results, SRGN and EFF2. Notably, two of the reference genes, ACT B and HPRT, proved to be poorly designed. When the ACT B and HPRT genes were further analyzed, several pseudogenes for each gene and multiple hits for several species for each primer pair were found. A reference gene should not have pseudogenes and all primers should be designed so that they are separated by an intron, to avoid genomic DNA amplification. However, despite the fact that both primer pairs for each gene were designed so they were separated by introns and that a DNase treatment step was included as an extra precaution, it could not be excluded that amplification of genomic DNA for both the ACT B and 35
36 HPRT genes had occurred. Since the primer pairs for both genes gave multiple hits for several species with no observed mismatches, the risk for non-specific target amplification was increased, affecting the data analysis. There are some important aspects that separate our results from other studies performed with HPRT and ACT B as reference genes. Bulkowska and co-authors implied that both primer pairs for the ACT B gene and the HPRT gene should serve as good controls for validation of genes involved in metastatic canine mammary cancer (Bulkowska et al., 2017). Their study does not include any validation data for these primer pairs and therefore, is not possible to exclude genomic DNA amplification. However, the use of nonvalidated reference genes for normalization purposes is a known problem but seldom taken into consideration (Ohl et al., 2005). Such disregard can lead to highly misleading effects, which in turn will affect the credibility of the end results. Therefore, our result suggests that the ACT B and HPRT primer pairs proposed in Bulkowska et al. (2017), are not good reference genes for validating canine gene expression studies. Instead, new primers with improved target specificity should be tested. Because mismatches at the 3end have shown to have a higher likelihood to prevent unwanted amplification than mismatches at the 5end (Ye et al., 2012), primer pairs whose sequences contain three or more mismatches at the 3end are more recommended. Furthermore, the experimental set up should always include a quality control for each primer pair used. The control should exclude potential genomic DNA amplification, as well as prove that the amplicons are within the expected size range. Alternatively, the amplicons could be sequenced to verify that the correct cdna sequences are amplified. Inclusion of a melting curve analysis at the end of qpcr assay makes it possible to confirm that the pri- 36
37 mer pairs only amplified a single product. The right amplicon size can further be confirmed by running the qpcr amplification products on an agarose gel (Gene-quantification, 2018). In contrast, when performing a BLAST analysis with the primer pairs for reference gene EEF2 it did not give multiple hits for several species, only canine breeds, and the melting curve analysis confirmed that the primer pair for EEF2 had only amplified a single product. This result together with an accurate %E value (104%) allowed us to conclude that, out of the three reference genes tested, the EEF2 gene is the best suited to use as reference gene for gene expression studies in canine blood. The primer pairs for the EEF2 and SRGN genes performed well under the described qpcr reaction conditions as showed by the E values (within the range of 90%-105%, see table 6), and therefore indicating a robust, reproducible qpcr assay. Because both E values obtained were >100% some pipetting error in the serial dilutions may have occurred which is known to have a big impact in the outcome. For more conclusive result new dilution series should be constructed. In addition, both the SRGN and EEF2 genes showed R 2 values that were higher than These results showed that the amplification efficiency is the same for the different concentrations of starting cdna template and that no significant differences between the Cqvalues between replicates can be detected. Knowing that the experimental data fits the regression line, the assay can be considered accurate and reproducible for our samples. In addition, the cdna 37
38 with a 1:64 dilution gave a good signal in the qpcr assay. This relatively high cdna dilution suggests that a rather low limit of detection can be assumed for this assay. Furthermore, the annealing temperature that seemed most advantageous for both primer pairs was 62 C with a primer concentration of 300 nm. By choosing a higher annealing temperature for both primer pairs than the calculated (55 C/56 C SRGN and 58 C /58 C EFF2) specificity can be improved, and primer dimer formation be further avoided. However, no significant differences between Cq values could be observed among the different annealing temperatures and primer concentrations. This result may have been affected by the relatively narrow temperature range (5 C) in the annealing gradient. Because of the limitation of time for this study, it was not possible to repeat the gradient approach with higher temperature differences (i.e. in the range of 10 C), but continuation of the optimization regarding this point is recommended for a more accurate result. In conclusion, the study demonstrated a functional method that can be applied for detection of serglycin expression in the blood of canine patients. Our results showed that a relatively low amount of blood (around 100 µl) from the canine patients is enough to get a reliable result on the expression level of serglycin when utilizing qpcr. We validated the use of one stable reference gene (EEF2) and predict that this reference gene can be useful for canine blood expression studies. However, to apply the method in further studies, more suitable reference genes need to be tested for the normalization purpose. We therefore concluded that validation of all reference 38
39 genes should be included as an important step of the experimental set up. As a continuation of this study, and with the purpose of comparing the serglycin expression levels between healthy and cancer patients, it would be interesting to apply the optimized qpcr assay presented here on canine cancer patients with a known history of malignant tumors. Due to the limitation of time for this project, no tumor tissue or blood from cancer patients were obtained. However, the designed method and results in this study will be important for further research on this subject. 39
40 Acknowledgments Thanks to my Supervisor Magnus Åbrink for giving me the opportunity to be a part of a very interesting project work, for answering all my questions and for helping me complete this report. I would also like to send an endless thanks to my assistant supervisor Claudia Lützelschwab, for making sure that every practical part of project worked and for teaching me some very valuable things around in the laboratory. A thanks to Bernt Hjertner for answering all questions around qpcr. And last but not least, thanks to my examiner, Caroline Fossum for taking the time and effort to evaluate my project work. 40
41 References Bio-Rad Laboratories, Inc. (2006). Real-Time PCR Applications Guide. Bio-Rad, Carlsbad, USA. Available at: [ ] Bio-Rad Laboratories, Inc. (2009). iq SYBR Green Supermix. Bio- Rad, Carlsbad, USA. Available at: [ ] Bonnett, B., Egenvall, A., Hedhammar, Å., Olson, P. (2005). Mortality in over 350,000 Insured Swedish dogs from : I. Breed-,Gender-, Age- and Cause-specific Rates. Acta Vet Scand 46, Brinkhof, B., Spee, B., Rothuizen, J., Penning, L.C. (2006). Development and evaluation of canine reference genes for accurate quantification of gene expression. Analytical Biochemistry 356, Bryan, J.N.(2016). The Current State of Clinical Application of Serum Biomarkers for Canine Lymphoma. Front Vet Sci 3. Bulkowska, M., Rybicka, A., Senses, K.M., Ulewicz, K., Witt, K., Szymanska, J., Taciak, B., Klopfleisch, R., Hellmén, E., Dolka, I., Gure, A.O., Mucha, J., Mikow, M., Gizinski, S., Krol, M.(2017). MicroRNA expression patterns in canine mammary cancer show significant differences between metastatic and non-metastatic tumours. BMC Cancer 17,
42 Bustin, S.A., Benes, V., Nolan, T., Pfaffl, M.W. (2005). Quantitative real-time RT-PCR a perspective. J Mol Endocrinol 34, Bustin, S.A., Mueller, R. (2005). Real-time reverse transcription PCR (qrt-pcr) and its potential use in clinical diagnosis. Clinical Science 109, Fleige, S., Pfaffl, M.W.(2006). RNA integrity and the effect on the real-time qrt-pcr performance. Molecular Aspects of Medicine 27, Hui, K., Feng, Z.-P. (2013). Efficient experimental design and analysis of real-time PCR assays. Channels (Austin) 7, Invitrogen Corporation. (2002-4). SuperScript TM III Reverse Transcriptase kit. Invitrogen, Carlsbad, USA. Available at: [ ] Kolset,S.O., Tveit, H.(2008). Serglycin-Structure and biology. Cellular and Molecular Life Sciences 65, Korpetinou, A., Skandalis, S.S., Labropoulou, V.T., Smirlaki, G., Noulas, A., Karamanos, N.K., Theocharis, A.D.( 2014). Serglycin: At the Crossroad of Inflammation and Malignancy. Front. Oncol Korpetinou, A., Skandalis, S.S., Moustakas, A., Happonen, K.E., Tveit, H., Prydz, K., Labropoulou, V.T., Giannopoulou, E., Kalofonos, H.P., Blom, A.M., Karamanos, N.K., Theocharis, A.D.(2013). Serglycin Is Implicated in the Promotion of Aggressive Phenotype of Breast Cancer Cells. PLoS ONE 8, e Joosse, S.A., Gorges, T.M., Pantel, K., Biology, detection, and clinical implications of circulating tumor cells. EMBO Mol Med 7,
43 Manuali, E., De Giuseppe, A., Feliziani, F., Forti, K., Casciari, C., Marchesi, M.C., Pacifico, E., Pawłowski, K.M., Majchrzak, K., Król, M.(2012). CA 15 3 cell lines and tissue expression in canine mammary cancer and the correlation between serum levels and tumour histological grade. BMC Vet Res 8, Ohl, F., Jung, M., Xu, C., Stephan, C., Rabien, A., Burkhardt, M., Nitsche, A., Kristiansen,G., Loening, S.A., Radonic, A., Jung, K. (2005). Gene expression studies in protaste cancer tissue: which reference gen should be selected fore normalization?. J Mol Med, Pawłowski, K.M., Homa, A., Bulkowska, M., Majchrzak, K., Motyl, T., Król, M. (2013). Expression of inflammation-mediated cluster of genes as a new marker of canine mammary malignancy. Veterinary Research Communications 37, Pejler, G., Åbrink, M., Wernersson, S. (2009). Serglycin proteoglycan: Regulating the storage and activities of hematopoietic proteases. BioFactors 35, Promega Biotech AB.(2018). RQ1 RNase-Free DNase. Available at: [ ] Purushothaman, A., Bandari, S.K., Chandrashekar, D.S., Jones, R.J., Lee, H.C., Weber, D.M., Orlowski, R.Z. (2017). Chondroitin sulfate proteoglycan serglycin influences protein cargo loading and functions of tumor-derived exosomes. Oncotarget 8, QIAGEN. (2011). RT2 First Strand kit. Available at: [ ] 43
44 Roy, A., Attarha, S., Weishaupt, H., Edqvist, P.-H., Swartling, F.J., Bergqvist, M., Siebzehnrubl, F.A., Smits, A., Pontén, F., Tchougounova, E.(2017.) Serglycin as a potential biomarker for glioma: association of serglycin expression, extent of mast cell recruitment and glioblastoma progression. Oncotarget 8, Roy, A., Femel, J., Huijbers, E.J.M., Spillmann, D., Larsson, E., Ringvall, M., Olsson, A.-K., Åbrink, M., Targeting Serglycin Prevents Metastasis in Murine Mammary Carcinoma. PLoS One Thermo Fisher Scientific (2010), Thermo Scientific Nano Drop Spectrophotometers Nucleic Acid. Thermo Scientific, Carlsbad, USA. Available at: Scientific-NanoDrop-Products-Nucleic-Acid-Technical-Guide-EN.pdf [ ] Thermo Fisher Scientific (2016), TRIzol TM Reagent- Invitrogen. Thermo Scientific, Carlsbad, USA. Available at: [ ] Walker, N.J. (2002). A Technique Whose Time Has Come. Science 296, Wong, M., Medrano, J.(2005). Real-time PCR for mrna quantitation. BioTechniques 39, Ye, J., Coulouris, G., Zaretskaya, I., Cutcutache, I., Rozen, S., Madden, T.L.(2012). Primer-BLAST: A tool to design target-specific primers for polymerase chain reaction. BMC Bioinformatics 13,
Syns du, finns du? Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap
Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap Syns du, finns du? - En studie över användningen av SEO, PPC och sociala medier som strategiska kommunikationsverktyg i svenska företag
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET National Swedish parental studies using the same methodology have been performed in 1980, 2000, 2006 and 2011 (current study). In 1980 and 2000 the studies
A study of the performance
A study of the performance and utilization of the Swedish railway network Anders Lindfeldt Royal Institute of Technology 2011-02-03 Introduction The load on the railway network increases steadily, and
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private
EVALUATION OF ADVANCED BIOSTATISTICS COURSE, part I
UMEÅ UNIVERSITY Faculty of Medicine Spring 2012 EVALUATION OF ADVANCED BIOSTATISTICS COURSE, part I 1) Name of the course: Logistic regression 2) What is your postgraduate subject? Tidig reumatoid artrit
Om oss DET PERFEKTA KOMPLEMENTET THE PERFECT COMPLETION 04 EN BINZ ÄR PRECIS SÅ BRA SOM DU FÖRVÄNTAR DIG A BINZ IS JUST AS GOOD AS YOU THINK 05
Om oss Vi på Binz är glada att du är intresserad av vårt support-system för begravningsbilar. Sedan mer än 75 år tillverkar vi specialfordon i Lorch för de flesta olika användningsändamål, och detta enligt
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols.
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols. ExcelLoad simulates the maximum forces that may appear during a transport no matter if the
Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM
Rastercell Digital Rastrering Hybridraster, Rastervinkel, Rotation av digitala bilder, AM/FM rastrering Sasan Gooran (VT 2007) Önskat mått * 2* rastertätheten = inläsningsupplösning originalets mått 2
Methods to increase work-related activities within the curricula. S Nyberg and Pr U Edlund KTH SoTL 2017
Methods to increase work-related activities within the curricula S Nyberg and Pr U Edlund KTH SoTL 2017 Aim of the project Increase Work-related Learning Inspire theachers Motivate students Understanding
Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands
Skill-mix innovation in the Netherlands dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands m.kroezen@erasmusmc.nl The skill-mix innovation of interest BEFORE AFTER How did the Netherlands
Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:
Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH 2016 Anne Håkansson All rights reserved. Svårt Harmonisera -> Introduktion, delar: Fråga/
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
EBBA2 European Breeding Bird Atlas
Methodology Sergi Herrando, Verena Keller, Petr Voříšek et al. objectives 1. To document breeding evidence for all bird species at a resolution of 50x50 km 2. To estimate abundance for all bird species
x 2 2(x + 2), f(x) = by utilizing the guidance given by asymptotes and stationary points. γ : 8xy x 2 y 3 = 12 x + 3
MÄLARDALEN UNIVERSITY School of Education, Culture and Communication Department of Applied Mathematics Examiner: Lars-Göran Larsson EXAMINATION IN MATHEMATICS MAA151 Single Variable Calculus, TEN2 Date:
Measuring child participation in immunization registries: two national surveys, 2001
Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of
2.1 Installation of driver using Internet Installation of driver from disk... 3
&RQWHQW,QQHKnOO 0DQXDOÃ(QJOLVKÃ'HPRGULYHU )RUHZRUG Ã,QWURGXFWLRQ Ã,QVWDOOÃDQGÃXSGDWHÃGULYHU 2.1 Installation of driver using Internet... 3 2.2 Installation of driver from disk... 3 Ã&RQQHFWLQJÃWKHÃWHUPLQDOÃWRÃWKHÃ3/&ÃV\VWHP
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen
Examensarbete Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen Malin Carlström, Sandra Mårtensson 2010-05-21 Ämne: Informationslogistik Nivå: Kandidat Kurskod: 2IL00E Projektmodell
Tunga metaller / Heavy metals ICH Q3d & Farmakope. Rolf Arndt Cambrex Karlskoga
Tunga metaller / Heavy metals ICH Q3d & Farmakope Rolf Arndt Cambrex Karlskoga Tunga metaller / Heavy metals Rolf Arndt -Quality Assurance Cambrex Karlskoga - Svenska Farmakopekommitten / Working Party
Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance?
r Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance? - A pilot study Susan Sarwari and Mohammed Fazil Supervisors: Camilla Ahlgren Department of
This exam consists of four problems. The maximum sum of points is 20. The marks 3, 4 and 5 require a minimum
Examiner Linus Carlsson 016-01-07 3 hours In English Exam (TEN) Probability theory and statistical inference MAA137 Aids: Collection of Formulas, Concepts and Tables Pocket calculator This exam consists
District Application for Partnership
ESC Region Texas Regional Collaboratives in Math and Science District Application for Partnership 2013-2014 Applying for (check all that apply) Math Science District Name: District Contacts Name E-mail
The Algerian Law of Association. Hotel Rivoli Casablanca October 22-23, 2009
The Algerian Law of Association Hotel Rivoli Casablanca October 22-23, 2009 Introduction WHY the Associations? NGO s are indispensable to the very survival of societal progress Local, National or International
Thesis work at McNeil AB Evaluation/remediation of psychosocial risks and hazards.
Evaluation/remediation of psychosocial risks and hazards. Help us to create the path forward for managing psychosocial risks in the work environment by looking into different tools/support/thesis and benchmarking
State Examinations Commission
State Examinations Commission Marking schemes published by the State Examinations Commission are not intended to be standalone documents. They are an essential resource for examiners who receive training
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
Aborter i Sverige 2008 januari juni
HÄLSA OCH SJUKDOMAR 2008:9 Aborter i Sverige 2008 januari juni Preliminär sammanställning SVERIGES OFFICIELLA STATISTIK Statistik Hälsa och Sjukdomar Aborter i Sverige 2008 januari juni Preliminär sammanställning
Boiler with heatpump / Värmepumpsberedare
Boiler with heatpump / Värmepumpsberedare QUICK START GUIDE / SNABBSTART GUIDE More information and instruction videos on our homepage www.indol.se Mer information och instruktionsvideos på vår hemsida
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
REHAB BACKGROUND TO REMEMBER AND CONSIDER
Training in water REHAB BACKGROUND TO REMEMBER AND CONSIDER PHASE I: PROLIFERATION PROTECTION, 0-6 WEEKS PHASE II: TRANSITION PROGRESSION, 7-12 WEEKS PHASE III: REMODELLING FUNCTION, 13-32 WEEKS PHASE
Materialplanering och styrning på grundnivå. 7,5 högskolepoäng
Materialplanering och styrning på grundnivå Provmoment: Ladokkod: Tentamen ges för: Skriftlig tentamen TI6612 Af3-Ma, Al3, Log3,IBE3 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles
Health café. Self help groups. Learning café. Focus on support to people with chronic diseases and their families
Health café Resources Meeting places Live library Storytellers Self help groups Heart s house Volunteers Health coaches Learning café Recovery Health café project Focus on support to people with chronic
Eternal Employment Financial Feasibility Study
Eternal Employment Financial Feasibility Study 2017-08-14 Assumptions Available amount: 6 MSEK Time until first payment: 7 years Current wage: 21 600 SEK/month (corresponding to labour costs of 350 500
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
Ett hållbart boende A sustainable living. Mikael Hassel. Handledare/ Supervisor. Examiner. Katarina Lundeberg/Fredric Benesch
Ett hållbart boende A sustainable living Mikael Hassel Handledare/ Supervisor Examinator/ Examiner atarina Lundeberg/redric Benesch Jes us Azpeitia Examensarbete inom arkitektur, grundnivå 15 hp Degree
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, EITA50, LP4, 209 Inlämningsuppgift av 2, Assignment out of 2 Inlämningstid: Lämnas in senast kl
Validering av kvalitetsregisterdata vad duger data till?
Validering av kvalitetsregisterdata vad duger data till? Anders Ekbom, Professor Karolinska Institutet Institutionen för medicin Solna Enheten för klinisk epidemiologi Karolinska Universitetssjukhuset
Theory 1. Summer Term 2010
Theory 1 Summer Term 2010 Robert Elsässer 1 Introduction Summer Term 2010 Robert Elsässer Prerequisite of Theory I Programming language, such as C++ Basic knowledge on data structures and algorithms, mathematics
Uttagning för D21E och H21E
Uttagning för D21E och H21E Anmälan till seniorelitklasserna vid O-Ringen i Kolmården 2019 är öppen fram till och med fredag 19 juli klockan 12.00. 80 deltagare per klass tas ut. En rangordningslista med
Könsfördelningen inom kataraktkirurgin. Mats Lundström
Könsfördelningen inom kataraktkirurgin Mats Lundström Innehåll Fördelning av antal operationer utveckling Skillnader i väntetid Effekt av NIKE Skillnader i synskärpa före operation Skillnader i Catquest-9SF
Examensarbete i matematik på grundnivå med inriktning mot optimeringslära och systemteori
Examensarbete i matematik på grundnivå med inriktning mot optimeringslära och systemteori (kurskod SA104X, 15hp, VT15) http://www.math.kth.se/optsyst/grundutbildning/kex/ Förkunskaper Det är ett krav att
Klicka här för att ändra format
på 1 på Marianne Andrén General Manager marianne.andren@sandviken.se Sandbacka Park Högbovägen 45 SE 811 32 Sandviken Telephone: +46 26 24 21 33 Mobile: +46 70 230 67 41 www.isea.se 2 From the Off e project
Hur fattar samhället beslut när forskarna är oeniga?
Hur fattar samhället beslut när forskarna är oeniga? Martin Peterson m.peterson@tue.nl www.martinpeterson.org Oenighet om vad? 1.Hårda vetenskapliga fakta? ( X observerades vid tid t ) 1.Den vetenskapliga
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
Webbregistrering pa kurs och termin
Webbregistrering pa kurs och termin 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en länk till Studieöversiktssidan. På den sidan
The Academic Career Path - choices and chances ULRIKKE VOSS
The Academic Career Path - choices and chances ULRIKKE VOSS The Academic Path Professur söks i konkurrens 5llsvidareanställning D O K T O R S E X Postdoktor!dsbegränsad max 2 år enligt avtal Biträdande
Kursplan. NA3009 Ekonomi och ledarskap. 7,5 högskolepoäng, Avancerad nivå 1. Economics of Leadership
Kursplan NA3009 Ekonomi och ledarskap 7,5 högskolepoäng, Avancerad nivå 1 Economics of Leadership 7.5 Higher Education Credits *), Second Cycle Level 1 Mål Studenterna skall efter genomgången kurs: kunna
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
Bridging the gap - state-of-the-art testing research, Explanea, and why you should care
Bridging the gap - state-of-the-art testing research, Explanea, and why you should care Robert Feldt Blekinge Institute of Technology & Chalmers All animations have been excluded in this pdf version! onsdag
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
Kurskod: TAMS11 Provkod: TENB 07 April 2015, 14:00-18:00. English Version
Kurskod: TAMS11 Provkod: TENB 07 April 2015, 14:00-18:00 Examiner: Xiangfeng Yang (Tel: 070 2234765). Please answer in ENGLISH if you can. a. You are allowed to use: a calculator; formel -och tabellsamling
Läkemedelsverkets Farmakovigilansdag
Swedish Medical Products Agency s Patient- and Consumer Advisory Board Brita Sjöström May 29, 2018 Patientrådet@mpa.se https://lakemedelsverket.se/patient-konsument-rad The vision of the Swedish Medical
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
Kursplan. JP1040 Japanska III: Språkfärdighet. 15 högskolepoäng, Grundnivå 1. Japanese III: Language Proficiency
Kursplan JP1040 Japanska III: Språkfärdighet 15 högskolepoäng, Grundnivå 1 Japanese III: Language Proficiency 15 Higher Education Credits *), First Cycle Level 1 Mål Efter avslutad kurs ska de studerande
Läkemedelsverkets Farmakovigilansdag 19 maj 2015
Läkemedelsverkets Farmakovigilansdag 19 maj 2015 Incidence and outcome of paracetamol poisoning Rolf Gedeborg Associate Professor, Scientific Director of Epidemiology and Pharmacovigilance Unit for Scientific
Mönster. Ulf Cederling Växjö University Ulf.Cederling@msi.vxu.se http://www.msi.vxu.se/~ulfce. Slide 1
Mönster Ulf Cederling Växjö University UlfCederling@msivxuse http://wwwmsivxuse/~ulfce Slide 1 Beskrivningsmall Beskrivningsmallen är inspirerad av den som användes på AG Communication Systems (AGCS) Linda
TN LR TT mg/l N b) 2,6-Dimethylphenole
TN LR TT 0.5-14 mg/l N b) 2,6-Dimethylphenole 283 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer
Application Note SW
TWINSAFE DIAGNOSTIK TwinSAFE är Beckhoffs safety-lösning. En översikt över hur TwinSAFE är implementerat, såväl fysiskt som logiskt, finns på hemsidan: http://www.beckhoff.se/english/highlights/fsoe/default.htm?id=35572043381
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
Kundfokus Kunden och kundens behov är centrala i alla våra projekt
D-Miljö AB bidrar till en renare miljö genom projekt där vi hjälper våra kunder att undersöka och sanera förorenad mark och förorenat grundvatten. Vi bistår dig som kund från projektets start till dess
Pre exam I PATHOLOGY FOR MEDICAL STUDENTS
Pre exam I PATHOLOGY FOR MEDICAL STUDENTS 2003-11-04 Max 42 credit points Pass 27 credit points NAME:.. Good Luck! 1 Define metaplasia. Provide 3 clinical examples of common metaplastic changes. 4 p Vad
Robust och energieffektiv styrning av tågtrafik
1 Robust och energieffektiv styrning av tågtrafik - CATO - Forskning inom OnTime - Vidareutveckling och möjligheter KAJT, temadag om punktlighet 2014-11-13 Tomas Lidén Transrail Sweden AB Dagens trafikledning
Vässa kraven och förbättra samarbetet med hjälp av Behaviour Driven Development Anna Fallqvist Eriksson
Vässa kraven och förbättra samarbetet med hjälp av Behaviour Driven Development Anna Fallqvist Eriksson Kravhantering På Riktigt, 16 maj 2018 Anna Fallqvist Eriksson Agilista, Go See Talents linkedin.com/in/anfaer/
12.6 Heat equation, Wave equation
12.6 Heat equation, 12.2-3 Wave equation Eugenia Malinnikova, NTNU September 26, 2017 1 Heat equation in higher dimensions The heat equation in higher dimensions (two or three) is u t ( = c 2 2 ) u x 2
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
TN HR TT b) i) 5-140 mg/l N 2,6-Dimethylphenole 284 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the
Hållbar utveckling i kurser lå 16-17
Hållbar utveckling i kurser lå 16-17 : Jag tillhör akademin / My position is in the School of Jag tillhör akademin / My position is in the School of Humaniora och medier / Humanities and Media Studies
Second handbook of research on mathematics teaching and learning (NCTM)
Second handbook of research on mathematics teaching and learning (NCTM) The effects of classroom mathematics teaching on students learning. (Hiebert & Grouws, 2007) Inledande observationer Undervisningens
SEC-03-DRS-2016: Validation of biological toxins measurements after an incident: Development of tools and procedures for quality control
SEC-03-DRS-2016: Validation of biological toxins measurements after an incident: Development of tools and procedures for quality control EQuATox - Establishment of Quality Assurances for the Detection
Arbetsplatsträff 5 april, 2017 Workplace meeting April 5, 2017
Arbetsplatsträff 5 april, 2017 Workplace meeting April 5, 2017 Ärenden: - Inför beslutsmötet - Forskningsinformation - Arbetsmiljö och Infrastruktur - Personaldagar - Övriga frågor Agenda: - Prior to the
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 17 August 2015, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 17 August 2015, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 2234765). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
Schenker Privpak AB Telefon 033-178300 VAT Nr. SE556124398001 Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr 033-257475 Säte: Borås
Schenker Privpak AB Interface documentation for web service packageservices.asmx 2010-10-21 Version: 1.2.2 Doc. no.: I04304 Sida 2 av 14 Revision history Datum Version Sign. Kommentar 2010-02-18 1.0.0
3 rd October 2017
3 rd October 2017 Failures of Scaffold False work Failures Form work Bursting Trench Support Failure Hoarding Failures Can be expensive and result in fatalities and serious injuries Cardiff
Image quality Technical/physical aspects
(Member of IUPESM) Image quality Technical/physical aspects Nationella kvalitetsdokument för digital radiologi AG1 Michael Sandborg och Jalil Bahar Radiofysikavdelningen Linköping 2007-05-10 Requirements
Fysisk aktivitet och hjärnan
1 Fysisk aktivitet och hjärnan Professor Ingibjörg H. Jónsdóttir Hälsan och stressmedicin, VGR Institutionen för kost och idrottsvetenskap Göteborgs Universitet Kvinnlig simultankapacitet troligen en myt
Documentation SN 3102
This document has been created by AHDS History and is based on information supplied by the depositor /////////////////////////////////////////////////////////// THE EUROPEAN STATE FINANCE DATABASE (Director:
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik Kurs: MA152G Matematisk Analys MA123G Matematisk analys för ingenjörer Tentamensdag: 2012-03-24 kl 14.30-19.30 Hjälpmedel : Inga hjälpmedel
Kursplan. AB1029 Introduktion till Professionell kommunikation - mer än bara samtal. 7,5 högskolepoäng, Grundnivå 1
Kursplan AB1029 Introduktion till Professionell kommunikation - mer än bara samtal 7,5 högskolepoäng, Grundnivå 1 Introduction to Professional Communication - more than just conversation 7.5 Higher Education
KOL med primärvårdsperspektiv ERS 2014. Björn Ställberg Gagnef vårdcentral
KOL med primärvårdsperspektiv ERS 2014 Björn Ställberg Gagnef vårdcentral Nationella programrådet Astma och KOL Identifierade insatsområden Nationella programrådet Astma och KOLinsatsområden för KOL Diagnostik,
Kursutvärderare: IT-kansliet/Christina Waller. General opinions: 1. What is your general feeling about the course? Antal svar: 17 Medelvärde: 2.
Kursvärdering - sammanställning Kurs: 2AD510 Objektorienterad programmering, 5p Antal reg: 75 Program: 2AD512 Objektorienterad programmering DV1, 4p Antal svar: 17 Period: Period 2 H04 Svarsfrekvens: 22%
http://marvel.com/games/play/31/create_your_own_superhero http://www.heromachine.com/
Name: Year 9 w. 4-7 The leading comic book publisher, Marvel Comics, is starting a new comic, which it hopes will become as popular as its classics Spiderman, Superman and The Incredible Hulk. Your job
Schenker Privpak AB Telefon VAT Nr. SE Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr Säte: Borås
Schenker Privpak AB Interface documentation for web service packageservices.asmx 2012-09-01 Version: 1.0.0 Doc. no.: I04304b Sida 2 av 7 Revision history Datum Version Sign. Kommentar 2012-09-01 1.0.0
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
Användning av Erasmus+ deltagarrapporter för uppföljning
Användning av Erasmus+ deltagarrapporter för uppföljning Internationaliseringsdagarna 2016 2016-11-02 Anders Clarhäll Participant Report Form Identification of the Participant and General Information (Motivation)
SVENSK STANDARD SS-ISO :2010/Amd 1:2010
SVENSK STANDARD SS-ISO 14839-1:2010/Amd 1:2010 Fastställd/Approved: 2010-11-08 Publicerad/Published: 2010-11-30 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 01.040.17; 17.160 Vibration och stöt
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
Formaldehyde M. TT 0.1-5 mg/l HCHO SO 4 / Chromotropic acid 177 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption
Anmälan av avsiktsförklaring om samarbete mellan Merck Sharp & Dohme AB (MSD AB) och Stockholms läns landsting
1 (2) Landstingsradsberedningen SKRIVELSE 2014-06-04 LS 1403-0357 LANDSTINGSSTYRELSEN Landstingsstyrelsen 1 4-06- 1 7 0 0 0 1 6 ' Anmälan av avsiktsförklaring om samarbete mellan Merck Sharp & Dohme AB
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
Signatursida följer/signature page follows
Styrelsens i Flexenclosure AB (publ) redogörelse enligt 13 kap. 6 och 14 kap. 8 aktiebolagslagen över förslaget till beslut om ökning av aktiekapitalet genom emission av aktier och emission av teckningsoptioner