Studies of recombinant forms of Aleuria aurantia lectin
|
|
- Torbjörn Sandström
- för 6 år sedan
- Visningar:
Transkript
1 Linköping Studies in Health Science No. 105 Studies of recombinant forms of Aleuria aurantia lectin Johan Olausson Department of Clinical and Experimental Medicine, Faculty of Health Sciences Linköpings Universitet, SE Linköping. Sweden Linköping 2009
2 Johan Olausson, 2009 Paper I has been reprinted with permission from the copyright holder. ISBN ISSN
3 Table of contents List of papers... 6 Populärvetenskaplig sammanfattning... 7 Abstract... 8 Abbreviations... 9 Background Protein carbohydrate interactions...10 Lectins...10 Classification of lectins...11 Lectins as research tools...12 Aleuria aurantia lectin...12 Structure of AAL...12 Binding characteristics of AAL...13 Fucose...13 Fucosylation as a disease marker...14 Aims of the thesis Paper I...15 Paper II...15 Methods Construction of plasmids...16 His-tagged raal Paper I His-tagged monomeric AAL Paper II His-tagged monovalent AAL Paper II Circular dichroism Paper I and II...17 Enzyme Linked Lectin Assay Paper I and II...19 Surface Plasmon Resonance Paper I and II Tryptophan fluorescence Paper I...22 Hemagglutination Paper I and II...22 Analytical Ultracentrifugation Paper II...23 Results and Discussion Finding a high affinity binding site in recombinant AAL Paper I...25 Construction of a monomeric and a monovalent fucose binder Paper II
4 Tack! References
5 List of papers This thesis is based on the following papers; I. Olausson, J., Tibell, L., Jonsson, B-H. and Påhlsson, P. (2008) Detection of a high affinity binding site in recombinant Aleuria aurantia lectin. Glycoconj J. 25, II. Olausson, J., Tibell, L., Jonsson, B-H. and Påhlsson, P. (2009) Production and characterization of a monomeric and a monovalent form of Aleuria aurantia lectin. In manuscript 6
6 Populärvetenskaplig sammanfattning Förändringar av de kolhydrater som sitter fast på de flesta av våra proteiner i kroppen har kunnat knytas till flera olika typer av sjukdomar. Man säger att sjukdomar ger ett förändrat kolhydratmönster. Till exempel uppvisar alla typer av tumörceller ett förändrat kolhydratmönster jämfört med normalvävnad. Vår forskargrupp har tidigare visat att proteiner som finns i blodbanan (plasmaproteiner) ofta uppvisar kolhydratmönster som går att relatera till en viss sjukdom. Ett exempel är plasmaproteinet orosomukoid vars förändringar i kolhydratmönstret har visat sig kunna användas för diagnostik av till exempellevercirrhos. För att mäta förändringar av kolhydratmönstret som kan uppstå vid sjukdom används proteiner som känner igen och binder till kolhydrater. Dessa naturligt förekommande kolhydratbindande proteiner kallas lektiner. Vi har nyligen visat att ett lektin vid namn Aleuria aurantia lektin (AAL) kan användas för att hitta de förändringar i kolhydratmönstret som uppkommer vid leversjukdom. AAL binder till en kolhydrat som kallas fukos och det är just mängden av fukos som förändras vid leversjukdom. I detta arbete har vi detaljstuderat AAL för att få bättre kunskap om hur AAL binder till fukos. Detta för att det ska vara möjligt att förbättra AALs förmåga att upptäcka olika sjukdomstillstånd. Vi har producerat AAL i bakterier och visar att bakterieproducerat AAL kan binda mycket starkt till fukos. Vi har också kunnat göra två mindre former av bakterieproducerat AAL som båda kan binda fukos. Den minsta av dessa former binder något annorlunda till fukos än de övriga två AAL formerna. Denna AAL form tror vi kan ha nya användningsområden inom diagnostik. Studierna har dels gett oss större förståelse för hur AAL binder till fukos men de visar också att DNA-teknik kan användas för att påverka ursprungsegenskaperna hos ett lektin. De DNA-tekniska metoderna kan vara viktiga redskap för att skapa nya tillförlitliga kolhydrat bindande reagens för sjukdomsdiagnostik. 7
7 Abstract The presented work describes construction and analysis of recombinantly produced forms of Aleuria aurantia lectin (AAL). The binding properties of the produced AAL forms were studied using techniques such as tryptophan fluorescence, hemagglutination analysis, ELISA and surface plasmon resonance analysis. Lectins are proteins that are ubiquitous in nature with the ability to bind specifically to different types of carbohydrates. The physiological function of different lectins is not always known, but they are involved in many recognition events at molecular and cellular levels. In research, lectins are widely used for structural and functional studies of complex carbohydrates, and they are also used to detect changes in the carbohydrate pattern on glycoproteins in different diseases. With the use of recombinant technology it is now possible to refine properties of lectins such as decreasing the valency and alter specificity and affinity. This may be a way of constructing more suitable reagents for use in diagnostic glycosylation analysis assays. AAL has been extensively used in different types of research for its ability to bind the monosaccharide fucose and to fucose-containing oligosaccharides. It is composed of two identical subunits where each subunit contains five binding sites for fucose. AAL was expressed recombinantly (raal) and its properties was investigated. These studies reveled that one of the binding sites in raal had unusually high affinities towards fucose and fucosecontaining oligosaccharides with K d -values in the nanomolar range. This binding site is not detected in AAL that have been exposed to fucose during its purification, and therefore we proposed that this site may be blocked with free fucose in commercial preparations of AAL. Normally lectin-oligosaccharide interactions are considered to be of weak affinity, so the finding of a high affinity site was interesting for the future study of recombinant forms of AAL. The next step was to produce recombinant AAL forms with decreased valency. This was done using site-directed mutagenesis. First a monomeric form of AAL (maal) was constructed and then a monovalent form of AAL, containing only one fucose-binding site (S2-AAL) was constructed. Both of these forms had retained ability to bind fucose. The binding characteristics of maal were similar to that of raal, but maal showed decreased hemagglutinating activity. S2-AAL showed a lower binding affinity to fucosylated oligosaccharides and did not bind to sialylated fuco-oligosaccharides such as sialyl-lewisx. This study shows that molecular engineering techniques could be important tools for development of reliable and specific diagnostic and biological assays for carbohydrate analysis. 8
8 Abbreviations AAA AAL AGP BSA CD ELLA Fuc GAG Gal GalNAc GlcNAc HA HAI ITC K d k off k on maal Man MIC naal Neu5Ac PA IIL PBS RA raal RSL S2-AAL SE SPR SV Anguilla anguilla agglutinin Aleuria aurantia lectin α1-acid glycoprotein Bovine serum albumin Circular dichroism Enzyme linked lectin assay Fucose Glycosaminoglycan Galactose N-acetylgalactosamine N-acetylglucosamine Hemagglutination Hemagglutination inhibition Isothermal titration calorimetry Dissociation constants Dissociation rate constant Association rate constant His-tagged recombinant monomeric Aleuria aurantia lectin (AAL-Y6R) Mannose Minimum inhibiting concentration Native Aleuria aurantia lectin Sialic acid Pseudomonas aeruginosa lectin Phosphate buffered saline Rheumatoid arthritis His-tagged recombinant Aleuria aurantia lectin Ralstonia solanacearum lectin His-tagged recombinant site 2 of Aleuria aurantia lectin Sedimentation equilibrium Surface plasmon resonance Sedimentation velocity 9
9 Background Protein-carbohydrate interactions Protein-carbohydrate interactions are normally considered as weak affinity interactions. Weak biological interactions are determined by a dissociation constant of about mm [1]. Protein-carbohydrate binding is mainly formed by two types of interactions: hydrogen bonds formed from the hydroxyl groups of the carbohydrate, and van der Waals interactions formed by stacking of the hydrophobic face of carbohydrates to the side chains of aromatic amino acids [2]. The protein-carbohydrate interactions in biological processes is often multivalent interaction between protein and carbohydrate, that creates an avidity effect that compensate the low affinity generally observed for each individual carbohydrate binding site. In the human body, several biological processes are mediated by weak interactions between proteins and carbohydrates, one example being rolling of leukocytes along the endothelial surface during an inflammatory process [3]. During rolling, the speed of the leukocytes decreases so that they can extravasate through the endothelium to the site of inflammation. This rolling event is mediated by the selectin family of cell adhesion molecules including L-, P-, and E-selectin [3, 4]. L-selectin is expressed on the surface of leukocytes whereas P- and E-selectins are expressed on the surface of endothelial cells. L-selectin interacts with carbohydrates on endothelial cells, while P-and E-selectins interact with carbohydrates on the leukocytes [3, 4]. Lectins Proteins that interact with naturally occurring carbohydrates are generally referred to as lectins. When first discovered lectins were defined as phytoagglutinins because they were commonly detected by their ability to induce erythrocyte agglutination and were found almost exclusively in plants. This definition was later revised to define lectins as a class of proteins of non-immune origin that binds carbohydrates without modifying them. This definition is still used, but today a broader definition of lectins is starting to be accepted. Now lectins are defined as proteins which specifically bind (or crosslink) carbohydrates. One exception to the former definition is actually the oldest known lectin called ricin [5]. This lectin has been revealed to act as the enzyme RNA-N-glycosidase [6]. Today it is known that lectins are ubiquitous in nature and found in all kinds of organisms such as animals, fungi, bacteria and even viruses [7]. Lectins are structurally different, and their binding properties are dependent on the exact three-dimensional structure and amino acid sequence of the lectin [7, 8]. A specific lectin usually binds a certain carbohydrate epitope [9]. The biological function for most lectins is still unclear. The function differs depending on the type of lectin and the species that expresses the lectin but in general they are important in many recognition events at molecular or cellular level. It is known that bacteria uses lectins to bind host carbohydrates at epithelial cell surfaces and use these attachment points for further 10
10 colonization [10]. In fungi, lectins can be of importance for host association (symbiosis or parasitism) [11]. In humans lectins are involved in cell-cell recognition, leukocyte rolling, cancer metastasis, fertilization and microbial adherence to host tissues [7, 12, 13]. Plant lectins are proposed to be involved in the defense against pathogens since lectins bind to glycoproteins on the surface of parasites [14] Classification of lectins Lectins are not easily classified but some attempts have been made. One way of classifying lectins is according to the small carbohydrate haptens they recognize, e.g. mannose - (Man), galactose/n-acetylgalactosamine- (Gal/GalNAc), N-acetylglucosamine- (GlcNAc), fucose- (Fuc) and sialic acid- (Neu5Ac) binding lectins [15]. This conventional method is practically useful but it is not necessarily relevant for refined specificity because lectins in the same category, for example galactose-specific lectins, can show different binding specificity [16]. Since lectins are proteins it is also possible to classify lectins through their evolutionary kinship. Animal lectins are generally classified according to homologies in the carbohydrate recognition domain [12, 17, 18]. Some examples of animal lectin families are P-type, C-type, Galectins (former S-type), I-type and Glycosaminoglycan-binding proteins. The special features of these families are: P-type lectins are lectins that recognize Man-6-P [17]. C-type lectins are a large family with diverse structure and function that requires calcium for recognition of carbohydrates (not all calcium-requiring lectins are C-type lectins) [17]. Selectins are a subfamily of C-type lectins distinguished by their specific function in leukocyte adhesion to endothelial cells through sialyl-lewisx recognition [3, 19]. Galectins all share galactose specificity and requires free thiols for stability [16]. I-type lectins are members of the immunoglobulin superfamily. Siglecs are a subfamily of these molecules that specifically recognize sialic acids [18]. Glycosaminoglycan-binding proteins (GAG-binders) binds with clusters of positively charged amino acid that line up against internal regions of the anionic GAG chains. This is unlike other lectins that bind their carbohydrate ligand with a relatively narrow binding pocket [20]. Plant lectins have also been classified in families and the largest and most studied is the legume lectin family [21]. These lectins have a shared consensus sequence and most of them require Ca 2+ and Mn 2+ for carbohydrate binding. But since there is such a tremendous diversity of carbohydrate-binding specificities among plant lectins they are often classified according to the carbohydrate they bind. The three dimensional structure has been solved for more than 550 lectins and they all show proteins that are oligomeric, usually made up of two or four subunits (homo- or hetromers) 11
11 with typically one single carbohydrate binding site per monomer. Based on their tertiary structure lectins have been divided into different folding families. Most of these families contain several β-strands in the core structure [21, 22]. The tertiary structures are similar within many lectin families [22]. This similarity in the tertiary structure has been extensively studied for plant lectins and these studies suggest that lectins are conserved throughout evolution and thus may play important physiological functions [23-25]. Lectins as research tools Since lectins recognize specific carbohydrate structures they are used to detect and separate cells, bacteria, and viruses with respect to their carbohydrate content. Lectins are also useful tools for investigating the structure and function of different carbohydrate chains on glycoproteins and glycolipids [26, 27]. In clinical research, lectins can be used to detect changes in the carbohydrate pattern on glycoproteins in different diseases [28-35]. Today many researchers consider lectins as "deciphers of the glycocode". The use of lectins may be great tools to analyze glycosylation patterns and to facilitate the development of novel treatments for many diseases in which carbohydrate recognition plays a key role. To achieve this goal, it is important to learn more about lectin structure, function and binding properties. Aleuria aurantia lectin The Aleuria aurantia lectin is obtained from the mushroom Aleuria aurantia and was initially characterized by its binding to fucosylated blood group antigens [36]. When AAL was characterized by Kochibe et al. they showed that AAL had the ability to precipitate blood group substances in an agar gel that contained 0.5 % of SDS (sodium deoxycholate), Triton X-100 or Tween 80 [36]. The fact that AAL tolerated these detergents made it a promising tool for purifying and analyzing fucosylated oligosaccharides and glycoproteins. AAL has during the years been widely used to estimate the extent of fucosylation on glycoproteins and to fraction glycoproteins [28, 37-41]. AAL has shown to be a non-glycosylated dimer with two identical 312-amino acid subunits and both of these subunits specifically recognize fucose [42, 43]. Each subunit has a calculated molecular weight of about Dalton [44]. Structure of AAL Crystallisation studies of AAL show that each AAL monomer consists of a six-bladed β- propeller fold and of a small antiparallel two-stranded β-sheet [42, 43]. The antiparallel twostranded β-sheets have an important role in the dimerization of AAL [42]. Between each of the six β-blades, a cleft is formed by the loops that connect the blades. Fucose can bind to five of these six clefts (site 1-5) in each monomer [42, 43]. AAL differs from other fucose-specific lectins, such as Anguilla anguilla agglutinin (AAA, isolated from the serum of eel) and Pseudomonas aeruginosa lectin (PA IIL, isolated from the bacteria Pseudomonas aeruginosa) that also forms dimers but only have one fucose-binding site per monomer [45, 46]. The recently characterized fucose-binding lectin from the bacterium Ralstonia solanacearum (RSL) forms trimers with two binding sites per monomer [47, 48]. 12
12 Before the determination of the crystal structure of AAL, no lectins had been found in the group of six-folded β-propeller proteins. However when RSL was crystallized it also was included in the group of six-folded β-propeller proteins [48]. RSL forms a homotrimer that reproduces a six-bladed β-propeller fold [48]. Besides these two lectins a couple of other proteins are included in this family, for example glucose dehydrogenase and the low-density lipoprotein (LDL) receptor [22]. In contrast to other six-bladed proteins almost all residues in AAL and RSL are used to form the propeller structure, and therefore AAL and RSL form the most compact structures among all known six-bladed proteins [42, 43, 22]. AAL also differs from other β-propeller proteins, which normally are disc like, in the way that AAL monomers are shaped like short cylinders with a hydrophobic central cavity [42, 43]. The dimerization of AAL creates a back to back association of the two cylinder-shaped monomers with the fucose-binding sites exposed to the solvent on each side of the dimer [42]. The AAL-monomers that forms the dimer are almost equivalent with the exception of a marginal contact between site 4 in one monomer and site 5 in the other monomer [42]. Binding characteristics of AAL The dissociation constant (K d ) for interaction between free fucose and AAL has been determined to 16 µm using equilibrium dialysis [36]. However, since AAL has multiple binding sites for fucose this value represents an average K d -value for all binding sites. The crystal structure of AAL was first determined by Wimmerova et al. [42] who showed that each AAL monomer could bind five fucose residues. In a similar study performed by Fujihashi et al. it was shown that three fucose molecules per monomer at sites 1, 2 and 4 were present after dialysis against a fucose-free buffer. This indicated that the binding affinity for fucose was higher at sites 1, 2 and 4 than at sites 3 and 5. Each binding sites in AAL includes arginine, glutamic acid and tryptophan as characteristic amino acids. All of these amino acids form hydrogen bonds with fucose [42]. In site 2 seven hydrogen bonds are formed between fucose and AAL, in site 4 six hydrogen bonds are formed whereas 5 hydrogen bonds are formed between AAL and fucose in site 1, 3 and 5 [42]. This probably gives site 2 the highest affinity for fucose followed by site 4. AAL has been shown to bind to fucosylated oligosaccharides irrespective of linkage (Fucα1-2, Fucα1-3, Fucα1-4 or Fucα1-6). However, affinity for oligosaccharides with α1-6 linked fucose is somewhat higher than for the other linkages. Therefore AAL has mostly been used for detection and fractionation of oligosaccharides containing α1-6 linked fucose [38, 44, 49]. Studies on whether there is specificity differences between the individual binding sites in AAL have not been performed. Fucose Fucose is a 6-deoxyhexose (Fig. 1) and a common component of many N- and O-linked glycans and glycolipids produced by mammalian cells. In contrast to other hexoses in mammals fucose has an L-configuration [50]. Fucosyltransferases (FucTs) are responsible for 13
13 the catalysis of fucose transfer from donor guanosine-diphosphate fucose to various acceptor molecules including oligosaccharides, glycoproteins, and glycolipids [51]. Fucose normally exists as a terminal modification but it can also serve as substrate for the addition of other monosaccharides [52]. Fucose is commonly linked α-1,2 to Gal or α-1,3, α-1,4 or α-1,6 to GlcNAc. Fucose linked α-1,6 is commonly found to the reducing terminal GlcNAc on complex type N-linked glycans [51]. Fucose linked α-1,2 to Gal forms the H antigen which is the precursor structure for formation of the A and B blood group antigens. Fucosylated structures are involved in a variety of important biological and pathological processes in eukaryotic organisms including tissue development, angiogenesis, fertilization, cell adhesion, inflammation, and tumour metastasis [51]. In prokaryotic organisms fucosylation appears to be less common. Still fucosylated structures are present in prokaryotes and these structures has been suggested to be involved in molecular mimicry, adhesion, colonization, and modulating the host immune response [51]. Figure 1. Structure of the monosaccharide α-l-fucose. Fucosylation as a disease marker Changes in fucosylation patterns are commonly associated with many disease states such as inflammation, liver disease and cancer [28, 39-41, 53]. Using AAL, Rydén et al. have shown that the fucosylation of the plasma protein α1-acid glycoprotein (AGP) also known as orosomucoid, is significantly higher in patients with rheumatoid arthritis and liver cirrhosis, and that the degree of fucosylation correlated with the severity of the disease [39]. Therefore they proposed that the fucosylation of AGP could be useful in diagnosis of inflammatory disease and in early detection of liver cirrhosis. Changes in glycosylation are also common in all types of tumor cells [28, 53]. On these cells N-linked oligosaccharides often become more branched and contain more fucose compared with non-malignant cells [53, 54]. The changed glycosylation pattern of tumor cells can give rise to expression of specific tumor-associated oligosaccharide structures [53, 54]. These structures could potentially be used as cancer markers, and some of them may have a prognostic value. 14
14 Aims of the thesis Glycosylated plasma proteins and/or cell surface proteins have in various studies shown disease-specific or disease-state specific changes in glycosylation pattern. Thus there is an obvious need for glycosylation analysis in routine diagnostics. Therefore it will be important to obtain reliable carbohydrate binders with high specificity. In our lab Aleuria aurantia lectin (AAL) has been used in glycodiagnostic assays to determine fucosylation of AGP during different pathological conditions. This lectin has been shown to bind to fucose and fucosylated oligosaccharides with relatively high affinity and broad specificity compared to other lectins. The overall aim of this study was to use molecular biology techniques to produce recombinant AAL and recombinant AAL forms and to study their binding characteristics in detail. More specific aims were: Paper I The aim of this study was to produce a recombinant form of AAL lectin (raal). This raal would then be purified in the absence of free fucose. The aim was further to characterize the purified raal and determine its affinity to fucose and different fucose-containing oligosaccharides. Paper II A problem of using multivalent lectins for diagnostic purposes is that differences in affinity between different binding sites can reduce the accuracy and performance of the assay. Another problem is the fact that binding specificity can differ between different binding sites in the lectin giving unwanted cross reactivity. To solve some of these problems, it is of interest to produce monovalent lectins with more specific carbohydrate binding properties. The aim of this study was to create a functional monomeric form of AAL and to create a monovalent form of AAL by expressing only one binding site of AAL and to investigate their binding characteristics. 15
15 Methods Construction of plasmids His-tagged raal Paper I Initially we obtained the plasmid pgem-aal as a generous gift from Dr. Yoshiho Nagata at the Chiba University, Japan. Instead of using this plasmid to produce AAL we incorporated the AAL-gene in the pet28b vector, which will produce raal with a Histidine tag (His-tag). The His-tag enabled purification of raal without adding free fucose during purification. The plasmid pgem-aal was digested with the two restriction enzymes NdeI and XhoI. The gene product (AAL = 939 bp) was purified from an agarose gel and then added to pet28b that had previously been digested with NdeI and XhoI, purified and dephosphorylated. This mixture was ligated with T4 DNA-ligase and then transformed into E.coli. Transformed E.coli was cultured on agar plates and bacterial colonies were screened for pet28b containing AAL insert. His-tagged monomeric AAL Paper II To create monomeric AAL a single amino acid was changed in AAL. Site directed mutagenesis of pet-28b-aal was used to change the codon TAC to CGC in the AAL coding region giving a switch in amino acid from Tyr6 to Arg6. His-tagged monovalent AAL Paper II Initially we tried to use modified primers and PCR to amplify a part of the AAL gene comprising only binding site 2 (S2-AAL). The primers were modified to create an NdeI cleaving site in the 5 -end of S2-AAL and an XhoI cleaving site in the 3 -end. This PCR product was then cleaved with NdeI and XhoI and added to cleaved (NdeI and XhoI), purified and dephosphorylated pet28b. The mixture was ligated with T4 DNA-ligase and then transformed into E.coli. However this approach was not successful most probably due to failure of the restriction enzymes to cleave the PCR products prior to ligation. Our second approach was to use site directed mutagenesis of pet-28b-aal (Fig. 2 A). An NdeI cleavage site was inserted at nucleotide position 150 in the AAL coding sequence. This was followed by the insertion of a stop codon site at nucleotide position 480 in the AAL coding sequence (Fig. 2 B). The resulting plasmid was cleaved with NdeI to remove the 5 -segment of AAL corresponding to nucleotides and then ligated (Fig. 2 C). The coding region of the resulting plasmid corresponds to nucleotides (encoding S50 G160) in the original AAL sequence. When expressed, we observed that approximately 50 % of S2-AAL was found in the supernatant and 50 % in inclusion bodies. We succeeded to purify S2-AAL from inclusion bodies using denaturation with guanidinium chloride and renaturation on the Ni 2+ - column. However, due to ease of purification only S2-AAL purified from supernatant was used in Paper II. 16
16 Figure 2. Modification of pet28b-aal to express S2-AAL. a Shows were AAL is located in pet28b-aal and restriction enzyme cleavage sites. b Indicates insertion of new NdeI and stop codon sites. c The final pet28b-s2-aal plasmid. Circular dichroism Paper I and II Circular dichroism (CD) spectroscopy is a form of light absorption spectroscopy that is sensitive to the secondary structure of proteins. Changes in a CD signal reflect changes in the protein structure. The definition of CD is that it measures the difference in absorbance of left circularly polarized light (LCPL) and right circularly polarized light (RCPL) for a specific substance: CD = Abs (LCPL) Abs (RCPL) [55-58]. The fact that CD measures circularly polarized light is the major difference compared to other absorption spectroscopic methods that measures the absorption of isotropic light. A molecule that has the ability to absorb RCPL and LCPL must be structurally asymmetric and exhibit absorbance [56, 57]. Such a molecule is said to be a CD active molecule. For instance proteins are CD active molecules because all amino acids except glycine contain a chiral carbon, and are thus asymmetric [56]. CD is reported in units of absorbance or ellipticity and both can be normalized for the molar concentration of the sample [55, 56]. The CD spectra in Paper I and Paper II have the unit of molar ellipticity ([θ]) which is ellipticity that has been corrected for the concentration of the sample. The unit of molar ellipticity is (deg cm 2 /dmol). To calculate molar ellipticity, the sample concentration (g/l), molecular weight (g/mol) and the cell path length (cm) must be known [55, 56]. If the sample is a protein, the mean residual weight (average molecular weight of the amino acids it contains) is used instead of the molecular weight. The CD spectrum is divided into a far-ultraviolet (far-uv) region ( nm) and a nearultraviolet (near-uv) region ( nm). In a far-uv CD spectrum the amide groups in the polypeptide backbone are the major CD absorbents. Since these amide groups will have different orientations depending on the secondary structure of the protein a CD spectra in the far-uv region will give information on the presence of secondary structures such as α-helix, β-sheet and random coil. These different structural elements give roughly the following characteristic CD spectra: α-helical proteins have negative bands at 222 nm and 208 nm and a positive band at 193 nm, proteins with well-defined antiparallel β-sheets have negative bands at 218 nm and positive bands at 195 nm, whereas disordered proteins (random coil) have very 17
17 low ellipticity above 210 nm and negative bands near 195 nm (Fig. 3) [59]. But it is not only the polypeptide backbone that affects the far-uv CD spectrum. It has been shown that tryptophans with its aromatic side chains also affect the CD spectrum in almost the entire wavelength region ( nm) [60]. Since tryptophans contribute to the CD spectra also in the far-uv region it will make predictions of the amount of various types of secondary structure more difficult for proteins containing several tryptophans. One monomer of AAL contains 16 tryptophans. Therefore, we did not predict the secondary structures of the studied AAL forms on basis of the obtained CD spectra. Instead we used the data obtained from CDmeasurements to determine whether the different AAL forms were correctly folded and whether there were differences in secondary structure between the different AAL forms. Figure 3. Theoretical CD spectra for different structural elements in the far-ultraviolet region. In the near-uv region the side chains of aromatic amino acids (phenylalanine, tyrosine and tryptophan) influence the CD spectrum the most. To give a CD signal these side chains have to be situated in an asymmetric environment. Unfolded proteins do not give CD signals in the near-uv region. Therefore a CD spectrum in this region gives information about the tertiary structure around the aromatic side chains. Requirements for obtaining a far-uv CD spectrum are a sample volume of µl with a protein concentration of 100 µg/ml to 1.5 mg/ml depending on type of cuvette used [55]. Signals in the near-uv region of the CD spectrum are generally more than an order of magnitude weaker than in the far-uv region of the CD spectrum. Therefore these measurements require more material with a sample volume of about 1 ml and a protein concentration between mg/ml [55]. The buffers in which the proteins are dissolved during a CD experiment can not contain any molecules that have a high absorbance in this region of the spectra ( nm). Such molecules are for example dithiothreitol (DTT) and imidazole [61]. In our experiments we never experienced any problems with lack of material or high background absorbance from the buffer. 18
18 Both near- and far-uv CD spectra provide a fingerprint of the examined protein. CD spectroscopy can therefore be used to study protein stability or folding intermediates following different treatments such as heating or treatment with denaturating agents. Enzyme Linked Lectin Assay Paper I and II One important application area for lectins is to detect specific carbohydrate structures on glycoproteins. This can be done by different techniques such as lectin affinity chromatography [62, 63], crossed affino-immunoelectrophoresis [64, 65], lectin immunosensors [66], lectin blotting [65, 67, 68] and enzyme linked lectin assay (ELLA, lectin ELISA) [69-72]. AAL has previously been used in different ELLA assays [69, 40]. The advantages with the ELLA method are that it gives much information within a short time and it is easy to perform and repeat. ELLA does not give any affinity values but it can be used for specificity studies. We used ELLA to investigate if our lectin forms had retained ability to bind a number of fucosylated oligosaccharide structures and if there was differences in binding specificity. All ELLA experiments were performed in the same way. Initially a microtiter plate was coated with synthesized BSA-oligosaccharide conjugates, containing on average 15 oligosaccharide chains per conjugate. Then the wells were blocked with BSA followed by addition of biotinylated lectin forms. The bound biotinylated lectin was visualized by adding ExtrAvidin and phosphatase substrate and absorbance was measured at 405 nm. These experiments gave information about binding capacity and binding specificity for the different lectin forms compared to the native lectin. Surface Plasmon Resonance Paper I and II A sensor that uses biomolecules to detect a certain analyte is called a biosensor. One of the most used types of biosensors is the affinity biosensor. An affinity biosensor can measure the interaction between different biomolecules, for example between an antibody and an antigen or between a lectin and a carbohydrate [73]. A common method to detect the interaction is Surface Plasmon Resonance (SPR). The underlying physical principles of SPR are complex. Simplified, the SPR method will give information on how the refractive index is changed near the surface of a sensor chip. When an analyte binds to the sensor surface the refractive index is changed and this will be measured and the interaction can be studied [74]. In 1990 a commercial instrument using this technology was released by Biacore AB (Uppsala, Sweden) and it was named BIACORE [74]. There are several SPR-based systems but it is the different BIACORE systems that are the most widely used [72]. An advantage with this method is that data describing affinity as well as kinetics is obtained in a straightforward manner [75]. Affinity biosensors based on SPR technique provide a powerful tool for the analysis of protein carbohydrate interactions [76-83]. In addition to affinity measurements SPR can also be used to determine the enthalpy, stoichiometry, kinetics and activation energy of an interaction. A major advantage of SPR over other techniques such as isothermal titration 19
19 calorimetry (ITC) is that less amounts of protein are required. We used BIACORE 2000 and a CM5 sensor chip to study the affinity between the obtained AAL forms and fucose or different fucosylated oligosaccharides. The sensor surface where the interaction between ligand and analyte occurs is shaped as a small flow cell, nl in volume, through which an aqueous solution (running buffer) passes under continuous flow. In order to detect an interaction, the ligand (in our case the lectin of interest) is immobilized onto the sensor surface. It is important that the activity of the ligand is not disrupted during the immobilization. After immobilization of the ligand, the analyte is injected (mono- and oligosaccharides in our experiments) in aqueous solution (sample buffer) through the flow cell under continuous flow. As the analyte binds to the ligand on the sensor surface the refractive index will change due to the accumulation of molecules on the sensor surface. This change in refractive index is measured in real time and the result is plotted as response or resonance units (RUs) versus time in a sensorgram (Fig. 4). After the desired association time a solution without the analyte, preferably the sample buffer, is injected over the sensor surface resulting in dissociation of the analyte (Fig. 4). As the analyte dissociates from the ligand a decrease in SPR signal is observed (Fig. 4). Finally the sensor surface is regenerated and a new binding cycle can be performed (Fig. 4). From these data association rate constant (on rate, k on ) and dissociation rate constant (off rate, k off ) as well as equilibrium constants can be calculated. To obtain correct data in an SPR experiment it is important to measure the background response. This is done to correct for unspecific binding of analyte or to correct for any difference in the refractive index between the running- and sample buffers. The background response must be subtracted from the sensorgram to obtain the actual binding response. The background response is recorded by injecting the analyte through a different reference flow cell on the same sensor chip, which has no ligand or an irrelevant ligand immobilized to the sensor surface (blank). In Papers I and II we used a blank flow cell with inactivated surface to record the background response. The advantage with this type of blank reference flow cell is that it is easy to create and it gives a good estimation of the background response. The disadvantage is that if there is any unspecific binding between the analyte and the ligand this will not be corrected for. On the other hand there is no risk of overestimating unspecific binding when this type of blank sensor surface is used. The ultimate reference surface, if a lectin carbohydrate interaction is considered, would be a lectin that has the exact same characteristics as the normal lectin but lacks the ability to bind the carbohydrate of interest. 20
20 Figure 4. Sensorgram obtained from a typical SPR experiment. 1 A baseline is recorded as running buffer flows over the immobilized ligand. 2 Injection of analyte resulting in an increased response due to formation of analyte/ligand complex. 3 Steady state equilibrium. 4 Injection of running buffer without analyte. As a consequence the analyte disassociates from the ligand. 5 High flow washing to remove remaining complexes. The sensor surface of an ordinary BIACORE chip is coated with a nm thick layer of carboxymethylated dextran matrix. Commonly pg protein/mm 2 (corresponding to RU) is immobilized on the sensor surface when an experiment is performed. It is important that the level of immobilized ligand is not too high. Firstly, with too high ligand density the rate at which the surface binds the analyte may exceed the rate at which the analyte can be delivered to the surface (mass-transport). In this situation the mass-transport becomes the rate-limiting step and the k on will therefore be slower than the true k on. Secondly, when the analyte dissociates from the ligand it can rebind to an unoccupied ligand before diffusing out of the matrix and being washed from the flow cell. The consequence of this is that the measured k off is slower than the true k off. These two kinetic artefacts (mass-transport limitations and re-binding) are well known drawbacks for all surface-binding techniques. Due to the fact that SPR measures the mass of material binding to the sensor surface, small analytes as oligosaccharides will give low responses. Therefore we had to use quite high surface concentrations of ligand in our experiments (about RU) to receive a detectable signal. Because of this high ligand concentration at the sensor surface there is a risk of masstransport limitations and/or re-binding events in our experiments. In our experiment this was partly controlled for by increasing the flow rates of the injected analyte. These experiments showed that k on was independent of flow rates, indicating that there were no mass-transport effects. We used steady state equilibrium analysis to evaluate the affinities from our experiments and not kinetic analysis which is more sensitive to mass-transport limitations and re-binding. In our BIACORE experiments we used oligosaccharides as analytes and different AAL forms as immobilized ligands. This approach has previously been successful for affinity 21
21 measurements between lectins and oligosaccharides [76-78]. The Biacore experiments could also have been done with the different oligosaccharides immobilized on the sensor surfaces and the AAL forms in the running buffer [79-80]. However, since some of the AAL forms are multivalent this would result in an avidity effect that would complicate the interpretation of the SPR data [81]. Tryptophan fluorescence Paper I The fluorescence of a folded protein is a mixture of the fluorescence from individual aromatic residues. Most of the intrinsic fluorescence emissions of a folded protein are due to excitation of tryptophan residues, with some contribution from tyrosine and phenylalanine. Tryptophan fluorescence has shown to be a powerful tool to study the interaction between a carbohydrate ligand and its protein binder, and has therefore been used to study the affinity and specificity among different lectins [84-86]. Most proteins that bind carbohydrates contain tryptophan residues [84]. The innate fluorescence of these tryptophans can be affected upon binding due to changes in the microenvironment surrounding the tryptophans [87]. The change in tryptophan fluorescence can be observed as increased or decreased intensity, with or without change of the peak position of maximum intensity [87]. The tryptophans are usually excitated at 295 nm and the emitted tryptophan fluorescence can vary in wave length from nm [84]. This variation depends on the environment surrounding the tryptophan residues in the protein. Even if a change in tryptophan fluorescence is not a consequence of a direct participation of tryptophans in the binding, the observed fluorescence change can still be used to calculate binding constants [87]. Carbohydrates do not affect the tryptophan fluorescence since they are transparent to ultraviolet light [87, 88]. We performed tryptophan fluorescence experiments by adding increased concentration of fucosylated oligosaccharides to naal and raal in solution. The tryptophans were excited at 295 nm and a peak value of the emission spectra was obtained around 339 nm. For raal a decreased fluorescence intensity was observed after addition of fucosylated oligosaccharides (except NA2F) but no change was observed for naal. A non-fucosylated oligosaccharide was used to correct for background fluorescence. The obtained data from the experiments with raal was used to obtain binding curves and approximate K d -values. Hemagglutination Paper I and II Hemagglutination (HA) is a specific form of agglutination that involves erythrocytes. It is an assay based on the ability of multivalent binders to cross link their antigen on erythrocytes and thereby make them agglutinate. HA is commonly used to determine the ABO blood group of blood donors and transfusion recipients. This is done with antibodies directed to the different blood group antigens on erythrocytes. The wider term agglutination can involve different types of cells and molecules and it can be either direct agglutination, caused by a primary binder, or indirect agglutination caused by a secondary binder directed against the first. 22
22 HA and hemagglutination inhibition (HAI) has been extensively used to study the specificity of newly discovered lectins [89, 90]. AAL has previously been shown to agglutinate human erythrocytes in a reaction that could be specifically inhibited by fucose and fucosylated oligosaccharides [91, 36]. We used HA and hemagglutination inhibition (HAI) to investigate if the produced AAL forms had retained or altered binding activity. Human type O erythrocytes was used in our experiments and for the HA assay serial dilutions of the AAL forms were added. A positive reaction was determined as the formation of visual aggregates. If two lectins are compared and one gives agglutination at a lower concentration it can be concluded that this lectin has binding sites with higher affinity available for agglutination than the other lectin. For the HAI assay the AAL forms were preincubated with a serial dilution of fucose or fucosylated oligosaccharides and then assayed for hemagglutinating activity. In this way the minimum inhibition concentration (MIC) of oligosaccharide required to completely inhibit the agglutination reaction could be determined. Analytical Ultracentrifugation Paper II An accurate way to determine the molecular weight, binding constants and the hydrodynamic and thermodynamic properties of macromolecules is through use of analytical ultracentrifugation (AUC) [92, 93]. The technique was developed by Theodor Svedberg in 1923 [94]. An AUC application consists of a centrifugal force with the simultaneous real-time observation of the resulting redistribution of the macromolecules during the centrifugation [93]. The distribution of the macromolecules is monitored in real time through an optical detection system, normally ultraviolet light absorption (280 nm). The acquired data gives the spatial gradients that result from the application of the centrifugal field and their progression with time. There are several advantages with this method. For example it usually does not require any labeling or other chemical modification of the macromolecule/macromolecules to be analyzed, and the material can often be reused after an experiment [93]. The main strength with AUC is that the macromolecules of interest can be characterized in their native state in a biologically relevant solution. Furthermore, the solution conditions can be varied to give more information. Finally since the experiments are performed in free solution, there are few complications due to interactions with matrices or surfaces [95]. In our studies we used AUC to determine the molecular mass of the produced lectin forms and to determine whether they were present in monomeric or multimeric forms. We used SPR-analysis (Biacore) for affinity experiments due to the much higher throughput using this technique. There are two main AUC methods used to study macromolecules namely sedimentation equilibrium (SE) and sedimentation velocity (SV) [92, 93, 95]. In a SV experiment high centrifugal force (typically rpm) is used and the time course of the sedimentation process is analyzed [95]. On the other hand in a SE experiment low centrifugal force is used that permits the diffusion to balance the sedimentation such that a time-invariant equilibrium gradient can be observed [95]. Both methods can be used to determine the molecular mass but we used SE since this method is less sensitive to the shape of the macromolecules and therefore reveals any heterogeneities of the sample [95]. After an equilibrium sedimentation experiment is performed the buoyant molecular weight of the analyte is received. To convert 23
23 this value to an absolute molecular weight the partial specific volume for the analyte has to be determined. This can be done experimentally, however we used a simpler technique that computes the partial specific volume from a weight average of the partial specific volumes of the amino acid residues in AAL. Calculated partial specific volumes of amino acids are in agreement with the experimentally observed for most proteins [96]. 24
24 Results and Discussion Finding a high affinity binding site in recombinant AAL Paper I Usually monovalet interaction between lectins and carbohydrates are of weak affinity (millimolar). But there have been reports of fungal and bacterial lectins that bind carbohydrates with affinities in the nanomolar range [97]. Previous studies has shown that AAL bind to different fucosylated oligosaccharides in the micromolar range [42]. We had previously purified AAL from the Aleuria aurantia mushroom in our lab [69]. But in the present study a recombinant form of AAL (raal) was produced to obtain larger quantities of the lectin for further studies and characterization. We expressed AAL with a His-tag that made purification fast, reliable and avoided the use of free fucose during purification steps. Purified raal was analyzed by fucose-agarose affinity chromatography and was found to have retained ability to bind fucose. Therefore the binding characteristics were studied in more detail. Secondary structure was examined using CD and it was obvious that the raal secondary structure was very similar to naal. The near-uv spectra of raal gave information indicating an ordered structure around the tryptophans in the protein. Since most of the tryptophans are located in the binding sites these results indicated an ordered structure of the binding sites. Purified raal was biotinylated and used in ELLA experiments. The binding preference to oligosaccharides with α1-2, α1-3 and α1-4 linked fucose was retained in raal. However, interestingly, raal showed three to five times higher binding level compared to naal. To check whether the His-tag was responsible for some of the gained ability to bind in the ELLA experiment the His-tag was removed using thrombin digestion. Thrombin digested raal was compared to untreated raal in an ELLA experiment. No difference in binding to different fucosylated oligosaccharides was observed indicating that the His-tag did not contribute to the binding between raal and fucosylated carbohydrates. Biacore experiments was then performed to determine the affinity for raal towards different fucosylated oligosaccharides. The Biacore sensorgrams obtained showed a remarkable difference between raal and naal in affinity for all oligosaccharides except NA2F (for oligosaccharide structures se Table I). When fucose, LNF I, LNF II, LNF III and LDFT was injected over a sensor surface with immobilized raal distinct association and dissociation phases was observed in the obtained sensorgrams. However when the same oligosaccharides were injected over a sensor surface with immobilized naal pulse shaped sensorgrams with extremely rapid association and dissociation phases were observed. This indicated that raal has a higher affinity for these oligosaccharides compared to naal. When NA2F was injected both raal and naal showed pulse shaped sensorgrams indicating similar affinity. When the K d -values were calculated it became clear that raal had two different K d -values for fucose, LNF I, LNF II, LNF III and LDFT. One in the micromolar range and one in the nanomolar range. The K d -values in the micromolar range was similar for both naal and raal whereas the nanomolar K d -value was only observed in raal. 25
Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:
Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET National Swedish parental studies using the same methodology have been performed in 1980, 2000, 2006 and 2011 (current study). In 1980 and 2000 the studies
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
State Examinations Commission
State Examinations Commission Marking schemes published by the State Examinations Commission are not intended to be standalone documents. They are an essential resource for examiners who receive training
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
This exam consists of four problems. The maximum sum of points is 20. The marks 3, 4 and 5 require a minimum
Examiner Linus Carlsson 016-01-07 3 hours In English Exam (TEN) Probability theory and statistical inference MAA137 Aids: Collection of Formulas, Concepts and Tables Pocket calculator This exam consists
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Tunga metaller / Heavy metals ICH Q3d & Farmakope. Rolf Arndt Cambrex Karlskoga
Tunga metaller / Heavy metals ICH Q3d & Farmakope Rolf Arndt Cambrex Karlskoga Tunga metaller / Heavy metals Rolf Arndt -Quality Assurance Cambrex Karlskoga - Svenska Farmakopekommitten / Working Party
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Aborter i Sverige 2008 januari juni
HÄLSA OCH SJUKDOMAR 2008:9 Aborter i Sverige 2008 januari juni Preliminär sammanställning SVERIGES OFFICIELLA STATISTIK Statistik Hälsa och Sjukdomar Aborter i Sverige 2008 januari juni Preliminär sammanställning
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
TN LR TT mg/l N b) 2,6-Dimethylphenole
TN LR TT 0.5-14 mg/l N b) 2,6-Dimethylphenole 283 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer
A study of the performance
A study of the performance and utilization of the Swedish railway network Anders Lindfeldt Royal Institute of Technology 2011-02-03 Introduction The load on the railway network increases steadily, and
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
Validering av kvalitetsregisterdata vad duger data till?
Validering av kvalitetsregisterdata vad duger data till? Anders Ekbom, Professor Karolinska Institutet Institutionen för medicin Solna Enheten för klinisk epidemiologi Karolinska Universitetssjukhuset
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
TN HR TT b) i) 5-140 mg/l N 2,6-Dimethylphenole 284 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
Solutions to exam in SF1811 Optimization, June 3, 2014
Solutions to exam in SF1811 Optimization, June 3, 14 1.(a) The considered problem may be modelled as a minimum-cost network flow problem with six nodes F1, F, K1, K, K3, K4, here called 1,,3,4,5,6, and
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH 2016 Anne Håkansson All rights reserved. Svårt Harmonisera -> Introduktion, delar: Fråga/
MOLECULAR SHAPES MOLECULAR SHAPES
Molecules with 2 electron pair groups around Linear molecules have polar bonds, but are the central atom form a linear shape. usually non-polar. is 180 linear 2 electron pairs around the central atom 1
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private
12.6 Heat equation, Wave equation
12.6 Heat equation, 12.2-3 Wave equation Eugenia Malinnikova, NTNU September 26, 2017 1 Heat equation in higher dimensions The heat equation in higher dimensions (two or three) is u t ( = c 2 2 ) u x 2
Pre exam I PATHOLOGY FOR MEDICAL STUDENTS
Pre exam I PATHOLOGY FOR MEDICAL STUDENTS 2003-11-04 Max 42 credit points Pass 27 credit points NAME:.. Good Luck! 1 Define metaplasia. Provide 3 clinical examples of common metaplastic changes. 4 p Vad
Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands
Skill-mix innovation in the Netherlands dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands m.kroezen@erasmusmc.nl The skill-mix innovation of interest BEFORE AFTER How did the Netherlands
Collaborative Product Development:
Collaborative Product Development: a Purchasing Strategy for Small Industrialized House-building Companies Opponent: Erik Sandberg, LiU Institutionen för ekonomisk och industriell utveckling Vad är egentligen
Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power Networks
DEGREE PROJECT IN ELECTRICAL ENGINEERING, SECOND CYCLE, 30 CREDITS STOCKHOLM, SWEDEN 2017 Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
Thesis work at McNeil AB Evaluation/remediation of psychosocial risks and hazards.
Evaluation/remediation of psychosocial risks and hazards. Help us to create the path forward for managing psychosocial risks in the work environment by looking into different tools/support/thesis and benchmarking
Examensarbete i matematik på grundnivå med inriktning mot optimeringslära och systemteori
Examensarbete i matematik på grundnivå med inriktning mot optimeringslära och systemteori (kurskod SA104X, 15hp, VT15) http://www.math.kth.se/optsyst/grundutbildning/kex/ Förkunskaper Det är ett krav att
Kursplan. FÖ3032 Redovisning och styrning av internationellt verksamma företag. 15 högskolepoäng, Avancerad nivå 1
Kursplan FÖ3032 Redovisning och styrning av internationellt verksamma företag 15 högskolepoäng, Avancerad nivå 1 Accounting and Control in Global Enterprises 15 Higher Education Credits *), Second Cycle
Materialplanering och styrning på grundnivå. 7,5 högskolepoäng
Materialplanering och styrning på grundnivå Provmoment: Ladokkod: Tentamen ges för: Skriftlig tentamen TI6612 Af3-Ma, Al3, Log3,IBE3 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
Workplan Food. Spring term 2016 Year 7. Name:
Workplan Food Spring term 2016 Year 7 Name: During the time we work with this workplan you will also be getting some tests in English. You cannot practice for these tests. Compulsory o Read My Canadian
Windlass Control Panel v1.0.1
SIDE-POWER Windlass Systems 86-08950 Windlass Control Panel v1.0.1 EN Installation manual Behåll denna manual ombord! S Installations manual SLEIPNER AB Kilegatan 1 452 33 Strömstad Sverige Tel: +46 525
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
Kursplan. NA3009 Ekonomi och ledarskap. 7,5 högskolepoäng, Avancerad nivå 1. Economics of Leadership
Kursplan NA3009 Ekonomi och ledarskap 7,5 högskolepoäng, Avancerad nivå 1 Economics of Leadership 7.5 Higher Education Credits *), Second Cycle Level 1 Mål Studenterna skall efter genomgången kurs: kunna
Iron VARIO PP mg/l Fe g) 1,10-Phenanthroline
Iron VARIO PP 0.02-1.5 mg/l Fe g) 1,10-Phenanthroline 221 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range
Dokumentnamn Order and safety regulations for Hässleholms Kretsloppscenter. Godkänd/ansvarig Gunilla Holmberg. Kretsloppscenter
1(5) The speed through the entire area is 30 km/h, unless otherwise indicated. Beware of crossing vehicles! Traffic signs, guardrails and exclusions shall be observed and followed. Smoking is prohibited
The Finite Element Method, FHL064
The Finite Element Method, FHL064 Division of Solid Mechanics Course program, vt2, 20 Course description The finite element method (FEM) is a numerical method able to solve differential equations, i.e.
Tentamen i Biomätteknik SVENSK VERSION. UPPGIFT 1 (10p)
Tentamen i Biomätteknik 2013-10- 30 SVENSK VERSION UPPGIFT 1 (10p) I experimentet nedan har man undersökt om calmodulin binder till en del av estrogenreceptorn, vilket har betydelse för dess samband med
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols.
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols. ExcelLoad simulates the maximum forces that may appear during a transport no matter if the
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Introduktion till vetenskaplig metodik. Johan Åberg
Introduktion till vetenskaplig metodik Johan Åberg Innehåll Forskarvärlden Viktiga begrepp Referenshantering Den vetenskapliga rapporten Vetenskaplig diskussion Forskarvärlden Forskare mäts i antal publikationer
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, EITA50, LP4, 209 Inlämningsuppgift av 2, Assignment out of 2 Inlämningstid: Lämnas in senast kl
REHAB BACKGROUND TO REMEMBER AND CONSIDER
Training in water REHAB BACKGROUND TO REMEMBER AND CONSIDER PHASE I: PROLIFERATION PROTECTION, 0-6 WEEKS PHASE II: TRANSITION PROGRESSION, 7-12 WEEKS PHASE III: REMODELLING FUNCTION, 13-32 WEEKS PHASE
Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance?
r Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance? - A pilot study Susan Sarwari and Mohammed Fazil Supervisors: Camilla Ahlgren Department of
Bilaga 5 till rapport 1 (5)
Bilaga 5 till rapport 1 (5) EEG som stöd för diagnosen total hjärninfarkt hos barn yngre än två år en systematisk litteraturöversikt, rapport 290 (2018) Bilaga 5 Granskningsmallar Instruktion för granskning
Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen
Examensarbete Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen Malin Carlström, Sandra Mårtensson 2010-05-21 Ämne: Informationslogistik Nivå: Kandidat Kurskod: 2IL00E Projektmodell
Health café. Self help groups. Learning café. Focus on support to people with chronic diseases and their families
Health café Resources Meeting places Live library Storytellers Self help groups Heart s house Volunteers Health coaches Learning café Recovery Health café project Focus on support to people with chronic
Maria Fransson. Handledare: Daniel Jönsson, Odont. Dr
Klassificering av allvarlig kronisk parodontit: En jämförelse av fem olika klassificeringar utifrån prevalensen av allvarlig kronisk parodontit i en population från Kalmar län Maria Fransson Handledare:
Kursplan. JP1040 Japanska III: Språkfärdighet. 15 högskolepoäng, Grundnivå 1. Japanese III: Language Proficiency
Kursplan JP1040 Japanska III: Språkfärdighet 15 högskolepoäng, Grundnivå 1 Japanese III: Language Proficiency 15 Higher Education Credits *), First Cycle Level 1 Mål Efter avslutad kurs ska de studerande
Kundfokus Kunden och kundens behov är centrala i alla våra projekt
D-Miljö AB bidrar till en renare miljö genom projekt där vi hjälper våra kunder att undersöka och sanera förorenad mark och förorenat grundvatten. Vi bistår dig som kund från projektets start till dess
KOL med primärvårdsperspektiv ERS 2014. Björn Ställberg Gagnef vårdcentral
KOL med primärvårdsperspektiv ERS 2014 Björn Ställberg Gagnef vårdcentral Nationella programrådet Astma och KOL Identifierade insatsområden Nationella programrådet Astma och KOLinsatsområden för KOL Diagnostik,
The Algerian Law of Association. Hotel Rivoli Casablanca October 22-23, 2009
The Algerian Law of Association Hotel Rivoli Casablanca October 22-23, 2009 Introduction WHY the Associations? NGO s are indispensable to the very survival of societal progress Local, National or International
Assigning Ethical Weights to Clinical Signs Observed During Toxicity Testing
: Assigning Ethical Weights to Clinical Signs Observed During Toxicity Testing Supplementary Data Information (in Swedish) given to the test participants concerning the hypothetical experiment English
SWESIAQ Swedish Chapter of International Society of Indoor Air Quality and Climate
Swedish Chapter of International Society of Indoor Air Quality and Climate Aneta Wierzbicka Swedish Chapter of International Society of Indoor Air Quality and Climate Independent and non-profit Swedish
6 th Grade English October 6-10, 2014
6 th Grade English October 6-10, 2014 Understand the content and structure of a short story. Imagine an important event or challenge in the future. Plan, draft, revise and edit a short story. Writing Focus
Measuring child participation in immunization registries: two national surveys, 2001
Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of
Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5. Skriv svaren på varje fråga på SEPARATA blad.
Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5 Skriv svaren på varje fråga på SEPARATA blad. Skriv namn på VARJE blad. Du kan svara på engelska eller svenska. Motivera eller förklara
TAKE A CLOSER LOOK AT COPAXONE (glatiramer acetate)
TAKE A CLOSER LOOK AT COPAXONE (glatiramer acetate) A TREATMENT WITH HIDDEN COMPLEXITY COPAXONE is a complex mixture of several million distinct polypeptides. 2 State-of-the-art analytics cannot distinguish
Om oss DET PERFEKTA KOMPLEMENTET THE PERFECT COMPLETION 04 EN BINZ ÄR PRECIS SÅ BRA SOM DU FÖRVÄNTAR DIG A BINZ IS JUST AS GOOD AS YOU THINK 05
Om oss Vi på Binz är glada att du är intresserad av vårt support-system för begravningsbilar. Sedan mer än 75 år tillverkar vi specialfordon i Lorch för de flesta olika användningsändamål, och detta enligt
EVALUATION OF ADVANCED BIOSTATISTICS COURSE, part I
UMEÅ UNIVERSITY Faculty of Medicine Spring 2012 EVALUATION OF ADVANCED BIOSTATISTICS COURSE, part I 1) Name of the course: Logistic regression 2) What is your postgraduate subject? Tidig reumatoid artrit
Utfärdad av Compiled by Tjst Dept. Telefon Telephone Datum Date Utg nr Edition No. Dokumentnummer Document No.
Utfärdad av Compiled by Tjst Dept. Telefon Telephone David Andersson BUM 733 684 Stämpel/Etikett Security stamp/label ÅTDRAGNINGSMOMENT TIGHTENING TORQUE Granskad av Reviewed by Göran Magnusson Tjst Dept.
Kursplan. AB1029 Introduktion till Professionell kommunikation - mer än bara samtal. 7,5 högskolepoäng, Grundnivå 1
Kursplan AB1029 Introduktion till Professionell kommunikation - mer än bara samtal 7,5 högskolepoäng, Grundnivå 1 Introduction to Professional Communication - more than just conversation 7.5 Higher Education
(D1.1) 1. (3p) Bestäm ekvationer i ett xyz-koordinatsystem för planet som innehåller punkterna
Högsolan i Sövde (SK) Tentamen i matemati Kurs: MA4G Linjär algebra MAG Linjär algebra för ingenjörer Tentamensdag: 4-8-6 l 4.-9. Hjälpmedel : Inga hjälpmedel utöver bifogat formelblad. Ej ränedosa. Tentamen
Sammanfattning hydraulik
Sammanfattning hydraulik Bernoullis ekvation Rörelsemängdsekvationen Energiekvation applikationer Rörströmning Friktionskoefficient, Moody s diagram Pumpsystem BERNOULLI S EQUATION 2 p V z H const. Quantity
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
x 2 2(x + 2), f(x) = by utilizing the guidance given by asymptotes and stationary points. γ : 8xy x 2 y 3 = 12 x + 3
MÄLARDALEN UNIVERSITY School of Education, Culture and Communication Department of Applied Mathematics Examiner: Lars-Göran Larsson EXAMINATION IN MATHEMATICS MAA151 Single Variable Calculus, TEN2 Date:
FÖRBERED UNDERLAG FÖR BEDÖMNING SÅ HÄR
FÖRBERED UNDERLAG FÖR BEDÖMNING SÅ HÄR Kontrollera vilka kurser du vill söka under utbytet. Fyll i Basis for nomination for exchange studies i samråd med din lärare. För att läraren ska kunna göra en korrekt
J. Japan Association on Odor Environment Vol. -2 No. -,** Flavor * + * *, **
J. Japan Association on Odor Environment Vol. -2 No. -,**1 193 +, 0* Flavor * + * *, ** * 3/0 20*-,0/ + TEL : *,/*,/ /+-+ ** 3/0 *2.+ -+0, 194-2 - +3 - + +2**, + : *, -., : J. Japan Association on Odor
balans Serie 7 - The best working position is to be balanced - in the centre of your own gravity! balans 7,45
balans Serie 7 - The best working position is to be balanced - in the centre of your own gravity! balans 7,45 balans dynamic seating system TM Wheelbase aluminium Hjulkryss aluminium Back support upholstered,
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik
Högskolan i Skövde (SK, JS) Svensk version Tentamen i matematik Kurs: MA152G Matematisk Analys MA123G Matematisk analys för ingenjörer Tentamensdag: 2012-03-24 kl 14.30-19.30 Hjälpmedel : Inga hjälpmedel
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
Undergraduate research:
Undergraduate research: Laboratory experiments with many variables Arne Rosén 1, Magnus Karlsteen 2, Jonathan Weidow 2, Andreas Isacsson 2 and Ingvar Albinsson 1 1 Department of Physics, University of
denna del en poäng. 1. (Dugga 1.1) och v = (a) Beräkna u (2u 2u v) om u = . (1p) och som är parallell
Kursen bedöms med betyg, 4, 5 eller underänd, där 5 är högsta betyg. För godänt betyg rävs minst 4 poäng från uppgifterna -7. Var och en av dessa sju uppgifter an ge maximalt poäng. För var och en av uppgifterna
ASSESSMENT AND REMEDIATION FOR CHILDREN WITH SPECIAL EDUCATIONAL NEEDS:
ASSESSMENT AND REMEDIATION FOR CHILDREN WITH SPECIAL EDUCATIONAL NEEDS: THE ROLE OF WORKING MEMORY, COMPLEX EXECUTIVE FUNCTION AND METACOGNITIVE STRATEGY TRAINING Avdelningen för psykologi Mittuniversitetet
http://marvel.com/games/play/31/create_your_own_superhero http://www.heromachine.com/
Name: Year 9 w. 4-7 The leading comic book publisher, Marvel Comics, is starting a new comic, which it hopes will become as popular as its classics Spiderman, Superman and The Incredible Hulk. Your job
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
Formaldehyde M. TT 0.1-5 mg/l HCHO SO 4 / Chromotropic acid 177 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption
1. Varje bevissteg ska motiveras formellt (informella bevis ger 0 poang)
Tentamen i Programmeringsteori Institutionen for datorteknik Uppsala universitet 1996{08{14 Larare: Parosh A. A., M. Kindahl Plats: Polacksbacken Skrivtid: 9 15 Hjalpmedel: Inga Anvisningar: 1. Varje bevissteg
Hållbar utveckling i kurser lå 16-17
Hållbar utveckling i kurser lå 16-17 : Jag tillhör akademin / My position is in the School of Jag tillhör akademin / My position is in the School of Humaniora och medier / Humanities and Media Studies
F ξ (x) = f(y, x)dydx = 1. We say that a random variable ξ has a distribution F (x), if. F (x) =
Problems for the Basic Course in Probability (Fall 00) Discrete Probability. Die A has 4 red and white faces, whereas die B has red and 4 white faces. A fair coin is flipped once. If it lands on heads,
Syns du, finns du? Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap
Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap Syns du, finns du? - En studie över användningen av SEO, PPC och sociala medier som strategiska kommunikationsverktyg i svenska företag
SAMMANFATTNING AV SUMMARY OF
Detta dokument är en enkel sammanfattning i syfte att ge en första orientering av investeringsvillkoren. Fullständiga villkor erhålles genom att registera sin e- postadress på ansökningssidan för FastForward
Goals for third cycle studies according to the Higher Education Ordinance of Sweden (Sw. "Högskoleförordningen")
Goals for third cycle studies according to the Higher Education Ordinance of Sweden (Sw. "Högskoleförordningen") 1 1. Mål för doktorsexamen 1. Goals for doctoral exam Kunskap och förståelse visa brett
Läkemedelsverkets Farmakovigilansdag
Swedish Medical Products Agency s Patient- and Consumer Advisory Board Brita Sjöström May 29, 2018 Patientrådet@mpa.se https://lakemedelsverket.se/patient-konsument-rad The vision of the Swedish Medical
Profilinformation Flygteknink 2019, Ingo Staack
Profilinformation 2019 Flygteknik Roland Gårdhagen Ingo Staack Aeronautical Engineering Masterprofil Flygteknik Profilinformation Flygteknink 2019, Ingo Staack 1 2019-03-14 3 Från koncept till prototyp
EBBA2 European Breeding Bird Atlas
Methodology Sergi Herrando, Verena Keller, Petr Voříšek et al. objectives 1. To document breeding evidence for all bird species at a resolution of 50x50 km 2. To estimate abundance for all bird species
Har Du frågor angående uppgifterna: kontakta någon av lärarna, vid lektionerna, via e-post eller på deras rum:
PROJEKTTENTAMEN I FASTA TILLSTÅNDETS FYSIK FYP330, HT2009 Inlämningsuppgifterna ersätter tentamen. Du skall lösa uppgifterna för Ditt ämne. Nödvändig information hämtar Du i bibliotekets samlingar (böcker