Enligt närvaro-/tjänstgöringslista. Ordförande... John Åberg. Justerare... Anita Garefelt

Save this PDF as:

Storlek: px
Starta visningen från sidan:

Download "Enligt närvaro-/tjänstgöringslista. Ordförande... John Åberg. Justerare... Anita Garefelt"


1 (9) Datum Tid Kl Plats Beslutande B-salen, kommunhuset Enligt närvaro-/tjänstgöringslista Övriga Jerry Mähler, vård- och äldreförvaltningen 1 Närvarande Mikael Holmsten, kommunstyrelseförvaltningen 3 Underskrifter Sekreterare Ulla Johansson Ordförande... John Åberg Justerare... Anita Garefelt BEVIS OM JUSTERING Justeringen har tillkännagetts genom anslag på kommunens anslagstavla, entréplan, kommunhuset. Myndighet Sammanträdes- datum Anslaget sätts upp tas ner Förvaringsplats för protokollet Kommunstyrelseförvaltningen, kommunhuset, Sollefteå Underskrift... Ulla Johansson

2 (9) Närvaro- och omröstningslista Namn Ledamöter, kommun Närvaro Tjg. ers. Omröstningar Ja Nej Ja Nej Anteckningar John Åberg (S) 1 Elisabet Lassen (S) 1 Leif Östberg (FP) 1 Ledamöter, förening Siv Selinder 1 Örjan Eriksson 1 Inga Lindström 1 Lennart Sundqvist 1 Inga-Lill H Löfgren 1 Britt Altin 1 Maggi Gustafsson 1 Anita Garefelt 1 Justerare Anna-Stina Lundberg 1 Ersättare, förening Nils Tegman 1 K-A Kristoffersson - Jan-Bertil Johansson - Lisa Karlsson - Dick Andersson - Ivan Åhman - Gerd Karlsson - Ann-Sofi Högberg 1 Carl-Erik Mähler -

3 (9) Dagordning Ärende Paragraf 1. Val av justerare 2. Upprop 3. Föregående protokoll Information från vård- och äldreförvaltningen Information från Mikael Holmsten kostchef Västra Ekonomi Övriga frågor 5 8

4 (9) 1 Föregående protokoll Genomgång av protokoll från Föregående protokoll läggs till handlingarna.

5 (9) 2 Information från vård- och äldreförvaltningen Jerry Mähler är från och med den 1 april 2012 anställd som äldreomsorgschef vid vård- och äldreförvaltningen med ansvar att leda och utveckla äldreomsorgen. Jerry Mähler redogör för den nya Lednings- och stödorganisation inom vård- och äldreförvaltningen. Den är indelad i geografiska områden, särskilda boenden och hemtjänst samlat på ett ställe. Antalet chefstjänster blir färre, ingen personal kommer att sägas upp. Enhetscheferna har fått lämna intresseanmälan på tjänsterna på de olika områdena. Information till vård- och äldreförvaltningens samverkansgrupp den 21 februari vilka som fått tjänsterna. KPR anser att det bra att resurserna för hemtjänst och särskilda boenden är samlat på samma ställe. Diskuterades hur den fasta telefonin kommer att fungera i framtiden för de äldre som bor i glesbygden. Det är kommunstyrelsens ansvarsområde att när det gäller den tekniska plattformen och även en fråga för vård- och äldreförvaltningen. Nationell Värdegrund Socialstyrelsens anvisningar Nämnden har sökt medel för att införa lokala värdighetsgarantier. Målsättningen är att införa omsorgsgarantier där man kan sätta guldkant på tillvaron för de äldre. På frågan om ekonomisk kompensation ska kunna utgå om omsorgsgarantierna inte uppfylls svarar John Åberg att vård- och äldrenämnden inte har någon sådan avsikt. Statistik särskilda boenden KPR anser att statistiken stämmer inte med behovet av särskilt boende med den information som lämnades på möte den 5 december Jerry Mähler informerar om man inte sätter personer på kö utan att man tar beslut om så snabbt som möjligt. Är inte beslutet verkställt inom 3 månader för kommunen betala sanktionsavgift. Varje kvartal skickas rapport från vård- och äldreförvaltningen på ej verkställda beslut. Färdigvårdade Många utskrivningsklara i december 2011, fortfarande tre personer kvar på sjukhuset. Brist på platser beror på att det inte bedrivs någon verksamhet på plan 7. Lösningen blir att det blir fler platser för särskilt boende på Graningebyn.

6 (9) 2 forts. Information från vård- och äldreförvaltningen Äldreår i Europa 2012 KPR ställer fråga om Sollefteå kommun kommer att uppmärksamma att det är äldreår och om det kommer att anslås några medel för ändamålet. Enligt John Åberg finns inga planer i nuläget. Framfördes önskemål från KPR om en samlingslokal där pensionärsföreningarna skulle kunna träffas. Äldrepedagog Anneli Strindin är anställd som äldrepedagog från och med i vård- och äldreförvaltningen. Uppdraget som äldrepedagog utgår från inriktningen att äldre personer får leva ett värdigt liv och känna välbefinnande. Ska finnas minst 1 Träffpunkt i varje område i kommunen. Minst två socialt anpassade aktiviteter 2 per vecka ska planläggas på varje boende. Fråga från KPR om det finns möjligheter för chefer inom äldreomsorgen att fortbilda sig. Enligt Jerry Mähler finns pengar avsatta till studier, kurslitteratur till exempel och det finns möjlighet att studera på deltid..

7 (9) 3 Information av Mikael Holmsten, kostchef Västra Mikael Holmsten redogör för sitt arbete som kostchef Västra. Vård-och äldreförvaltningen samt barn- och skolförvaltningen är de förvaltningar som han främst ansvarar för. Mikaels arbetsuppgifter är att se över behovet av kompetensutveckling, fungera som inspiratör och lyfta fram den hemlagade maten och den traditionella husmanskosten lagad från grunden. Viktigt att kosten är av hög kvalite. Antalet kök är nio och antal personal är 24. Vissa kök har förelägganden som ska åtgärdas. Mikael Holmsten har gjort ett reviderat förslag på sju veckors matsedel för vård- och äldreomsorgen och förslag på tyngre rätter på kvällen. Förslaget har skickats på remiss till berörda. I samarbete med Hushållningssällskapet kommer det under våren att anordnas utbildning på Stöndar för småföretag om ekologisk odling samt hur man går tillväga vid upphandlingar.

8 (9) 4 Ekonomi Bokslutet för 2011 behandlas på kommunstyrelsen den 7 februari. Resultatet visar ett positivt resultat, 1-procentmålet är uppnått, miljoner. Samtidigt kan kostnader för rivning av gamla badhuset tillkomma, medan nedskrivning av bokförda värdet redan är gjord. Intäkterna för Sollefteåforsen är + 28 miljoner för 2011, 5 miljoner lägre än budgeterat. Vård- och äldrenämnden och individ- och omsorgsnämnden har underskott på 11 miljoner för 2011.

9 (9) 5 Övriga frågor Elisabet Lassen informerar om svar från Solatum Hus & Hem om trygghetsboende på Kv. Tuvan. Inflyttningsstatistik Elisabet Lassen informerar om befolkningsstatistik Sollefteå kommun Underlaget bilägges protokollet. Vidare informerar Elisabet Lassen om Medborgardialog inför kollektivtrafikupphandling som pågår i kommundelarna för att inhämta synpunkter och förslag om förändringar. Synpunkterna ska lämnas till kollektivtrafiktrafikmyndigheten i april. I september tar länsmyndigheten beslut om trafikförsörjningsplan.

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (9) Datum Tid Kl. 13.00 16.10 Plats ande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Mari Runesson, anhörigkonsulent, administrativt servicecenter 3 närvarande Lotta Berglund,

Läs mer

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (9) Datum Tid Kl. 13.00 16.05 Plats ande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Gert Persson, chef socialförvaltningen 3 närvarande Jerry Mähler, äldreomsorgschef 3

Läs mer

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (9) Datum Tid Kl. 13.00 15.55 Plats ande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Gert Persson, chef socialförvaltningen 27-28 närvarande Ulf Jonasson, ekonom 27-28 Ulla

Läs mer

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (9) Datum Tid Kl. 13.00 16.00 Plats ande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Johnny Högberg, kommunchef 27 närvarande Björn Osberg, organisationskonsulent 28 Ulla

Läs mer

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (9) Datum Tid Kl. 13.00 15.40 Plats ande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Ali Qadir, Hyresgästföreningen Norrland, 33 närvarande Niklas Nordén, förvaltningsekonom,

Läs mer

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (8) Datum Tid Kl. 09.00 11.00 Plats Beslutande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Ulf Jonasson, ekonom socialförvaltningen 14 närvarande Ulla Fors Nilsson, chefsekonom

Läs mer

Sollefteå kommun Pensionärsrådet

Sollefteå kommun Pensionärsrådet 1 (10) Datum Tid Kl. 13.00 15.30 Plats Beslutande Övriga Närvarande B-salen, kommunhuset Enligt närvaro-/tjänstgöringslista Ulf Jonasson, ekonom vård- och äldreförvaltningen Birgitta Nyström, sekreterare

Läs mer

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (10) Datum Tid Kl. 13.00 16.10 Plats ande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Ulf Nilsson och Leif Svensson Vasallen AB 8 närvarande Ulla Ullstein, kommunplanerare

Läs mer

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (7) Datum Tid Kl. 13.00-14.00 Plats ande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga närvarande Underskrifter Sekreterare... Ulla Johansson Ordförande... Birgitta Forsberg

Läs mer

A-salen, kommunhuset, Sollefteå. Enligt närvaro- och tjänstgöringslista

A-salen, kommunhuset, Sollefteå. Enligt närvaro- och tjänstgöringslista 1 (11) Datum Tid Kl. 11.00 11.50 Ajournering Kl. 11.35-11.45 Plats Beslutande Övriga närvarande A-salen, kommunhuset, Sollefteå Enligt närvaro- och tjänstgöringslista Tomas Alsfjell, stf kommunchef Lena

Läs mer

A-salen, kommunhuset, Sollefteå. Enligt närvaro- och tjänstgöringslista. Ordförande... Åsa Nilsson. Justerare... Örjan Eriksson

A-salen, kommunhuset, Sollefteå. Enligt närvaro- och tjänstgöringslista. Ordförande... Åsa Nilsson. Justerare... Örjan Eriksson 1 (10) Datum Tid Kl. 13.00 15.45 Plats Beslutande A-salen, kommunhuset, Sollefteå Enligt närvaro- och tjänstgöringslista Övriga närvarande Marina Jones, MAS medicinskt ansvarig sjuksköterska 2 Underskrifter

Läs mer

B-salen kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (8) Datum Tid Kl. 13.00-15.35 Plats Beslutande B-salen kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Kollektivtrafikmyndigheten 14: närvarande Hans Fälldin administrativ chef Sture

Läs mer

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista

B-salen, kommunhuset, Sollefteå. Enligt närvaro-/tjänstgöringslista 1 (14) Datum Tid Kl. 13.00 15.25 Plats ande B-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Övriga Lena Andersson, administrativ chef socialförvaltningen 18 närvarande Ulf Jonasson,

Läs mer

Sollefteå kommun Vård- och äldrenämnden

Sollefteå kommun Vård- och äldrenämnden 1(15) Datum Tid 09.00 14.15 Plats Beslutande Övriga Närvarande Justerare A-salen, kommunhuset Sollefteå Enligt bifogad närvaro-/tjänstgöringslista Gert Persson, förvaltningschef Ulf Jonasson, ekonom Lena

Läs mer


PROTOKOLL KOMMUNALA PENSIONÄRSRÅDET 2014-12-09 Sida 1 av 5 PLATS OCH TID Gruvsalen, kl 14.00 16.00 NÄRVARANDE Ordförande Ledamöter Tjänstgörande ersättare Ej tjänstgörande ersättare Övriga närvarande Sekreterare Bo Brantmark, socialnämnden Peter Graff,

Läs mer

Hans Bengtson. Gunilla Andersson. Per Almberg. Hans Bengtson

Hans Bengtson. Gunilla Andersson. Per Almberg. Hans Bengtson Protokoll 1 (5) Plats och tid: Stadshotellet, Hudiksvall, kl. 08.30-08.45 Förtroendevalda: Beslutande: Ej beslutande: Per Almberg (MP) ordf Birgitta Medin (M) Kerstin Karlsson (M) Agneta Palmqvist (M)

Läs mer

Ramselerummet, Sollefteå kommunhus. Enligt närvaro- och tjänstgöringslista. Ordförande:... Marie-Louise Andersson. Justerare: Helen Palm

Ramselerummet, Sollefteå kommunhus. Enligt närvaro- och tjänstgöringslista. Ordförande:... Marie-Louise Andersson. Justerare: Helen Palm 1 (9) Datum och tid: kl. 10:15-11:45 Plats Beslutande Ramselerummet, Sollefteå kommunhus Enligt närvaro- och tjänstgöringslista Övriga Guniris Jonasson Sekreterare närvarande Underskrifter Sekreterare:...

Läs mer

Sollefteå kommun Vård- och äldrenämnden

Sollefteå kommun Vård- och äldrenämnden 1(11) Datum Tid 13.00 14.00 Plats Beslutande Övriga närvarande Justerare A-salen, kommunhuset Sollefteå Enligt bifogad närvaro-/tjänstgöringslista Gert Persson, förvaltningschef Ulf Jonasson, ekonom Jerry

Läs mer


ÅSTORPS KOMMUN SAMMANTRÄDESPROTOKOLL Sida 136 136 Plats och tid Kommunhuset, Åstorp kl. 18.00 19.00 Beslutande Karlsson, Gunilla (s) ordförande Iona, Cimpoeru (s) Lucy, Glinka (s) Axelsson, Bodil (fp) Berglund, Tony (s) Andersson, Annika (s) Hassel,

Läs mer

SAMMANTRÄDESPROTOKOLL Sammanträdesdatum 2015-03-16

SAMMANTRÄDESPROTOKOLL Sammanträdesdatum 2015-03-16 1(11) Plats och tid Beslutande Nämndhuset Nynäshamn, sammanträdesrummet på Kansliavdelningen, kl 10.00-12.05 Catrine Ek (MP), ordförande Daniel Adborn (FP) Thomas Johansson (S) Bodil Toll (M) Harry Bouveng

Läs mer

Meddelande om avliden 3. Information från socialnämnden 6. Melanie Koren, Förenade Care 7. Monica Göransson, chef för särskilt boende 10

Meddelande om avliden 3. Information från socialnämnden 6. Melanie Koren, Förenade Care 7. Monica Göransson, chef för särskilt boende 10 Kommunala pensionärsrådet Sammanträdesdatum Sida 1 Innehållsförteckning Sida Meddelande om avliden 3 Ann-Carine Liljegren, sysselsättningshandledare 4 på särskilt boende Föregående protokoll 5 Information

Läs mer

Socialnämnden (13)

Socialnämnden (13) Socialnämnden 2015-03-19 1(13) Plats och tid Nämndrummet, kommunhuset, kl. 13.00-16.00 Beslutande Solweig Gard (S) ordförande Marianne Ohlsson (C) Åsa Karlsson (S) Magnus Zetterlund (S) Lennart Eriksson

Läs mer

Kommunstyrelsens utskott för Unga och Lärande

Kommunstyrelsens utskott för Unga och Lärande 1 (10) Datum: Tisdag Tid: 12:00-14:15 Plats: Beslutande: Ramselerummet, kommunhuset Sollefteå Enligt närvaro- och tjänstgöringslista Övriga Guniris Jonasson Sekreterare närvarande: Siv Sjödin Kvalitet-

Läs mer

Anslag / Bevis Protokollet är justerat. Justeringen har tillkännagetts genom anslag

Anslag / Bevis Protokollet är justerat. Justeringen har tillkännagetts genom anslag Sammanträdesprotokoll Blad Socialnämnden 2009-01-08 1 Plats och tid Kommunalhuset Arvidsjaur, klockan 09.00-10.30. Beslutande Henning Åhman (s), ordförande Tycko Johansson (s) Ylva Stråhle Andersson (s)

Läs mer

Kommunhuset, socialförvaltningen

Kommunhuset, socialförvaltningen 1(9) Plats och tid Aspås skola, måndagen den, klockan 14.30-16.30 Beslutande Ledamöter Malin Bergman, socialnämnden Niklas Rhodin, barn och utbildningsnämnden, tjg ers (kl:14.30-15.00) Peter Grundström,

Läs mer

Vård- och Omsorgsnämnden 2005-01-27 1 (12) Ann Svensson Hans Nilsson

Vård- och Omsorgsnämnden 2005-01-27 1 (12) Ann Svensson Hans Nilsson Vård- och Omsorgsnämnden 2005-01-27 1 (12) Plats och tid Kommunhuset rum 293, kl 13.15 16.30 Beslutande Sören Carlsson (s) Ann Svensson (s) Hans Nilsson (fp) Klas-Gunnar Appel (s) Lennart Samuelsson (s)

Läs mer

Sammanträdesrum Korallen, Arken Kl 08:30-09:30, 13:00-15:30. Eva Edberg (S) Gunnar Eklöf (V) - 47

Sammanträdesrum Korallen, Arken Kl 08:30-09:30, 13:00-15:30. Eva Edberg (S) Gunnar Eklöf (V) - 47 Omsorgsnämnden 2010-05-11 1 (11) Plats och tid Beslutande ledamöter Sammanträdesrum Korallen, Arken Kl 08:30-09:30, 13:00-15:30. Christina Karlsson (S) ordförande Gunnar Holmberg (S) Anna-Lena Holmström

Läs mer

Plats och tid: Pensionärernas Hus, kl

Plats och tid: Pensionärernas Hus, kl Pensionärsrådet och Rådet för personer med Sammanträdesprotokoll Sammanträdesdatum Plats och tid: Pensionärernas Hus, kl. 18.00 20.00 Beslutande ledamöter: Inte tjänstgörande ersättare: Övriga närvarande:

Läs mer

Protokoll 2013-08-27

Protokoll 2013-08-27 2013-08-27 Socialnämnden Plats och tid Kumla, 2013-08-27, klockan 13:30 14:25 Beslutande Gunnel Kask (S) Jan Engman (C) Lars Malmberg (S) Göran Andersson (M) Agneta Eriksson (S) Barbro Backlund (FP) Mats

Läs mer

Sollefteå kommun Individ- och omsorgsnämnden

Sollefteå kommun Individ- och omsorgsnämnden 1 (10) Datum Tid Kl. 14.00 - Plats Beslutande Övriga närvarande A-salen, kommunhuset, Sollefteå Enligt närvaro-/tjänstgöringslista Gert Persson, förvaltningschef Ann-Katrin Lundin, verksamhetschef HO Mia

Läs mer


NÄMNDEN FÖR OMSORG OCH HÄLSA Plats och tid: Förvaltningkontoret för omsorg och hälsa, Parkgatan 6, Alvesta klockan 13.15 16.15 Beslutande Helen Gustavsson (m) ordförande Kia Jonsson (m) Mia Gällring (kd) Lars Andersson (fp) Rose-Marie

Läs mer

A-salen, kommunhuset, Sollefteå. Enligt närvaro- och tjänstgöringslista

A-salen, kommunhuset, Sollefteå. Enligt närvaro- och tjänstgöringslista 1 (10) Datum Tid Kl. 14.00 Plats Beslutande Övriga närvarande A-salen, kommunhuset, Sollefteå Enligt närvaro- och tjänstgöringslista Gert Persson, förvaltningschef Ann-Katrin Lundin, verksamhetschef FS/IFO

Läs mer

6 Redovisning av verksamhet med personligt ombud i Östra Göinge kommun för år 2013

6 Redovisning av verksamhet med personligt ombud i Östra Göinge kommun för år 2013 Protokoll Omsorgs och utbildningsutskottet 2014-02-18 Sida 1 av 7 Ärendeförteckning 6-9 6 Redovisning av verksamhet med personligt ombud i Östra Göinge kommun för år 2013 7 Bldandet av en regional utvecklingsenhet

Läs mer

Sammanträdesprotokoll 1 (10)

Sammanträdesprotokoll 1 (10) Sammanträdesprotokoll 1 (10) Plats och tid Skive, kl. 13.30 15.45 Beslutande ledamöter Övriga närvarande Sten Fransson (S), ordförande Gerd-Else Bergdahl (RPG) Birgitta Frödin (SPF) Maj-Britt Eriksson

Läs mer

A-salen, kommunhuset, Sollefteå. Enligt närvaro- och tjänstgöringslista

A-salen, kommunhuset, Sollefteå. Enligt närvaro- och tjänstgöringslista 1 (13) Datum Tid Kl. 14.00 Plats Beslutande Övriga närvarande A-salen, kommunhuset, Sollefteå Enligt närvaro- och tjänstgöringslista Gert Persson, förvaltningschef Ann-Katrin Lundin, verksamhetschef FS/IFO

Läs mer

SAMMANTRÄDESPROTOKOLL Sida 1 (12) Omsorgsnämnden

SAMMANTRÄDESPROTOKOLL Sida 1 (12) Omsorgsnämnden Plats och sammanträdestid Beslutare Övriga deltagare SAMMANTRÄDESPROTOKOLL Sida 1 2007-02-15 Äldreboendet Jägarens sammanträdesrum 2007-02-15 kl. 09.00 16.00 Leif Andersson (s) Anna-Lena Carlsson (c) Lisbeth

Läs mer

Protokoll för kommunstyrelsen

Protokoll för kommunstyrelsen 1(6) Protokoll för kommunstyrelsen Plats: Datum och tid: Kommunhusets sessionssal, Skutskär 2015-06-24 kl. 10.00-11.30 Sammanträdet ajourneras kl. 10.45-11.10 för överläggning. Justering Plats: Kommunhuset,

Läs mer

Information från hemtjänst egenregin och särskilt boende 4

Information från hemtjänst egenregin och särskilt boende 4 Kommunala pensionärsrådet Sammanträdesdatum Sida 1 Innehållsförteckning Sida Föregående protokoll 3 Information från hemtjänst egenregin och särskilt boende 4 Rapport angående Mötesplats i Lit 5 Information

Läs mer

Barbro Johansson, kontorschef Nina Thiel, resultatenhetschef Väsby Vård och Omsorg Lidia Wasniewski, controller Jenny Magnusson, nämndsekreterare

Barbro Johansson, kontorschef Nina Thiel, resultatenhetschef Väsby Vård och Omsorg Lidia Wasniewski, controller Jenny Magnusson, nämndsekreterare Produktionsstyrelsen 2012-05-15 1 Plats och tid Beslutande Messingen, Love Almqvists torg 1, lokal: Ragnvald Tisdagen den 15 maj 2012, klockan 19:00-21.40 Ledamöter: Johan Hjelmstrand (M), ordf. Kent Hjalmarsson

Läs mer

Hjernet, 2015-05-12 kl. 10. 00-11.15. ordinarie ledamöter jämte tjänstgörande ersättare samt icke tjänstgörande ersättare enligt bifogad närvarolista.

Hjernet, 2015-05-12 kl. 10. 00-11.15. ordinarie ledamöter jämte tjänstgörande ersättare samt icke tjänstgörande ersättare enligt bifogad närvarolista. SAMMANTRÄDESTOKOLL Kommunala pensionärsrådet 2015-05-12 1 Plats och tid Beslutande Hjernet, 2015-05-12 kl. 10. 00-11.15 ordinarie ledamöter jämte tjänstgörande ersättare samt icke tjänstgörande ersättare

Läs mer

Kommunstyrelsens budgetberedning

Kommunstyrelsens budgetberedning 1 (13) Datum och tid 2013-10-03 kl. 09.00-16.15 2013-10-04 kl.09.00-14.45 Plats Beslutande Övriga närvarande A-salen, kommunhuset Enligt närvaro-/tjänstgöringslista Johnny Högberg, kommunchef Agneta Sundqvist

Läs mer

BURLÖVS KOMMUN SAMMANTRÄDESPROTOKOLL Socialnämnden Sammanträdesdatum 2014-11-06 Sida 1 (13)

BURLÖVS KOMMUN SAMMANTRÄDESPROTOKOLL Socialnämnden Sammanträdesdatum 2014-11-06 Sida 1 (13) Socialnämnden Sammanträdesdatum 2014-11-06 Sida 1 (13) Plats och tid Lilla Sessionsslaen, Medborgarhuset i Arlöv, kl 18.30-20.40 Beslutande Inger Borgenberg,(S) ordförande Sven-Åke Persson, (S) Britt Sonesson,

Läs mer

Qerim Maksudi, S Siw Svensson, S. Stefan Filipsson, omsorgschef Helene Håkansson, verksamhetschef Camilla Eriksson, nämndsekreterare.

Qerim Maksudi, S Siw Svensson, S. Stefan Filipsson, omsorgschef Helene Håkansson, verksamhetschef Camilla Eriksson, nämndsekreterare. 2010-09-23 Sida 1 (11) Plats och tid Stadshuset, Sölvesborg, Lageråssalen, torsdagen den 23 september 2010 kl 18.30-19.35 Beslutande Ersättare Övriga närvarande Roine Olsson, ordförande, S Annelie Rosenqvist,

Läs mer

Protokoll för kommunstyrelsen

Protokoll för kommunstyrelsen 1(6) Protokoll för kommunstyrelsen Plats: Kommunhusets sessionssal, Skutskär Datum och tid: 2014-01-14 Kl. 13.30 14.15 Justering Plats: Kommunhuset, Skutskär Datum och tid: 2014-01-14 Kl. 15.00 Omedelbar

Läs mer

Vård- och Omsorgsnämnden 2002-03-20 1 (10) Björntorps konferensrum, kl 09.00-12.30

Vård- och Omsorgsnämnden 2002-03-20 1 (10) Björntorps konferensrum, kl 09.00-12.30 Vård- och Omsorgsnämnden 2002-03-20 1 (10) Plats och tid Björntorps konferensrum, kl 09.00-12.30 Beslutande Kerstin Eriksson Ann Svensson Ivan Abrahamsson Klas-Gunnar Appel Hans Nilsson Britt-Marie Kärngren

Läs mer

MÖNSTERÅS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum 1 Socialnämnden 2013-03-06. Plats och tid Kommunhuset kl 13:30 17:00

MÖNSTERÅS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum 1 Socialnämnden 2013-03-06. Plats och tid Kommunhuset kl 13:30 17:00 1 Plats och tid Kommunhuset kl 13:30 17:00 ande Emma Magnusson (C) Agnetha Landberg (C) Daniel Backenius (C) Inga Jonsson (C) Britt-Marie Domeij (M) Alexandra Ekstrand (S) 17-22 Britt-Marie Berg-Engström

Läs mer

PLATS OCH TID Kommunhuset, Mellanfryken, måndag 17 oktober 2016, kl BESLUTANDE

PLATS OCH TID Kommunhuset, Mellanfryken, måndag 17 oktober 2016, kl BESLUTANDE PLATS OCH TID Kommunhuset, Mellanfryken, måndag 17 oktober 2016, kl. 09.00 09.15 BESLUTANDE LEDAMÖTER TJG ERSÄTTARE Mikael Johansson (S), ordförande Georg Forsberg (C), 1:e vice ordförande Hans Eriksson

Läs mer

Kommunkontoret torsdag 2 juni kl Sekreterare Paragrafer ANSLAG/BEVIS

Kommunkontoret torsdag 2 juni kl Sekreterare Paragrafer ANSLAG/BEVIS SAMMANTRÄDESPROTOKOLL 1 (11) Plats och tid Kommunkontoret, Heby, kl 13.00 16.30 Beslutande Leif Nilsson (S), ordförande Ulf Fahlstad (LP) Maire Lautakoski (S) Pär Rickman (S) Sven Erik Eriksson (KD) Jan

Läs mer

Kommunala pensionärsrådet

Kommunala pensionärsrådet 2015-05-26 1 (11) Plats och tid Ks-salen, Stadshuset kl. 13-16 Workshop kl. 8.30-12 Beslutande Tommy Bohman (S), ordf, Nils-Erik Olofsson (S), Ejlon Johansson (FP) SPF Lennart Carlsson, Birgitta Sigfridsson,

Läs mer

ARJEPLOGS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum Handikapp- och Pensionärsrådet (21)

ARJEPLOGS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum Handikapp- och Pensionärsrådet (21) Handikapp- och Pensionärsrådet 2012-03-14 1 (21) Plats och tid Grupprum, Vaukagården, onsdagen den 14 mars 2012, Kl 13.00 16.00 Beslutande Bo Åberg, PRO ordförande John Sundström, MBR-nämndens representant

Läs mer

Anslag / Bevis Justeringen har tillkännagetts genom anslag

Anslag / Bevis Justeringen har tillkännagetts genom anslag Sammanträdesprotokoll Sammanträdesdatum Blad Kommunstyrelsens budgetutskott - delegering 2010-11-04 23 Plats och tid Förvaltningsbyggnaden Arvidsjaur klockan 08.30-12.00. Beslutande Jerry Johansson (s),

Läs mer

Ärendeförteckning. Protokoll Omsorgs och utbildningsutskottet. 32 Brukarundersökning inom bostad med särskild service 2014

Ärendeförteckning. Protokoll Omsorgs och utbildningsutskottet. 32 Brukarundersökning inom bostad med särskild service 2014 Protokoll Omsorgs och utbildningsutskottet Sida 1 av 7 Ärendeförteckning 32 Brukarundersökning inom bostad med särskild service 2014 33 Brukarundersökning inom daglig verksamhet 2014 34 Revidering av kommunstyrelsens

Läs mer

Gun Bodén (pro) Kjell Richardsson (s) John Henriksson, omsorgschef Elisabeth Hulter, vik. nämndsekreterare

Gun Bodén (pro) Kjell Richardsson (s) John Henriksson, omsorgschef Elisabeth Hulter, vik. nämndsekreterare Tid och plats Måndagen den 17 mars 2007, kl 17.00-19.00 i Dynamiken, Bollegården Ärenden 1-11 Ordförande Beslutande Pensionärsorg. Hannu Sutinen (fp) Lars Engstrand (spf) Gun Bodén (pro) Omsorgsnämnden

Läs mer

Plats och tid Sammanträdesrum Korallen, Arken, kl 13:00-14:45

Plats och tid Sammanträdesrum Korallen, Arken, kl 13:00-14:45 Omsorgsnämnden 2007-09-14 1 (6) Plats och tid Sammanträdesrum Korallen, Arken, kl 13:00-14:45 Beslutande Christina Karlsson (s) Anna-Lena Holmström (c) Gunnar Holmberg (s) Sofia Olsson (c) Lillemor Edlund

Läs mer

ANSLAG/BEVIS Protokollet är justerat. Justeringen har tillkännagivits genom anslag

ANSLAG/BEVIS Protokollet är justerat. Justeringen har tillkännagivits genom anslag 1 Plats och tid Kallingesalen, stadshuset, kl 08.30-11.30 Ordinarie ledamöter Ersättare Närvarande Bo Johansson Birger Svensson Malin Norfall Äldrenämnden Äldrenämnden Kommunstyrelsen Åke Nilsson PRO Ingrid

Läs mer

Socialnämnden 2012.12.12 1

Socialnämnden 2012.12.12 1 Socialnämnden 2012.12.12 1 Plats och tid Sammanträdesrum Verandan, kommunhuset kl 13.30-14.30 Beslutande Stefan Westergren (S) ordf Anders Palm-Lundin (S) Mikael Hernborg (S) Håkan Karlsson (C) Charlotte

Läs mer

Omsorgsnämndens protokoll

Omsorgsnämndens protokoll Datum: Måndagen den 26 augusti 2013 Tid: 15.30 19.15 Plats: Östra Roten, kommunhuset i Lilla Edet Justeringsdag: Torsdagen den 29 augusti 2013 Paragrafer: 71-81 Utses att justera: Tommy Nilzén (MP) Underskrifter:

Läs mer

Justering av Beredningen för tillväxt och samhällsbyggandes protokoll har tillkännagivits genom anslag på kommunens anslagstavla

Justering av Beredningen för tillväxt och samhällsbyggandes protokoll har tillkännagivits genom anslag på kommunens anslagstavla 2010-12-21 16 (21) Plats och tid Kommunhuset, A-salen, Tierp, kl 14.00 16.30 Beslutande Se förteckning sid 17 Övriga närvarande Claes Breitholtz, konsult Krister Sernbo. konsult Helena Gåije, planarkitekt

Läs mer


TJÖRNS KOMMUN SAMMANTRÄDESPROTOKOLL Sammanträdesdatum TJÖRNS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Kommunfullmäktige 2009-08-27 1 [7] Plats och tid Stora Tjörnsalen, kommunkontoret kl 18.30 20.30 Beslutande Förteckning enligt bilaga Övriga närvarande Bo Svensson,

Läs mer

ANSLAG/BEVIS. Protokollet är justerat. Justeringen har tillkännagivits genom anslag Organ

ANSLAG/BEVIS. Protokollet är justerat. Justeringen har tillkännagivits genom anslag Organ Socialnämnden 2013.12.18 1 Plats och tid Sammanträdesrum Roskilde, kommunhuset, kl 13.30-14.50 Beslutande Övriga deltagande Stefan Westergren (S) ordf Mohamad Rezkar (S) tjg ers Mikael Hernborg (S) Ulla

Läs mer

PROTOKOLL 1(4) 2009-09-08

PROTOKOLL 1(4) 2009-09-08 PROTOKOLL 1(4) Tid: Kl 13 00 16 00 Plats: Kommunförvaltningen, lokal Älven Ledamöter: Erika Sundström, s, ordförande Sirpa Lundkvist, s Robert Karlsson, s Anita Lindström, c Dick Öhman, kd Anita Backman,

Läs mer

Anslag / Bevis Justeringen har tillkännagetts genom anslag

Anslag / Bevis Justeringen har tillkännagetts genom anslag Sammanträdesprotokoll Sammanträdesdatum Blad Kommunstyrelsens arbetsutskott - delegering 2009-05-25 4 Plats och tid Förvaltningsbyggnaden Arvidsjaur klockan 13.00-15.00. Beslutande Jerry Johansson (s),

Läs mer

Sammanträdesprotokoll 1 (9)

Sammanträdesprotokoll 1 (9) Sammanträdesprotokoll 1 (9) Plats och tid Garvaren Röd, kl. 13.15 17.00 Beslutande ledamöter Övriga närvarande Sten Fransson, Ordförande (S) Maria Rönnehäll, Vice ordförande (S) Per-Olov Ålander, Vice

Läs mer

LUDVIKA KOMMUN SAMMANTRÄDESPROTOKOLL 1 (5 ) Sammanträdesdatum Kommunala handikapprådet

LUDVIKA KOMMUN SAMMANTRÄDESPROTOKOLL 1 (5 ) Sammanträdesdatum Kommunala handikapprådet LUDVIKA KOMMUN SAMMANTRÄDESPROTOKOLL 1 (5 ) Plats och tid Samlingssalen Marnäsliden, kl 15:00 16:15 Paragrafer 7-14 Underskrifter Sekreterare Cathrine Flodström Backlund Ordförande Britt Marinder Justerare

Läs mer

ARJEPLOGS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum Handikapp- och pensionärsrådet (15)

ARJEPLOGS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum Handikapp- och pensionärsrådet (15) Handikapp- och pensionärsrådet 2016-02-23 1 (15) Plats och tid Vaukagårdens samlingssal, tisdag den 23 februari 2016, klockan 9.00 Beslutande Mats Abrahamsson (S), ordförande John Sundström, MBR, ledamot

Läs mer

Kommunala pensionärsrådet 2013-05-21 8

Kommunala pensionärsrådet 2013-05-21 8 Kommunala pensionärsrådet 2013-05-21 8 Plats och tid Hjernet, 2013-05-21 kl. 10.00-11.25 Beslutande Övriga deltagande Tom Rymoen (M), ordförande Bertil Nilsson, PRO Enar Moberg, PRO Ulf Eklund, PRO Siv

Läs mer

Sannerudshemmets samlingssal, Kil, 2011-09-26, kl 15.00-16.50

Sannerudshemmets samlingssal, Kil, 2011-09-26, kl 15.00-16.50 Plats och tid Sannerudshemmets samlingssal, Kil, 2011-09-26, kl 15.00-16.50 Beslutande Mikke H Wivungi, ordförande, kommunstyrelsen Anita Karmteg, socialnämnden Jessica Hildén, barn- och utbildningsnämnden

Läs mer

Underskrifter Paragrafer 7-12. Marie Jesson. Pia Wårdsäter. Marianne Pettersson BEVIS OM ANSLAG

Underskrifter Paragrafer 7-12. Marie Jesson. Pia Wårdsäter. Marianne Pettersson BEVIS OM ANSLAG 2011-05-10 8 Plats och tid Kommunhuset, A-salen kl 13:00-16:00 Beslutande Övriga närvarande Utses att justera Justeringens plats och tid Pia Wårdsäter (S), ordförande Håkan Thomsson (MP) Urban Blomster

Läs mer

ANSLAGSBEVIS. Plats och tid Tunadal, Virgatan 7, Köping, kl 09.00 14.10 Beslutande

ANSLAGSBEVIS. Plats och tid Tunadal, Virgatan 7, Köping, kl 09.00 14.10 Beslutande SAMMANTRÄDESPROTOKOLL 1 (5) Plats och tid Tunadal, Virgatan 7, Köping, kl 09.00 14.10 ande Övriga deltagande Roger Eklund (S), ordförande Inger Lindström (S) Rougel Frössle (S) Hans Andersson (S) från

Läs mer

MÖNSTERÅS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum 1 Socialnämnden Plats och tid Kommunhuset kl 13:30 16:15

MÖNSTERÅS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum 1 Socialnämnden Plats och tid Kommunhuset kl 13:30 16:15 1 Plats och tid Kommunhuset kl 13:30 16:15 ande Emma Magnusson (C) Agnetha Landberg (C) Daniel Backenius (C) Inga Jonsson (C) Britt-Marie Domeij (M) Rune Carlsson (KD) Renée Solstad (S) Britt-Marie Berg-Engström

Läs mer

Bertil Börjeson (HEL), ordförande Kristina Wang (HEL) Lars-Erik Andersson (C) Birgitta Eklund (S) ersättare för Tommy Glader (S) Sofia Andersson (S)

Bertil Börjeson (HEL), ordförande Kristina Wang (HEL) Lars-Erik Andersson (C) Birgitta Eklund (S) ersättare för Tommy Glader (S) Sofia Andersson (S) 1(17) Plats och tid Kommunstyrelsesalen Kommunkontoret Charlottenberg kl 09.00 12.15 Beslutande Bertil Börjeson (HEL), ordförande Kristina Wang (HEL) Lars-Erik Andersson (C) Birgitta Eklund (S) ersättare

Läs mer


SAMMANTRÄDESPROTOKOLL OMSORGSNÄMNDEN Datum Sid (10) 2007-11-13 1 (10) Plats och tid Högalid, Storstugan, kl 13.00 14.00 Beslutande Ledamöter John Bruun (fp) ordf Cecilia Tornerefelt (m) 1:e vice ordf Rolf Delcomyn (s) 2:e vice ordf Göran Blomberg (m) Kerstin

Läs mer


SÄFFLE KOMMUN PROTOKOLL 1 SÄFFLE KOMMUN PROTOKOLL 1 Paragrafer 93-100 Plats och tid Socialkontoret, kl. 16.00 17.35 ande Närvarande,ej tjänstgörande ledamöter Lisbet Westerberg (c) Cecilia Riveros Boström (m) Marianne Blom (c)

Läs mer

Eva Edberg (s) - 13 Frits Söderlind (s) 14 Ersättare Frits Söderlind (s) Barbro Olsson (c) Lars-Åke Norman (s) Christina Göransson (kd)

Eva Edberg (s) - 13 Frits Söderlind (s) 14 Ersättare Frits Söderlind (s) Barbro Olsson (c) Lars-Åke Norman (s) Christina Göransson (kd) Omsorgsnämnden 2007-01-10 1 (16) Plats och tid Stadshuset, Örnsköldsvik, sammanträdesrum Kubbe kl 13:00-14:50. Beslutande Christina Karlsson (s) Anna-Lena Holmström (c) Gunnar Holmberg (s) Sofia Olsson

Läs mer

Omsorgsnämndens protokoll

Omsorgsnämndens protokoll Datum: Måndagen den 18 november 2013 Tid: 15.30 17.00 Plats: Östra Roten, kommunhuset i Lilla Edet Justeringsdag: Onsdagen den 20 november 2013 Paragrafer: 106-112 Utses att justera: Tommy Nilzén (MP)

Läs mer

KOMMUNALA PENSIONÄRSRÅDET Bert Nordqvist Elisabeth Karlsson. Yvonne Eriksson. Karin Jonsson Socialchef

KOMMUNALA PENSIONÄRSRÅDET Bert Nordqvist Elisabeth Karlsson. Yvonne Eriksson. Karin Jonsson Socialchef PLATS Odengatan 34, konferensrummet KL 8.30 11.15 Ordförande Ingemar Dahlström Aage Hansen Birgitta Johansson Margoth Hansen Doris Carlsson Bert Nordqvist Elisabeth Karlsson Kommunstyrelsen ÄO-nämnden

Läs mer

Cecilia Gustafsson (S), ordförande Christer Törnell (KD) Göran Andreasson (S), vice ordförande Margareta Bäckström (C) Gunwald Karlsson (S)

Cecilia Gustafsson (S), ordförande Christer Törnell (KD) Göran Andreasson (S), vice ordförande Margareta Bäckström (C) Gunwald Karlsson (S) 1(9) Plats och tid Päronsalen, klockan 09:00 12:05 Beslutande Ersättare Cecilia Gustafsson (S), ordförande Christer Törnell (KD) Göran Andreasson (S), vice ordförande Margareta Bäckström (C) Gunwald Karlsson

Läs mer

Protokoll 2013-10-30

Protokoll 2013-10-30 2013-10-30 Socialnämnden Plats och tid Kumla, 2013-10-30, klockan 13:30 Beslutande Gunnel Kask (S) Jan Engman (C) Lars Malmberg (S) Göran Andersson (M) Sölve Persson (S) Barbro Backlund (FP) Agneta Eriksson

Läs mer


ÅMÅLS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum SAMHÄLLSBYGGNADSNÄMNDEN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum SAMHÄLLSBYGGNADSNÄMNDEN 2008-01-21 1-10 Plats och tid Konferensrum Norrtull kl 14.00-16.00 Beslutande Thomas Olson (fp), ordf Leif Larsson (c) Jan Hagelbrand

Läs mer

kl Qerim Maksudi, s Siw Svensson, s Jan-Erik Pilthammar, m Birgitta Karlsson, sd

kl Qerim Maksudi, s Siw Svensson, s Jan-Erik Pilthammar, m Birgitta Karlsson, sd 2010-01-28 Sida 1 (9) Plats och tid Stadshuset, Sölvesborg, Lageråssalen, torsdagen den 28 januari 2010 kl 18.30-19.45 Beslutande Ersättare Övriga närvarande Justerare Roine Olsson, s, ordförande Annelie

Läs mer

Anslag/Bevis Protokollet är justerat. Justeringen har tillkännagivits genom anslag.

Anslag/Bevis Protokollet är justerat. Justeringen har tillkännagivits genom anslag. SAMMANTRÄDESPROTOKOLL 1 (16) Datum Tid 08.15-14.00 Plats Hesselgrenska, sammanträdesrummet Närvarande Se sidan 2 Justeringens plats och tid Justerade paragrafer 1-14 Benny Eriksson (S) Kommunhuset Sekreterare

Läs mer

SAMMANTRÄDESPROTOKOLL Kommunens revisorer 2015-01-14

SAMMANTRÄDESPROTOKOLL Kommunens revisorer 2015-01-14 Plats B-salen Tid Kl. 14:00 17:00 Beslutande Ledamöter Carl-Olof Bengtsson (S) Sven Pehrson (C) Marita Bengtsson (MP) Peter Bengtsson (S) Eva R Ericsson (FP) Carl Geijer (M) Ann-Mari Häggsgård (S) Magnus

Läs mer

Kommunstyrelsens protokoll POSTADRESS Haninge BESÖKSADRESS Rudsjöterrassen 2 TELEFON E-POST

Kommunstyrelsens protokoll POSTADRESS Haninge BESÖKSADRESS Rudsjöterrassen 2 TELEFON E-POST Kommunstyrelsens protokoll POSTADRESS 136 81 Haninge BESÖKSADRESS Rudsjöterrassen 2 TELEFON 08-606 70 00 E-POST haningekommun@haninge.se Kommunstyrelsen Protokoll 2 (12) Plats och tid Beslutande KS-salen

Läs mer


ÅSTORPS KOMMUN SAMMANTRÄDESPROTOKOLL Sida 158 158 Plats och tid Kommunhuset, Åstorp kl. 19.00 20.15 Beslutande Karlsson, Gunilla (s) ordförande Wilhelmsson, Anders (s) Åkerman, Lizzethe (s) Berglund, Tony (s) Andersson, Annika (s) Pettersson, Monica

Läs mer

Plats och tid: Pensionärernas Hus, kl Jan-Olov Hangren, PRO Vagnhärad Jerker Löfgren, SPF

Plats och tid: Pensionärernas Hus, kl Jan-Olov Hangren, PRO Vagnhärad Jerker Löfgren, SPF Pensionärsrådet Sammanträdesprotokoll Sammanträdesdatum 2016-02-11 Plats och tid: Pensionärernas Hus, kl. 10.00 11.20 Beslutande ledamöter: Inte tjänstgörande ersättare: Övriga närvarande: Martina Johansson

Läs mer

ÅSTORPS KOMMUN Medborgarnämnden 2010-03-01

ÅSTORPS KOMMUN Medborgarnämnden 2010-03-01 24 Allmän Plats och tid Kommunhuset, Björnekullasalen kl. 19.00-20.25 ande Reino Persson (S) ordförande Friberg, Gun (S) vice ordf. Hellman, Gertrud (M) Eriksson, Lennart (S) Andersson, Lena (C) tjg. ersättare

Läs mer


ÅSTORPS KOMMUN SAMMANTRÄDESPROTOKOLL Sida 21 21 Plats och tid Kommunhuset, Åstorp kl. 19.00 20.15 Beslutande Karlsson, Gunilla (s) ordförande Wilhelmsson, Anders (s) Glans, Monika (fp) Åkerman, Lizette (s) Gavrilids, Georgies (s) Andersson, Annika

Läs mer

ARJEPLOGS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum Handikapp- och pensionärsrådet 2014-03-05 1 (16)

ARJEPLOGS KOMMUN SAMMANTRÄDESPROTOKOLL Sida Sammanträdesdatum Handikapp- och pensionärsrådet 2014-03-05 1 (16) Handikapp- och pensionärsrådet 2014-03-05 1 (16) Plats och tid Samlingssalen Vaukagården, onsdagen den 5 mars 2014, Kl. 9.00 12.00 Beslutande Leif Rönnqvist, ordförande John Sundström, ledamot Eva Forsmark,

Läs mer

Anslag / Bevis Justeringen har tillkännagetts genom anslag

Anslag / Bevis Justeringen har tillkännagetts genom anslag ARVIDSJAURS KOMMUN Sammanträdesprotokoll Sammanträdesdatum Blad Kommunstyrelsen 2010-03-29 128 Plats och tid Kommunalhuset Arvidsjaur klockan 16.45-17.05 Beslutande Jerry Johansson (s), ordförande Ulf

Läs mer

Kommunkontoret i Bergsjö. Tisdag 8 november 2011 kl. 08:15-12:05.

Kommunkontoret i Bergsjö. Tisdag 8 november 2011 kl. 08:15-12:05. NORDANSTIGS KOMMUN SAMMANTRÄDESPROTOKOLL Sammanträdesdatum 1 (5) Sida Plats och tid Kommunkontoret i Bergsjö. Tisdag 8 november 2011 kl. 08:15-12:05. Beslutande Monica Olsson (S) Ordförande Dick Lindkvist

Läs mer

Anslag/bevis Protokollet är justerat. Justeringen har tillkännagivits genom anslag.

Anslag/bevis Protokollet är justerat. Justeringen har tillkännagivits genom anslag. Sida 1 av 8 Plats och tid Kommunkontoret Lessebo tisdagen den 19 november 2013 kl 14.00 17.00 ande Anders Palmengren (s) ordf Ingvar Johansson (c) v ordf Monica Johansson (s) Tommy Truedsson (s) Eva Kabanda

Läs mer

Kommunfullmäktige () Beslutande Björn Hörgren (M), ordförande Per Helsing (KD) Marie Johansson, sekreterare Caroline Depui, kommunchef

Kommunfullmäktige () Beslutande Björn Hörgren (M), ordförande Per Helsing (KD) Marie Johansson, sekreterare Caroline Depui, kommunchef Kommunfullmäktige 2014-09-01 1() Plats och tid Sockenstugan, Lövnäs, Hammarö, kl 18:30-19:15 Beslutande Björn Hörgren (M), ordförande Per Helsing (KD) Siw Gidlöf (S) Bengt-Gustav Persson (S) Leif Sandberg

Läs mer

ANSLAG/BEVIS. Protokollet är justerat. Justeringen har tillkännagivits genom anslag Organ

ANSLAG/BEVIS. Protokollet är justerat. Justeringen har tillkännagivits genom anslag Organ Socialnämnden 2013.08.28 1 Plats och tid Stora sammanträdesrummet vårdcentralen kl 13.30-14.05 ande Övriga deltagande Stefan Westergren (S) ordförande Anders Palm-Lundin (S) Mikael Hernborg (S) Ulla Johansson

Läs mer

Justering av lönenämndens protokoll har tillkännagivits genom anslag på kommunens anslagstavla.

Justering av lönenämndens protokoll har tillkännagivits genom anslag på kommunens anslagstavla. 2012-03-05 1 (6) Plats och tid Tierps kommun, kommunhuset, Rådrummet 5 mars 2012 kl 9.00-10.15 Beslutande Se blad 2 Övriga närvarande Utses att justera Justeringens plats och tid Sara Svanfeldt, personalchef

Läs mer

Sammanträdesprotokoll Socialnämnden

Sammanträdesprotokoll Socialnämnden 1(6) Tid och plats 2014-06-17 - i Kommunhuset klockan 13.00. Beslutande Madeleine Roos, (M) - ordförande Björn Zorec, (FP) - förste vice ordförande Patric Carlsson, (S) - andre vice ordförande Lennart

Läs mer

Ärendeförteckning 93-105

Ärendeförteckning 93-105 Minnesanteckningar Kommunrevisionen Ärendeförteckning 93-105 93 Mötet öppnas 94 Justeringsperson 95 Fastställa dagordningen 96 Inkomna/avsända handlingar 97 Minnesanteckningar 2014-05-21 98 Revisionens

Läs mer

23 Svar på remiss på reviderad överenskommelse om samverkan mellan Region Skåne och den idéburna sektorn

23 Svar på remiss på reviderad överenskommelse om samverkan mellan Region Skåne och den idéburna sektorn Protokoll Omsorgs och utbildningsutskottet Sida 1 av 9 Ärendeförteckning 21 Rapport Förebyggande hembesök 22 Förlängning av avtal med Attendo Sverige AB 23 Svar på remiss på reviderad överenskommelse om

Läs mer

Kommunhuset i Harmånger. Måndag 7 maj 2007 kl. 19:00. Eva Engström Sekreterare. Hans-Åke Bergman (c) Sven-Erik Sjölund (s)

Kommunhuset i Harmånger. Måndag 7 maj 2007 kl. 19:00. Eva Engström Sekreterare. Hans-Åke Bergman (c) Sven-Erik Sjölund (s) NORDANSTIGS KOMMUN SAMMANTRÄDESPROTOKOLL Sammanträdesdatum 1 (6) Sida Plats och tid Beslutande Kommunhuset i Harmånger. Måndag 7 maj 2007 kl. 19:00. Se närvarolista. Övriga deltagande Eva Engström Sekreterare

Läs mer

Kenneth Tinglöf (KD)

Kenneth Tinglöf (KD) Vård- och omsorgsnämnden Sammanträdesprotokoll Sammanträdesdatum 2016-09-30 Plats och tid: Folkets hus i Trosa, 12.30 16.00 ande ledamöter: Inte tjänstgörande ersättare: Martina Johansson (C), ordf. Ricken

Läs mer