Time (min)

Relevanta dokument
SUPPLEMENTARY INFORMATION

Supplemental Data. Urzica et al. Plant Cell (2012) /tpc Supplemental Figure 1.

Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG

tgd4-1 - MGDG - PtdGro - DGDG - SQDG - PtdEtn - TriGDG - PtdCho - TetraGDG

Hydroxyquinone O-Methylation in Mitomycin. Biosynthesis

SUPPLEMENTARY FIGURE LEGENDS

* 2 0 * 4 0 * 6 0 * 8 0 * * * * * * * * * 2 6 0

Omtentamen Biomätteknik, TFKE augusti 2014

Supplemental Information. P-TEFb Activation by RBM7 Shapes a Pro-survival. Transcriptional Response to Genotoxic Stress

Supplemental Data. Antony et al. (2010). Plant Cell /tpc

Arabidopsis CHX16-20 are Endomembrane Cation Transporters with Distinct Activities and Emerging Role in Protein Sorting

Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm

Supplementary information for. MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing

Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!!

TN LR TT mg/l N b) 2,6-Dimethylphenole

The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.

PID1 GSYTAADMQGLSFTLTNLGTKQLEIREQEFYRQGVLAVAVRKQILQPGEITDVFIISRPGG 244

Supplemental Figure S1.

CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018

Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski

Supplementary Data. Figure S1: EIMS spectrum for (E)-1-(3-(3,7-dimethylocta-2,6-dienyl)-2,4,6-trihydroxyphenyl)butan-1-one (3d) 6'' 7'' 3' 2' 1' 6

Tentamen i Biomätteknik SVENSK VERSION. UPPGIFT 1 (10p)

A QUEST FOR MISSING PULSARS

Utvärdering av IVIG behandling vid post-polio syndrom. Kristian Borg

Metodprov för kontroll av svetsmutterförband Kontrollbestämmelse Method test for inspection of joints of weld nut Inspection specification

Immunteknologi, en introduktion. Hur man använder antikroppar för att mäta eller detektera biologiska händelser.

Supporting Information

Klimatpåverkan och de stora osäkerheterna - I Pathways bör CO2-reduktion/mål hanteras inom ett osäkerhetsintervall

KOL med primärvårdsperspektiv ERS Björn Ställberg Gagnef vårdcentral

SUPPLEMENTARY DATA Data in the Relational Database

Supplementary Information

WindPRO version feb SHADOW - Main Result. Calculation: inkl Halmstad SWT 2.3. Assumptions for shadow calculations. Shadow receptor-input

Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:

FORTA M315. Installation. 218 mm.

REHAB BACKGROUND TO REMEMBER AND CONSIDER

Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM

LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik

INVESTIGATION OF LAKE HÖRNTRÄSKET, LYCKSELE KOMMUN

in the inward-facing conformation revealed by single particle electron Supplementary information

Measuring child participation in immunization registries: two national surveys, 2001

Molecular Biology Primer

Supporting Information. Mechanism and Stereochemistry of Polyketide Chain Elongation and Methyl Group Epimerization in Polyether Biosynthesis

Klimat och miljö vad är aktuellt inom forskningen. Greppa Näringen 5 okt 2011 Christel Cederberg SIK och Chalmers

Iron VARIO PP mg/l Fe g) 1,10-Phenanthroline

A study of the performance

Beijer Electronics AB 2000, MA00336A,

Bilaga 5 till rapport 1 (5)

Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET

Consumer attitudes regarding durability and labelling

Transporter och handel med utsläppsrättigheter. Lars B Johansson Head of Environmental Affairs Schenker AG

Documentation SN 3102

I korta drag. Skörd av trädgårdsväxter 2010 JO 37 SM 1101

Olika uppfattningar om torv och

The Arctic boundary layer

Den framtida redovisningstillsynen

SUPPLEMENTARY INFORMATION

Sannolikhetsteori. Tentamenskrivning: TMS145 - Grundkurs i matematisk statistik och bioinformatik,

Oro och sömn. är piller lösningen eller ännu ett problem? Carl-Olav Stiller Docent, överläkare Klinisk farmakologi Karolinska Universitetssjukhuset

Typografi, text & designperspektiv

Elektron-absorbtionspektroskopi för biomolekyler i UV-VIS-området

Supplementary Materials: Ribosome Inactivating Proteins from Rosaceae

R min. 5 max

Supplemental Data. Mbengue et al. (2010). Plant Cell /tpc

Uttagning för D21E och H21E

Produktens väg från idé till grav

1.4 Luftrumsklassning 1.4 ATS airspace classification

Table S1: Oligonucleotides and PCR primers used in this study.

Ackrediteringens omfattning

INDUKTIV SLINGDETEKTOR INDUCTIVE LOOP DETECTOR

FaR-nätverk VC. 9 oktober

Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:

Measuring void content with GPR Current test with PaveScan and a comparison with traditional GPR systems. Martin Wiström, Ramboll RST

Affärsmodellernas förändring inom handeln

--LVKmDILLnGntVEELVtVVHKDKAHSIGKAIcERLKDSLPRQLfEIAIQAAIGSKIIAREtVKAYR >sp!q8n442!guf1_human-translation-factor-guf1,-mitochondrial-precursor-(ec-3.6.5

Grafisk teknik. Sasan Gooran (HT 2006)

Characterization of promoter regions for design of a synthetic cell specific promoter

ARC 32. Tvättställsblandare/Basin Mixer. inr.se

1. Förpackningsmaskin / Packaging machine

12.6 Heat equation, Wave equation

Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:

1.4 Luftrumsklassning 1.4 ATS airspace classification

Signatursida följer/signature page follows

Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas

Kunskapslyftet. Berndt Ericsson. Esbo Utbildning, arbetsliv och välfärd Ministry of Education and Research. Sweden

SUPPORTING INFORMATION

2.1 Installation of driver using Internet Installation of driver from disk... 3

Vägytans tillstånd, historik och framtid. Johan Lang

Styrteknik: Binära tal, talsystem och koder D3:1

Plain A262. För T16 (T5) lysrör. Innehåll. Monteringsanvisning. A. Instruktion för rampmontering

LUNDS TEKNISKA HÖGSKOLA Inst. for Elektro- och Informationsteknik. SIGNALBEHANDLING I MULTIMEDIA, ETI265 Inlämningsuppgift 1 (av 2), Task 1 (out of 2)

Vad är värdet/faran med att operera tidigt? Sofia Strömberg Kärlkirurg Sahlgrenska Universitetssjukhuset

Händelser i kraftsystemet v v

GU / Chalmers Campus Lindholmen Tentamen Programutveckling LEU 482 / TIG167

This manual should be saved! EcoFlush Manual

Tentamen Molekylärbiologi X3 (1MB608) 10 March, 2008 Page 1 of 5. Skriv svaren på varje fråga på SEPARATA blad.

Questionnaire on Nurses Feeling for Hospital Odors

Tunga metaller / Heavy metals ICH Q3d & Farmakope. Rolf Arndt Cambrex Karlskoga

Elektromagnetisk strålning. Lektion 5

Depression. En-måmads förekomst 10% Mer vanligt än demens efter 65

STORSEMINARIET 3. Amplitud. frekvens. frekvens uppgift 9.4 (cylindriskt rör)

Transkript:

3 2.6 TEF30 VIPP1 Fold change 2.2 1.8 1.4 1 0.6-60 0 60 120 180 240 300 360 420 480 Time (min) Supplemental Figure S1. TEF30 protein accumulates in Chlamydomonas cells exposed to high light. Chlamydomonas cc1690 wild-type cells were grown photoautotrophically in a photobioreactor at 41 µmol photons m -2 s -1 and 5% CO 2 for 3 d. Then the light intensity was increased to 145 µmol photons m -2 s -1 for 8 h. Relative changes of protein abundance were measured via shotgun proteomics including a 15 N-labeled universal standard (Mettler et al., 2014). Data for TEF30 and VIPP1 as control from membrane-enriched fractions are shown.

A Medicago truncatula Glycine max Arabidopsis thaliana Zea mays Oryza sativa Selaginella moellendorffii Physcomitrella patens Ostreococcus lucimarinus Micromonas pusilla Volvox carteri Chlamydomonas reinhardtii MGSSHHHHHH G Putative TAT signal peptide S Cr : ------------------MLAVKPINVVAPSGARPAPVAMLRPLASSRAERTVVASASSVAPKAVSRRQVLCQAQTGTKPAQAATSEA : 70 At : --MSLAPSSYPSLYSSPSLPRTQQTKQNPSLITQSSFISAKSLFLSSNSASLCNTHVAKRRNLALKASETESSAKAEAGGDGEEEEKY : 86 Pp : MASAMVTGSCTAAQVNVVARVVDSPVSSPTVAAVGVQLRHSSYAGAGMQSLKGGSTACETHQRGGRNVAMVVRAMAETSPPSGQPAVK : 88 Cr : EYIELDLPKPLGFKFARGNDGGAYIIEVNP-KAGNIDARVQPGDKIVEISASFGSEVWKAENFGQIMYAIRTRSGTVYMKLKKNYGDL :157 At : ETYEIEVEQPYGLKFRKGRDGGTYIDAILPGGSADKTGKFTVGDRVIATSAVFGTEIWPAAEYGRTMYTIRQRIGPLLMQMEKRNGKA :174 Pp : ETYEVELEKPWGLRFYKGADGGTYIDAVAPGGSADKSGMFTPGDKVIETSAMFGNEMWPAAEYGRTMYTIRQRVGTLLMRMEKRYGVR :176 Cr : SALEEEGLDAAEKQWKKERAGGNYGAGTKEIQARNYVQRKENERKRREMFDDALAKFKENDIQGALVEFENIIAMEPRNFVGDNFSRN :245 At : ---EDTGELTEKEIIRAERNAGYISSRLREIQMQNYLKKKEQKAQREKDLREGLQFSKNGKYEEALERFESVLGSKP----------T :249 Pp : ---EDRGATAEQ--LSAERNAGSIGDGIREIQVQNYLRKQEQKKQREQELDAGLKLYKQGKYEEALGHFESVLGLKP----------E :249 TPR domain PDZ domain TPR domain Cr : TPIYKVTQYNIACCYSMLDQVEEAIKSLDAAMLSGFDNYDQIRRDKNLSKARANPKFQAVLDKYDEPVVNWNAVKATFGAFGNMFNKEK:334 At : PEEASVASYNVACCYSKLNQVQAGLSALEEALKSGYEDFKRIRSDPDLETLRKSKDFDPLLKQFDESFINESAINAIKSLFGFN--KK-:335 Pp : AREEAVASYNVACCYSKLNQIESGLQALEEAMEAGFDDYKTVREDPDLALLRQSPGFTPLINKYDEPFINENAMNAIKNVFGLFGGKK-:337 Supplemental Figure S2. Phylogenetic tree and alignment of TEF30 homologs. (A) Phylogram based on an amino acid sequence alignment of TEF30 homologs lacking putative transit peptides. The analysis was performed with the MEGA 5.1 program. () Amino acid sequences of TEF30 homologs from C. reinhardtii (Cr), A. thaliana (At), and P. patens (Pp) were aligned using ClustalW. Amino acids highlighted in black are conserved in all 3 sequences. Residues underlined indicate transit peptides according to ChoroP predictions, lines above sequences depict a putative TAT signal peptide (C. reinhardtii sequence), PDZ and TPR domains (all sequences). The N-terminal translational fusion of a hexahistidine TAG with C. reinhardtii TEF30 lacking potential transit sequences is indicated.

SpeI A ARG7 HSP70A RCS2 amirna prec RPL12-3 UTR C_310026-3 UTR cw15-325 transformants TEF30-amiRNA mirna* 100% 50% 100% 100 52 28 17 43 26 6 35 96 TEF30 signal intensity AAGTTCGCTCGCGGTGGCGAA TTCGTTACCGCGAGCGAACTT TEF30 CF1β...K P A Q A A T S E A E Y I E -...CUGGGCUUCAAGUUCGCUCGCGGUAACGACGGUGGUGCCUAC...- -UUCAAGCGAGCGCCAUUGCUU- mirna cw15-302 transformants TEF30-amiRNA 100 19 18 104 16 52 27 72 67 53 23 91 79 77 32 94 16 TEF30 signal intensity TEF30 CF1β Supplemental Figure S3. Screening of TEF30-amiRNA transformants. (A) Artifical microrna (amirna) construct used for the constitutive downregulation of TEF30. The construct is based on the pchlamirna2 plastid described by Molnar et al. (2009), which employs the strong HSP70A-RCS2 tandem promoter to drive amirna expression, a double terminator to assure transcriptional termination from both 5 and 3 directions (RPL12-3 UTR/C_310026-3 UTR), and the ARG7 gene as selectable marker. The mirna generated targets the TEF30 coding region. () Immunoblot analysis of TEF30-amiRNA transformants in the cw15-325 (upper panel) and cw15-302 (lower panel) strain backgrounds. trols were transformed with a construct containing the ARG7 gene alone (). Proteins corresponding to 0.5 µg chlorophyll were separated on a 12% SDS-polyacrylamide gel and TEF30 levels were analyzed by immunoblotting with CF1β as loading control.

A TEF30- amirna C TEF30- amirna TAP-NH 4, LL TMP, LL TMP, 2% CO 2, LL TAP-NH 4, 16 h dark TAP-NH 4, HL TMP, HL TMP, 2% CO 2, HL TAP-NH 4, 16 h 10 o C Supplemental Figure S4. TEF30-underexpressing transformants exhibit no obvious growth phenotype under a variety of growth conditions. (A) Light microscopy images of control and a TEF30-underexpressing transformant in the cw15-325 strain background grown in TAP-NH 4 medium at ~30 μmol photons m 2 s 1. lack bars = 2 µm. () Growth curve of TEF30-underexpressing transformants (#1.23, #3.13, #4.41) and control () grown as described in (A). Error bars represent SD, n = 3. (C) Visual comparison of cultures with a TEF30-underexpressing transformant and a control transformant () cultivated in parallel under several different growth conditions. TMP = minimal medium. LL= 30 μmol photons m 2 s 1, HL= 800 μmol photons m 2 s 1.

Relative fluorescence Relative fluorescence Wavelength [nm] Wavelength [nm] Supplemental Figure S5. PSII fluorescence is more affected by high light in TEF30-amiRNA cells than in control cells. 77K fluorescence spectra normalized at the PSI emission peak (~712 nm) of C. reinhardtii cw15-325 control () and TEF30-amiRNA cells before (LL 0 min), during (PI 60 min), and after (Rec 90 and 180 min) the photoinhibition treatment. Photoinhibition was done at 1800 μmol photons m 2 s 1 for 60 min.

Fold change /TEF30-amiRNA A TAP-NH 4 TAP-NO 3 Supplemental Figure S6. Reduced induction of LHCSR3 expression in TEF30-amiRNA cells is realized at the transcriptional level and NPQ is not affected under photoautotrophic conditions. (A) Accumulation of LHCSR3.1 transcript levels in cw15-325 control and TEF30- amirna cells grown in TAP-NH 4 or TAP-NO 3 and exposed to 600 μmol photons m 2 s 1 for 1 h. LHCSR3.1 transcript levels were quantified by RT-qPCR using CLP2 transcripts as calibrator. Error bars represent SD, n=3. () Measurement of non-photochemical quenching (NPQ) of photoautotrophically grown cw15-325 TEF30-amiRNA and control cells in comparison with qe mutant npq4 and state transition mutant stt7. Error bars represent SD, n=2.