APPLICATION OF APPLE POMACE FOR FUNGAL CULTIVATION. Högskoleingenjörsutbildning i kemi Inriktning Bioteknik. Jonatan Viitala Bill Floberg Karlsson
|
|
- Kjell Åberg
- för 5 år sedan
- Visningar:
Transkript
1 APPLICATION OF APPLE POMACE FOR FUNGAL CULTIVATION Högskoleingenjörsutbildning i kemi Inriktning Bioteknik Jonatan Viitala Bill Floberg Karlsson Program: Kemiingenjör - tillämpad bioteknik Svensk titel: Användning av Äpplepressmassa för svampodling Engelsk titel: Application of Apple pomace for Fungal Cultivation
2 Utgivningsår: 219 Författare: Jonatan Viitala och Bill Floberg Karlsson Handledare: Akram Zamani Examinator: Jorge Ferreira Nyckelord: Äppelpressmassa, svamp, Apple pomace, filamentous fungi, Rhizomucor biomass, ethanol SAMMANFATTNING Äppelpressmassa är en solid biprodukt, producerad genom att pressa och trycka milliontals ton äpple i bland annat juiceindustrier. Den kvarstående massan motsvarar 25-3 % av äpplet och består utav skal, frön och fruktkött. Denna råvara har många tillämpningar då den har ett högt kolhydrat- och vätskeinnehåll. Detta examensarbete utvärderade användningen av äppelpressmassa från Herrljunga cider för att odla en filamentös svamp i syfte att producera biomassa och etanol. Massan blev utsatt för olika förbehandlingar för att extrahera så mycket socker som möjligt. Olika satser gjordes genom att blanda äppelpressmassa med vatten i olika förhållanden (g äppelpressmassa per g vatten) och olika vattentemperaturer. Äppeljuice producerades genom att filtrera blöt massa med ett fint tyg. Suspensioner gjordes genom att tillsätta vatten till massan och inte blanda det (icke-homogent). En annan variant gjordes genom att blanda äppelpressmassa och vatten med en mixer (homogent). Några utav äppeljuicesatserna ph justerades till 5.5 för att se hur det påverkade svamptillväxten. Satserna flyttades till Erlenmeyer flaskor, steriliserades och ympades med den filamentösa svampen Rhizomucor. Erlenmeyer flaskorna flyttades till ett skakvattenbad för att jäsa i 72 timmar. Prover togs var 24:e timma för att se socker- och etanolkoncentrationerna ändras. Detta analyserades med hjälp utav en HPLC. Resultaten visade att suspensionssatserna inte presterade bra jämfört med äppeljuicesatserna. Detta misstänks bero på att innehållet var väldigt visköst och hade lågt syreinnehåll för svampen att kunna växa. Att justera ph till 5.5 för äppeljuicesatserna visade sig inte vara bra, de presterade sämre jämfört med justerade satser. Förbehandlingen med en äppelpressmassa till vatten förhållandet på 1 g äppelpressmassa/1 g kallt vatten producerade mest biomassa med ett utbyte av 9.7 g torr biomassa per kg torr äppelpressmassa. För etanolproduktion hade förbehandlingsmetoden med en äppelpressmassa till vatten förhållandet på 1 g äppelpressmassa/1 g varmt vatten högst utbyte med 11.2 g etanol per kg torr äppelpressmassa.
3 ABSTRACT Apple pomace is a solid by-product acquired from pressing and crushing millions of tons of apple in juice-industries. It represents 25-3 % of the original fruit and consists of peels, seeds and pulp. This raw material has multiple applications due to its high carbohydrate and moisture content. This bachelor thesis evaluated the use apple pomace acquired from Herrljunga cider for the cultivation of a filamentous fungus to produce biomass and ethanol. Different pretreatment strategies were applied to the apple pomace to extract as much sugars as possible. Several batches were made by mixing pomace and distilled water at different ratios (g pomace per g water) and different water temperatures. Apple juice was produced by filtering soaked pomace using a fine fabric. Apple pomace suspensions were made by adding pomace and water without mixing it (non-homogenised) and homogenised suspensions by mixing with a kitchen blender. Some apple juice batches were ph adjusted to 5.5 to investigate the effect on the fungal growth. The batches were put in Erlenmeyer flasks, sterilised and inoculated with the fungal strain Rhizomucor that has been isolated from Indonesian leaves used for tempe preparation. The Erlenmeyer flasks were incubated in a water shake for 72 h. Samples were taken every 24 h to follow sugar and ethanol concentrations. The samples were analysed by HPLC (High- Performance Liquid Chromatography). The results showed that apple pomace suspension did not perform well compared to the apple juice since the suspension was too viscous and lacked oxygen for the fungus to grow properly in the solution. The apple juice did show a significant improvement compared to the suspension, however ph adjustment to 5.5 had a negative impact on the fungal growth. Cold pre-treatment with an apple pomace to water ratio of 1 g pomace /g water produced the most biomass, with a yield of 9.7 g biomass per kg dry apple pomace. For ethanol production, an apple pomace to water ratio of 1 g pomace /g water using hot water had the highest yield of 11.2 g ethanol per kg dry apple pomace.
4 TABLE OF CONTENTS SAMMANFATTNING... 2 ABSTRACT INTRODUCTION Background Purpose MATERIAL AND METHOD... 5 Material: Preparation of apple pomace for fermentation Extraction of water-soluble fractions and their application for fungal fermentation Preparation of apple pomace water mixture and their application for fungal fermentation Adjusting ph of water soluble fractions and their use for fungal fermentation Preparation of agar plates Inoculation of fungi, fermentation, and sampling Harvesting of Biomass Analysis of ethanol and sugar concentration Determining ethanol and biomass yield RESULTS Biomass yield from water soluble fractions Biomass yield from water soluble fractions with adjusted ph Biomass concentration from water insoluble fractions Ethanol yield and sugar consumption from water soluble fractions DISCUSSION Future work CONCLUSIONS REFERENCES... 1
5 1. INTRODUCTION Apple pomace is a solid by-product that is produced in quantities in millions of tonnes, commonly produced from juice industries acquired by crushing and pressing apples, representing 25% to 3 % of the fruit. It mostly consists of peels, seeds and pulp. It has a high moisture content of around 7-75 % and a high biochemical oxygen demand and chemical oxygen demand [1]. The country that produce the most apples is China and stands for more than half of world production. Other large producers are the USA, Turkey and Poland [2]. In 214, the total apple production of the world was 84,, tons and 25-3 % is estimated to have been processed for mostly juice production. At the same year, the European Union harvested 13,, tons of apples and around 1,, tons of apple pomace was produced per year [3]. In Sweden, around 2, tons of apples are produced every year (21) [4]. Raw apple pomace has limitations, it uses up large amounts of storage in apple processing plants due to its high water content and is susceptible to spoilage and microbial growth. Because of this, apple pomace is often regarded as waste and is disposed of in landfills, but it is also used as animal feed despite its low nutritional value [5]. Apple pomace in landfills can be a problem due to its acidic nature and prevents nearby seeds to germinate. Ruminant animals that eat apple pomace might be poisoned by alcohol that is produced by fermented apple pomace in their rumen [2]. A solution could be to dry and mill the apple pomace to reduce the density and become more economically sustainable in both storage and transportation [5]. Apple pomace used to be dried out in the sun, however, the apple pomace will be darkened due to enzymatic or oxidative browning and will lose its value as human food fortification. Therefore it is important to dry apple pomace enough to still be a useful resource; however, this could have a varying cost depending on how much energy is spent and the end-use [1]. In the industry, apple pomace is used to extract pectin with mineral based acids such as H2SO4, HNO3 and HCl. A common yield ranges between 1-15 % dry weight pectin of dry weight apple pomace. The pomace that has been subjected to pectin extraction often leaves an acidic waste and could be a potential pollutant. Jing Luo, et al. (219) considered the use of AA (acetic acid) to extract pectin in industrial use as an alternative to mineral acids. A stainless-steel system was used to adjust different variables such as AA concentration, temperature and time. 1
6 The highest yield of pectin, 19.6 % dry weight pectin compared to the dry weight of apple pomace was achieved with an AA concentration of 1 % (w/w), 1 C for 11 minutes [6]. Apple pomace could be used as a substrate to produce useful resources through fermentation due to its high soluble sugar content (glucose, fructose and sucrose). It consists of sugar polymers such as cellulose and hemicellulose. It also contains lignin which is a polyaromatic compound that covers the sugar polymers. A study by Gabriel S. L. et al. (213), presented an analysis of typical sugar fractions, varying depending on apple cultivars, such as % glucose, % fructose and roughly 3 % sucrose [7]. Dry apple pomace consists of 56 % carbohydrates (15.6 % soluble carbohydrates, 21.2 % cellulose and 14.8 % hemicellulose). The remaining composition is 18.5 % lignin and small amounts of water, proteins, fats and ash [3]. 1.1 Background When using apple pomace as a substrate it is important to extract as much sugar as possible. The high lignin and pectin content in apple pomace form a network that traps the sugars. To break this barrier, several pre-treatment methods can be used, one of which utilizes an acid or alkali substance to free the sugar polymers and increase the overall yield [8]. Several studies considered the use of apple pomace to produce Bio-H2, Bioethanol, Biobutanol and citric acid [3, 5, 8-1]. Apple pomace was used as a substrate to produce Bio-H2 via activity of a bacterial consortium from a river sludge through anaerobic digestion. The pomace was either pre-treated with sulphuric acid or ammonia liquor for disruption of the lignin and hemicellulose matrix to free cellulose and free sugars. In this study, only free sugars from apple pomace were investigated. Several factors affect the H2 production such as ph, temperature and substrate concentration. The concentration of apple pomace has a significant impact on how much H2 can be produced. Having a higher concentration resulted in lower yields since bacteria might produce alcohol and lactate instead of H2 and volatile fatty acids (VFA), at higher H2 partial pressure. Higher concentrations would also increase the production of VFAs that will decrease the ph and inhibit growths. Therefore, the optimal concentration for apple pomace was determined to be 15 g/l (g Apple pomace /l water), fermented at 37 C and a ph of 7. resulted in a CHYm (maximum cumulative H2 yield) of 11.8 ml/g TS (total solids) [5]. A similar study investigated production of H2 with enzymatic hydrolysis. The apple pomace was pre-treated with hydrochloric acid, sulphuric acid or ammonia liquor at different concentrations. Apple pomace 2
7 was hydrolysed with cellulase at a ph of 5. and a substrate concentration of 2 g/l (g pomace / l water) to determine the optimal hydrolysis time, temperature and cellulase dosage. The results show that the highest CHYm was 134 ml/g TS for apple pomace pre-treated with ammonia liquor and hydrolysed for 48h at 45 C and cellulase dosage of 12.5 mg/g TS. The substrate concentration was 15 g/l (AP/W), fermented at 37 C and ph 7. [9]. Production of bioethanol with apple pomace as substrate was investigated using enzymatic hydrolysis of the apple pomace and fermented with the baker s yeast Saccharomyces cerevisiae. Apple pomace was subjected to enzymatic hydrolysis using cellulase, pectinase and hemicellulase to breakdown lignocellulosic materials into useful free sugars such as glucose. Two pre-treatments were tested with either sulphuric acid or calcium oxide to investigate the impact on the production of bioethanol along with enzymatic hydrolysis. However, it yielded similar results to non-pre-treated pomace with enzymatic hydrolysis and was not used for fermentation. The fermentation had a metabolic yield of 92 % (g ethanol/g sugar) and a yield of 13.4 % (g ethanol/g pomace) [8]. Apple pomace was used as a substrate to produce Bio-butanol with Clostridium beijerinckii CECT 58 through anaerobic digestion. Several physicochemical pre-treatments were tested to determine which kind of treatment would result in the most extraction of free sugars and cellulosic material for enzymatic hydrolysis. The physicochemical pre-treatments consist of auto hydrolysis, different acids, alkalis, organic solvents and surfactants. The results showed that alkalis did not release as much sugars compared to the other pre-treatments and thus they were not further tested. Those that performed the best, from highest to lowest extracted sugars were HNO3, PEG 6 and acetone. HNO3 recovered the most sugars with an efficiency of 76 % compared to the lowest one with 38 % for acetone. During fermentation in apple pomace pre-treated with HNO3 the bacterium consumed 6 ± 1 % of the extracted sugars and therefore produced little Butanol. The author believes that it might be due to it having the highest production of inhibitors during pre-treatment and might have prevented enzymatic hydrolysis. Thus, the highest butanol concentration of 9.11 g/l was produced from PEG 6 surfactant with a sugar consumption of 91 %. The yield was.28 g butanol per g total sugars consumed [3]. Dried and grounded apple pomace was used to inoculate Aspergillus niger BC1 in a packed-bed reactor for production of citric acid. Several parameters during fermentation were observed such as aeration rate, bed height, particle size of the apple pomace and moisture content. The 3
8 author observed that having a higher aeration rate decreased the overall citric acid yield (g citric acid/ kg dry apple pomace). Having a higher bed height, particle size and moisture content provided a higher citric acid yield. The highest yield of citric acid was 124 g citric acid per 1 kg dry apple pomace, provided from the conditions of.81 l/min aeration rate, a bed height of 1 cm, particle sizes between mm and a moisture content of 78% (weight water/weight pomace) [9]. 1.2 Purpose The purpose of this bachelor thesis was to evaluate if the by-product apple pomace can be used for the cultivation of a filamentous fungus. The evaluation was carried out by monitoring ethanol and biomass concentrations during fungal cultivation. Different factors were investigated including pretreatment strategy and need of ph adjustment. The apple pomace was kindly provided by Herrljunga cider. Herrljunga cider is a local brewer producing cider and must in Sweden, the company started in
9 2. MATERIAL AND METHOD Material: Apple pomace was provided by Herrljunga cider, while the following chemicals were purchased from common suppliers: D-glucose anhydrous (Fisher chemical), Peptone Special (Sigma-Aldrich), Agar bacteriological (Scharlau), Sulphuric Acid (2 % w/w, prepared beforehand), Sodium hydroxide (1 M, prepared beforehand). 1. Preparation of apple pomace for fermentation 1.1. Extraction of water-soluble fractions and their application for fungal fermentation Water soluble fractions were extracted from apple pomace through the following process: apple pomace and distilled water were mixed together in 2 ml beakers, according to Table 1 below. The contents were mixed with a gloved hand to let the water cover as much apple pomace as possible. For cold treatments at room temperature, the beakers were covered with an aluminium foil to prevent moisture loss and left overnight. The warm samples were boiled for 3 minutes and cooled to room temperature. Table 1, pomace and water ratios for apple juice growth medium. Batch Temperature Mass apple pomace Mass water Mixing method A Room 4 g 2 g Manually B Room 2 g 2 g Manually C Boiling 4 g 2 g Manually D Boiling 2 g 2 g Manually Apple juice was extracted from the soaked pomace by pressing it through a fabric, afterwards the juice was filtered a second time with the same fabric to remove small particles. The volume of apple juice was measured and 5 ml juice was moved to 1 ml Erlenmeyer flasks which were closed with a cotton plug and aluminium foil on top. The juice was autoclaved for 2 minutes at 121 C with a Systec Autoclave. The batches were made in duplicate. The remaining apple juice was stored in centrifuge tubes and put in a freezer for further use. The filtered apple pomace was weighted and then dried in an oven at 7 C to measure the dry weight. This was to evaluate the remaining water content in the apple pomace. 5
10 1.2. Preparation of apple pomace water mixture and their application for fungal fermentation Apple pomace suspensions were prepared through the following process: Batches E and F were prepared according to Table 2 in a non-mixed manner (not homogenised), and added to 25 ml Erlenmeyer flasks, closed with a cotton plug and aluminium foil on top, while Batches G and H were mixed together with a kitchen blender to form a homogenised smoothie. Similarly, to E and F, around 1 g of the homogenised suspension were transferred to 25 ml Erlenmeyer flasks and closed with a cotton plug and aluminium foil on top. Table 2, pomace and water ratios for apple pomace suspension growth medium. Batch Temperature Mass apple pomace Mass water Mixing method E Room 1 g 9 g None F Room 2 g 8 g None G Room 1 g 9 g Blender H Room 2 g 8 g Blender Similarly, to the water-soluble fractions, the batches were made in duplicates. These flasks were sterilised for 2 minutes at 121 C using a Systec Autoclave Adjusting ph of water soluble fractions and their use for fungal fermentation The remaining apple juice from Batches A and B mentioned earlier was prepared for ph adjustment. In 1 ml Erlenmeyer flasks, 5 ml of A and B were transferred to their respective flasks. The ph was measured using a ph-meter under stirring to ensure a homogenous solution when adding 1 M NaOH to increase the ph to 5.5 from the average initial ph When the samples have reached the ph to around 5.5, the flasks were sealed with cotton plugs and aluminium foil to be sterilised for 2 minutes at 121 C in a Systec Autoclave. This was done in duplicates. Batches I and I5.5 were prepared by mixing with a gloved hand, 4 g of apple pomace and 1 g water (Table 3) to a 2 ml beaker. The mixture was covered in an aluminium foil to prevent moisture loss and was left to stay overnight. The following day, the mixture was filtered similarly to A-D mentioned earlier. The volume of apple juice was measured and divided into 6
11 two 5 ml batches called I and I5.5. Batch I will be a non-ph adjusted control for the ph adjusted sample I5.5. Sample I5.5 was ph adjusted to 5.5 similarly to sample A5.5 and B5.5 using 1 M NaOH. The flasks were sealed with cotton plugs and aluminium foil to be sterilised for 2 minutes at 121 C in a Systec Autoclave. This was done in duplicates. Table 3, pomace and water ratios for ph adjusted apple juice growth medium. Batch Temperature Mass apple pomace Mass water Mixing method A 5.5 Room 4 g 2 g None B 5.5 Room 2 g 2 g None I Room 4 g 1 g Manually I 5.5 Room 4 g 1 g Manually 2. Preparation of agar plates Agar was prepared by mixing 4. g Glucose,.8 g peptone and 3.4 g agar with 2 ml distilled water in a 4 ml beaker. The ph was adjusted to 5.5 using Sulphuric Acid (2 % w/w). The contents were stirred with a magnetic stirrer to ensure homogeneity before autoclavation. The agar mixture was autoclaved in Systec Autoclave at 121 C for 2 minutes. The sterilised agar mixture was poured onto petri dishes under aseptic conditions and left at room condition to solidify. After solidifying, a spore suspension was prepared by adding 2 ml autoclaved distilled water to a plate of Rhizomucor fungus, spores were scraped from the plate using a spreader. Afterwards, the spore suspension was poured from the plate to a sterile centrifuge tube. This was all done under aseptic conditions. The spore suspension was used to inoculate the agar plates,.1 ml spore suspension was spread with a spreader on each plate under aseptic conditions. The plates were placed in an oven at 3 C for 4 days to grow. 3. Inoculation of fungi, fermentation, and sampling. A spore suspension was prepared by adding 2 ml autoclaved distilled water to one of the previously prepared agar plates, spores were scraped from the plate using a spreader. Afterwards, the spore suspension was poured from the plate to a sterile centrifuge tube. This was all done under aseptic conditions. The sugar extract was inoculated by adding 1 ml spore 7
12 suspension per 5 ml extract. The Erlenmeyer flasks were shaken lightly and a 1 ml per 5 ml extract sample was taken. The fungi was allowed to grow for 72 hours in a shake water bath at 35 C and 1 rotations per minute, with samples taken every 24 hours. The sampling was conducted under aseptic conditions by transferring 1 ml liquid from the Erlenmeyer flask to a 1.5 ml Eppendorf tube. The sample was then centrifuged using a Heraeus Fresco 21 centrifuge at 1 G for 1 minutes. The supernatant was then transferred to another 1.5 ml Eppendorf tube and placed in a freezer for further HPLC analysis Harvesting of Biomass On the third day of growth, after the last sampling, the contents in the Erlenmeyer flasks were separated with a kitchen sieve and a beaker under it. A spoon was used to push out the remaining liquid from the biomass into the beaker. The liquid collected in the beaker was measured using a graduated cylinder and later transferred to a 5 ml Eppendorf tube to centrifuge at 5 x g for 1 minutes using a Heraeus Megafuge 8. The supernatant was removed, and the solids were collected, weighted, dried and weighted again to determine the mass of suspended solids. The remaining biomass that was collected in the sieve was washed two to three times with distilled water, dried at 7 C and weighted. 4. Analysis of ethanol and sugar concentration The samples that were collected through the entire experiment were analysed using HPLC (High-Performance Liquid Chromatography) to determine sugar and ethanol concentrations. The HPLC was using a hydrogen-ion based ion-exchange column (Aminex HPX-87H, Bio- Rad, Hercules, CA, USA) at 6 C, using.6 ml/min of.5 mm H2SO4 solution as an eluent and an RI detector. The samples were centrifuged using a Heraeus Fresco 21 centrifuge at 1 G for 1 minutes to try to remove as much solids as possible. Around 1ml of each sample was transferred to a glass vial. Since the volume of water insoluble fraction samples were too small,.3 ml from samples E-H were extracted to their own Eppendorf tube along with.9 ml of distilled water. Similarly, to the previous samples, they were centrifuged at 1 G for 1 minutes and 1ml was transferred to each individual vial. 8
13 5. Determining ethanol and biomass yield. To know how much dry biomass was used per batch, several samples were collected during the experiment. The mass of the wet apple pomace after filtration was weighted, dried and weighted again. The difference in weight (g dry / g wet) determines the dry content of the pomace. This will be used to approximate how much dry pomace is used per batch. Apple pomace concentration per batch was calculated by dividing the amount of apple pomace (g) with the total extracted volume (l). To know how much equivalent wet pomace is used per sample, the concentration was multiplied with the volume of sample (l). Lastly, to determine the equivalent dry pomace per sample, the dry content of the pomace was multiplied with the equivalent wet volume. The mass (g) of ethanol and biomass was calculated by multiplying their final concentration with the sample volume. To determine the ethanol and biomass yield, their corresponding mass (g) of a sample was divided with the equivalent dry weight pomace (kg) of the same sample. 3. RESULTS 3.1. Biomass yield from water soluble fractions Water soluble fractions were extracted from soaked pomace by filtration with a fine fabric. Apple juice was inoculated with Rhizomucor and grown in Erlenmeyer flasks for 72 hours at 35 C in a water shake bath. Biomass was separated from the growth suspension and the dry weight was measured. The biomass concentration was determined from the amount dry biomass per liter broth. It was observed during filtration that the soaked apple pomace still had a large amount of water content remaining. The yields could be improved by optimizing the filtration method. The biomass separated easily from the broth, at first it was brown, very soft and contained a lot of moisture. By washing it and pushing out the water it became stiffer and contracted until it formed a nice small white-greyish ball. Using an apple pomace to water ratio of 1 g/g (9.7 g ethanol/g dry apple pomace) gave higher biomass yields than 2 g/g (7.7 g ethanol/g dry apple pomace) and 4 g/g (4. g ethanol/g dry apple pomace) for both water temperature indicating that a lower pomace to water ration could 9
14 potentially improve yields. The use of hot water treatment gave no higher biomass yield compared to cold water treatment and was in fact lower, this can be seen in Table Biomass yield from water soluble fractions with adjusted ph To study the effects of the ph, the apple pomace extract obtained using 1 and 2 g pomace/g water was subjected to a ph adjustment process (at 5.5) before the cultivation. Two new batches with a pomace to water ratio of 4 g/g were prepared using cold water, one was adjusted to ph 5.5 while the other was kept as a reference. Water soluble fractions had a ph adjustment, 1 M Sodium hydroxide was added dropwise to the apple juice until the ph was around 5.5. It was observed that the final ph regardless if it was adjusted or not always stayed at around 3.5. Adjusting the ph was not beneficial as seen by the lower yield compared to the non-ph adjusted samples as seen on 1 g/g going from a yield of 9.7 g/kg to 7.6 g/kg. The reason might be due to the larger change of ph during fermentation compared to the non-changed samples as seen in Table 5. Table 4: Biomass yields from water soluble fractions with different apple pomace to water ratios. A (2 g P /g W), B (1 g P/g W) and I (4 g P/g W) were extracted with room temperature water. C (2 g P /g W) and D (1 g P /g W) were extracted with boiling water. A5.5 (2 g P /g W), B5.5 (1 g P /g W) and I5.5 (4 g P /g W) were extracted with room temperature water and had their ph adjusted to 5.5 Biomass yields for pomace to water ratios at different temperatures and ph adjustments (g biomass/ kg dry apple pomace) A B C D I B5.5 A5.5 I ± 9.7 ± 4.47 ± 9.52 ± 4. ± 7.6 ± 6.45 ± 3.48 ± Table 5: ph before adjustment, ph after adjustment and ph after fermentation for water soluble fractions with different apple pomace to water ratios. A5.5 (2 g P /g W), B5.5 (1 g P /g W) and I5.5 (4 g P /g W) were extracted using room temperature water and had their ph adjusted to 5.5. I (4 g P /g W) was extracted using room temperature water. Extraction condition ph before adjustment Adjusted ph B A I I ph after fermentation 1
15 3.3. Biomass concentration from water insoluble fractions Apple pomace suspensions were made by mixing apple pomace and distilled water with a kitchen blender. A non-mixed suspension was also made. Similarly mentioned earlier, the batches were inoculated, fermented and the biomass was separated. It was observed that the biomass was hard to separate from the growth suspension. A lot of apple pomace bits were stuck onto the biomass. It was also seen that the fungi started to grow on top of the broth for the thicker F (4g W/g P) and H (4g W/g P). This could indicate that the fungi was not happy due to the lack of oxygen in the suspension. The results were deemed too inconsistent due to the large amount apple pomace solids stuck on the biomass and not further investigated (Table 6). Table 6, biomass concentration for water insoluble fractions with different water to apple pomace ratios. E (9 g W /g P) and F (4 g W/g P) were prepared without blending. G (9 g W/g P) and H (4 g W/g P) were prepared with blending. Concentration of biomass for apple suspensions (g dry biomass / l water) E F G H 7.74 ± ± ± ± Ethanol yield and sugar consumption from water soluble fractions Sample sizes of 1 ml were taken every 24 h from the growth medium during the fermentation. The samples were transferred to glass vials and analysed by the HPLC. During sugar extraction with hot water, it was noted that water evaporates significantly (145 ml from hot extraction compared to 293 ml in cold extraction) which might have influenced the yields. As a general trend for all samples, ethanol concentrations peaked at 48 hours and decreased at 72 hours. The fungi preferred to consume glucose as opposed to the high amount of sugar mix (mostly fructose) present in the solution according to Figure 1-3. The highest ethanol yield was g ethanol per kg dry apple pomace obtained using an apple pomace to water ratio of 1g P/g W and hot water while the second highest ethanol yield was 1.53 g ethanol per kg dry 11
16 apple pomace using an apple pomace to water ratio of 2 g P/g W and cold water. The only visible trends were that ph adjusted samples gave lower ethanol yields. Table 7, Ethanol yields from water soluble fractions with different apple pomace to water ratios. A (2 g P /g W), B (1 g P/g W) and I (4 g P/g W) were extracted with room temperature water. C (2 g P /g W) and D (1 g P /g W) were extracted with boiling water. A5.5 (2 g P /g W), B5.5 (1 g P /g W) and I5.5 (4 g P /g W) were extracted with room temperature water and had their ph adjusted to 5.5 Ethanol yields for pomace to water ratios at different temperatures and ph adjustments (g biomass/ kg dry apple pomace) A B C D I B5.5 A5.5 I ± 6.56 ± 6.85 ± ± 8.85 ± 3.41 ± 8.25 ± 4.58 ±
17 Sugar (g/l) Ethanol (g/l) Sugar (g/l) Ethanol (g/l) Sugar (g/l) Ethanol (g/l) Sugar (g/l) Ethanol (g/l) Sugar (g/l) Ethanol (g/l) Figure 1, Multiple graphs showing the ethanol and sugar profile for the fermentation. A (2 g P /g W), B (1 g P/g W) and I (4 g P/g W) were extracted with room temperature water. A B Sugarmix Glucose Ethanol Sugarmix Glucose Ethanol I Sugarmix Glucose Ethanol Figure 2, Multiple graphs showing the ethanol and sugar profile for the fermentation. C (2 g P /g W) and D (1 g P /g W) were extracted with boiling water. C D Sugarmix Glucose Ethanol Sugarmix Glucose Ethanol 13
18 Sugar (g/l) Ethanol (g/l) Sugar (g/l) Ethanol (g/l) Sugar (g/l) Ethanol (g/l) Figure 3, Multiple graphs showing the ethanol and sugar profile for the fermentation. A5.5 (2 g P /g W), B5.5 (1 g P /g W) and I5.5 (4 g P /g W) were extracted with room temperature water and had their ph adjusted to A B Sugarmix Glucose Ethanol Sugarmix Glucose Ethanol I Sugarmix Glucose Ethanol 14
19 4. DISCUSSION Starting with water soluble fractions, the highest biomass yields was obtained using an apple pomace to water ratios of 1 g P/g W with cold water followed by 1 g P/g W with hot water. This might be due to the water not covering the entire apple pomace when extracting using higher apple pomace to water ratios. Comparing Figure 1 and 2 shows that using hot water for the extraction does not contribute to that much higher glucose concentrations, but the ethanol concentrations increases significantly, although we do not have an explanation for such observation. The cost of heating might however make this a less applicable approach. Further research should focus on lowering the apple pomace to water ratios while maintaining high yields. All glucose was not consumed so increasing the fermentation time might also result in higher yields or add nutrients to the medium to help the fungus to keep consuming sugars. Cold water extraction was deemed more interesting for the follow-up tests with ph adjustments. Apple pomace extracts with apple pomace to water ratios of 1, 2 and 4 g/g were prepared and ph was adjusted to 5.5. However, adjusting the ph to 5.5 decreased the biomass and ethanol production. This is unlike in other research which had a small increase in biomass and ethanol yields when cultivating Rhizopus oryzae in a solid-rich wastewater stream from a wheat-starch plant [1]. The ethanol production decreased. This might be due to the ph being less constant during the fermentation, leading to less production since the fungus is always adjusting. The yield could improve by having a constant ph of 5.5 with a bioreactor since the low ph could ve stopped the fungal growth. The fungus grew on the surface of low water to pomace mediums when cultivated with water insoluble fractions. Observations during fermentation showed that the liquid had limited movement due to the viscous nature from the large amount of insoluble mass. Therefore, it is suspected that the fungus did not thrive due to a lack of oxygen in the broth. Support for this suspicion was found in literature study by Gibbs, P.A., et al., (2), where the effects of high viscosity on filamentous fungi was discussed [11]. Having higher aeration provided from an airlift bioreactor could potentially help. The results show that Rhizomucor prefers to consume glucose over fructose. This is in accordance with research done by Satari, B., et al., (216), where free sugars from citrus waste containing mostly glucose and fructose was used for cultivation of Mucor indicus and Rhizopus 15
20 oryzae. The fructose remained intact during the cultivation in the shake flaks while glucose was completely consumed [12]. Due to the high amount of remaining fructose present in the broth, more research could be carried out to optimize the fructose consumption including e.g. longer cultivation time or different fungal strains. 4.1 Future work Several suggestions for future work were thought about during this research project. The goal was to see how much biomass can be produced from apple pomace as a sugar source for a filamentous fungus. The amount of biomass could be improved by the following steps. Use lower apple pomace to water rations for water soluble fractions. Adding nutrients to medium for better sugar consumption. Having higher aeration for apple pomace suspension samples. Having a constant ph of 5.5 with a bioreactor. Increase the duration for fermentation to longer than 3 days. Improve the filtration method and extract more juice from the pomace to increase the overall yield. 16
21 5. CONCLUSIONS In conclusion, water soluble fractions acquired by pre-treating apple pomace with cold distilled water for 24 h with an apple pomace to water ratio of 1g P/1g W, produced the most biomass per kg dry apple pomace. Heat treatment and ph adjustment had no positive impact on biomass production since both decreased during fermentation. The fungus Rhizomucor sp. preferred consuming glucose over fructose during the growth. The general trend was that lower apple pomace to water ratios resulted in higher yields. The highest ethanol yields were acquired by pre-treating apple pomace with boiling distilled water for 3 minutes with an apple pomace to water ratio of 1g P/1g W. Since the yield was similar to that of cold water, heat-treatment might not be applicable due to energy costs. The yields for hot water treatment might not be accurate due to evaporation during extraction. More research should be made to improve several aspects of this methodology to extract more sugars and increase the overall yields for biomass and ethanol production. 17
22 6. REFERENCES 1. Shashi Bhushan, K.K., Madhu Sharma, Bikram Singh & P. S. Ahuja, Processing of Apple Pomace for Bioactive Molecules. Critical Reviews in Biotechnology, (4): p Cargnin, S.T. and S.B. Gnoatto, Ursolic acid from apple pomace and traditional plants: A valuable triterpenoid with functional properties. Food Chemistry, : p Hijosa-Valsero, M., A.I. Paniagua-García, and R. Díez-Antolínez, Biobutanol production from apple pomace: the importance of pretreatment methods on the fermentability of lignocellulosic agro-food wastes. Applied Microbiology and Biotechnology, (21): p Jönsson, E., Apple pomace in Southern Sweden, current uses and potential for new products 21, Sveriges Lantbruksuniversitet. p Feng, X., et al., Biohydrogen production from apple pomace by anaerobic fermentation with river sludge. International Journal of Hydrogen Energy, (7): p Luo, J., Y. Xu, and Y. Fan, Upgrading Pectin Production from Apple Pomace by Acetic Acid Extraction. Applied Biochemistry and Biotechnology, (4): p Gabriel, L.S., et al., Multivariate Analysis of the Spectroscopic Profile of the Sugar Fraction of Apple Pomace. BRAZILIAN ARCHIVES OF BIOLOGY AND TECHNOLOGY, (3): p Magyar, M., et al., Conversion of apple pomace waste to ethanol at industrial relevant conditions. Applied Microbiology and Biotechnology, (16): p Hui Wang, J.W., Zhong Fang, Xiaofang Wang abd Huaiyu Bu, Enhanced biohydrogen production by anaerobic fermentation of apple pomace with enzyme hydrolysis. International Journal of Hydrogen Energy, (15): p Souza Filho, P.F., A. Zamani, and M.J. Taherzadeh, Edible Protein Production by Filamentous Fungi using Starch Plant Wastewater. Waste and Biomass Valorization, Gibbs, P.A., R.J. Seviour, and F. Schmid, Growth of Filamentous Fungi in Submerged Culture: Problems and Possible Solutions. Critical Reviews in Biotechnology, 2. 2(1): p Satari, B., et al., Co-Production of Fungal Biomass Derived Constituents and Ethanol from Citrus Wastes Free Sugars without Auxiliary Nutrients in Airlift Bioreactor. International journal of molecular sciences, (3): p
23 Besöksadress: Allégatan 1 Postadress: 51 9 Borås Tfn: E-post: registrator@hb.se Webb:
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET National Swedish parental studies using the same methodology have been performed in 1980, 2000, 2006 and 2011 (current study). In 1980 and 2000 the studies
Iron VARIO PP mg/l Fe g) 1,10-Phenanthroline
Iron VARIO PP 0.02-1.5 mg/l Fe g) 1,10-Phenanthroline 221 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range
TN LR TT mg/l N b) 2,6-Dimethylphenole
TN LR TT 0.5-14 mg/l N b) 2,6-Dimethylphenole 283 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Documentation SN 3102
This document has been created by AHDS History and is based on information supplied by the depositor /////////////////////////////////////////////////////////// THE EUROPEAN STATE FINANCE DATABASE (Director:
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
TN HR TT b) i) 5-140 mg/l N 2,6-Dimethylphenole 284 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the
Lignin i pulverpannor
Lignin i pulverpannor SEKAB 1 Project A08-847 2 Ca 100 anställda Omsättning ca 1,2 miljarder SEK Kemikalier och drivmedel baserade på etanol Utvecklat cellulosabaserad etanol ca 15 år 3 ED95 VEHICLES Euro
GERDA Cryostat Rn emanation
GERDA Cryostat Rn emanation K.T. Knöpfle, B. Schwingenheuer, H. Simgen, G. Zuzel MPI für Kernphysik, Heidelberg General remarks Tolerable rate: ~8 (14) mbq 10-4 cts/(kg kev y) assuming homogenous Rn distribution
Om oss DET PERFEKTA KOMPLEMENTET THE PERFECT COMPLETION 04 EN BINZ ÄR PRECIS SÅ BRA SOM DU FÖRVÄNTAR DIG A BINZ IS JUST AS GOOD AS YOU THINK 05
Om oss Vi på Binz är glada att du är intresserad av vårt support-system för begravningsbilar. Sedan mer än 75 år tillverkar vi specialfordon i Lorch för de flesta olika användningsändamål, och detta enligt
Boiler with heatpump / Värmepumpsberedare
Boiler with heatpump / Värmepumpsberedare QUICK START GUIDE / SNABBSTART GUIDE More information and instruction videos on our homepage www.indol.se Mer information och instruktionsvideos på vår hemsida
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
MILJÖBEDÖMNING AV BOSTÄDER Kvarteret Nornan, Glumslöv
INSTITUTIONEN FÖR TEKNIK OCH BYGGD MILJÖ MILJÖBEDÖMNING AV BOSTÄDER Kvarteret Nornan, Glumslöv Eva Lif Juni 2008 Examensarbete i Byggnadsteknik, 15 poäng (C-nivå) Handledare (intern): Mauritz Glaumann
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
Klimatpåverkan och de stora osäkerheterna - I Pathways bör CO2-reduktion/mål hanteras inom ett osäkerhetsintervall
Klimatpåverkan och de stora osäkerheterna - I Pathways bör CO2-reduktion/mål hanteras inom ett osäkerhetsintervall Vi måste förstå att: Vårt klimat är ett mycket komplext system Många (av människan påverkade)
CUSTOMER READERSHIP HARRODS MAGAZINE CUSTOMER OVERVIEW. 63% of Harrods Magazine readers are mostly interested in reading about beauty
79% of the division trade is generated by Harrods Rewards customers 30% of our Beauty clients are millennials 42% of our trade comes from tax-free customers 73% of the department base is female Source:
Consumer attitudes regarding durability and labelling
Consumer attitudes regarding durability and labelling 27 april 2017 Gardemoen Louise Ungerth Konsumentföreningen Stockholm/ The Stockholm Consumer Cooperative Society louise.u@konsumentforeningenstockholm.se
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Framtidens Bioraffinaderi mycket. mer än papper och massa
Framtidens Bioraffinaderi mycket mer än papper och massa 9.45-10.15 fika 10.15-10.45 Framtidens Bioraffinaderi Jennie 10.45-11.30 Trädet vår råvara och möjlighet Stefan Svensson 11.30-12.30 Lunch 12.30-13.00
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
DR.B.VIDYA ASSISTANT PROFESSOR DEPARTMRNT OF ANIMAL NUTRITION CVSC, KORUTLA
DR.B.VIDYA ASSISTANT PROFESSOR DEPARTMRNT OF ANIMAL NUTRITION CVSC, KORUTLA INTRODUCTION INDIA- Sheep and Goat play a vital role in rural economy Sheep - 75 million ( FAOSTAT,2012) Goat - 160 million In
Dokumentnamn Order and safety regulations for Hässleholms Kretsloppscenter. Godkänd/ansvarig Gunilla Holmberg. Kretsloppscenter
1(5) The speed through the entire area is 30 km/h, unless otherwise indicated. Beware of crossing vehicles! Traffic signs, guardrails and exclusions shall be observed and followed. Smoking is prohibited
INSTALLATION INSTRUCTIONS
INSTALLATION - REEIVER INSTALLATION INSTRUTIONS RT0 RF WIRELESS ROOM THERMOSTAT AND REEIVER MOUNTING OF WALL MOUTING PLATE - Unscrew the screws under the - Pack contains... Installation - Receiver... Mounting
Kundfokus Kunden och kundens behov är centrala i alla våra projekt
D-Miljö AB bidrar till en renare miljö genom projekt där vi hjälper våra kunder att undersöka och sanera förorenad mark och förorenat grundvatten. Vi bistår dig som kund från projektets start till dess
Workplan Food. Spring term 2016 Year 7. Name:
Workplan Food Spring term 2016 Year 7 Name: During the time we work with this workplan you will also be getting some tests in English. You cannot practice for these tests. Compulsory o Read My Canadian
Syns du, finns du? Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap
Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap Syns du, finns du? - En studie över användningen av SEO, PPC och sociala medier som strategiska kommunikationsverktyg i svenska företag
Etanol och biogas ur cellulosarika avfall. Utbildning om Resursåtervinning
Etanol och biogas ur cellulosarika avfall Mohammad Taherzadeh Ingenjörshögskolan Högskolan i Borås Centrum för optimal resurshantering av avfall www.wasterefinery.se Utbildning om Resursåtervinning Masterutbildning:
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH 2016 Anne Håkansson All rights reserved. Svårt Harmonisera -> Introduktion, delar: Fråga/
Country report: Sweden
Country report: Sweden Anneli Petersson, PhD. Swedish Gas Centre Sweden Statistics for 2006 1.2 TWh produced per year 223 plants 138 municipal sewage treatment plants 60 landfills 3 Industrial wastewater
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Make a speech. How to make the perfect speech. söndag 6 oktober 13
Make a speech How to make the perfect speech FOPPA FOPPA Finding FOPPA Finding Organizing FOPPA Finding Organizing Phrasing FOPPA Finding Organizing Phrasing Preparing FOPPA Finding Organizing Phrasing
A study of the performance
A study of the performance and utilization of the Swedish railway network Anders Lindfeldt Royal Institute of Technology 2011-02-03 Introduction The load on the railway network increases steadily, and
COPENHAGEN Environmentally Committed Accountants
THERE ARE SO MANY REASONS FOR WORKING WITH THE ENVIRONMENT! It s obviously important that all industries do what they can to contribute to environmental efforts. The MER project provides us with a unique
http://marvel.com/games/play/31/create_your_own_superhero http://www.heromachine.com/
Name: Year 9 w. 4-7 The leading comic book publisher, Marvel Comics, is starting a new comic, which it hopes will become as popular as its classics Spiderman, Superman and The Incredible Hulk. Your job
Fade to Green. stegen mot grönare hudvårdsprodukter. Tomas Byström Produktutvecklare. Grönt ljus för Grön kemi? 2011-03-23
Fade to Green stegen mot grönare hudvårdsprodukter Tomas Byström Produktutvecklare Grönt ljus för Grön kemi? 2011-03-23 Kort om ACO Hud ACO grundades 1939 ACO Hud sedan mitten av 1980-talet Numer ägare
MAP Modified Atmosphere Packaging CA Controlled Atmosphere + .* +0 +* +1. MA Modified Atmosphere MA MA
271 MA MA + + +, + : 20-., : /1+. - : --./ 33. 2 + a, MAP Modified Atmosphere Packaging CA Controlled Atmosphere + b + c.* +0 +* +1 +,//*,*** t +,.1-,*** t +, - MA Modified Atmosphere -*/ 20.,, + +, Email
SOLAR LIGHT SOLUTION. Giving you the advantages of sunshine. Ningbo Green Light Energy Technology Co., Ltd.
2017 SOLAR LIGHT SOLUTION Address:No.5,XingYeMiddleRoad,NingboFreeTradeZone,China Tel:+86-574-86812925 Fax:+86-574-86812905 Giving you the advantages of sunshine SalesServiceE-mail:sales@glenergy.cn Tech.ServiceE-mail:service@glenergy.cn
Hampaförpackningar Idag och imorgon
Hampaförpackningar Idag och imorgon Lars Sickert Tetra Pak LS/2012-03-28 TP206, JH/0208 1 Today s package portfolio TP106, JH/0208 A systems supplier of Processing solutions Packaging solutions Distribution
12.6 Heat equation, Wave equation
12.6 Heat equation, 12.2-3 Wave equation Eugenia Malinnikova, NTNU September 26, 2017 1 Heat equation in higher dimensions The heat equation in higher dimensions (two or three) is u t ( = c 2 2 ) u x 2
Agreement EXTRA. Real wage increases, expanded part-time pensions and a low-wage effort in the unions joint agreement demands.
Agreement EXTRA Real wage increases, expanded part-time pensions and a low-wage effort in the unions joint agreement demands. NOVEMBER 12016 United unions with combined strength in new wage negotiations
Support Manual HoistLocatel Electronic Locks
Support Manual HoistLocatel Electronic Locks 1. S70, Create a Terminating Card for Cards Terminating Card 2. Select the card you want to block, look among Card No. Then click on the single arrow pointing
BOENDEFORMENS BETYDELSE FÖR ASYLSÖKANDES INTEGRATION Lina Sandström
BOENDEFORMENS BETYDELSE FÖR ASYLSÖKANDES INTEGRATION Lina Sandström Frågeställningar Kan asylprocessen förstås som en integrationsprocess? Hur fungerar i sådana fall denna process? Skiljer sig asylprocessen
Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance?
r Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance? - A pilot study Susan Sarwari and Mohammed Fazil Supervisors: Camilla Ahlgren Department of
(Aloe vera L.) Downloaded from jcb.sanru.ac.ir at 20: on Thursday October 24th Liliaceae
71... 1390 /7 / / (Aloe vera L.) 2 2 1..... (Aloe vera L.).... MS (2 ). P (1 ) I (0/25 ) -1-2 90/12/21 : 89/6/22 : IAA (0/1 ) (0/5 0/2 ) Kin (1-0/5 ). I (1 ) (1-0/2 ). 10/66 1/36 (2 ) + Kin (0/5 ) + (2
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Grass to biogas turns arable land to carbon sink LOVISA BJÖRNSSON
Grass to biogas turns arable land to carbon sink LOVISA BJÖRNSSON Project funding and reporting, Thomas Prade & Mikael Lantz (2016) Grass for biogas - Arable land as carbon sink. Report 2016:280. Energiforsk,
Why Steam Engine again??
Småskalig ångteknik för värmeåtervinning inom Stålindustrin med modern ångmotor 1 Why Steam Engine again?? Rankine power cycles is more fuel flexible than any other power cycles but in the small scale
2 locations Blackwell and Cherokee Treatment Structure
Brian Arnall 2 locations Blackwell and Cherokee Treatment Structure 1 Check, no starter 2 10-34 34-0 @ 5 gal/ac 10-34 34-0 @ 3gal/ac KTS (potassium thiosulfate)@ 2 3 gal/ac 10-34 34-0 @ 3 gal/ac ATS (ammonia
The Municipality of Ystad
The Municipality of Ystad Coastal management in a local perspective TLC The Living Coast - Project seminar 26-28 nov Mona Ohlsson Project manager Climate and Environment The Municipality of Ystad Area:
Health café. Self help groups. Learning café. Focus on support to people with chronic diseases and their families
Health café Resources Meeting places Live library Storytellers Self help groups Heart s house Volunteers Health coaches Learning café Recovery Health café project Focus on support to people with chronic
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen
Examensarbete Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen Malin Carlström, Sandra Mårtensson 2010-05-21 Ämne: Informationslogistik Nivå: Kandidat Kurskod: 2IL00E Projektmodell
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
TETRA Chemicals Europe
TETRA Chemicals Europe Company presentation 2016 2016-04-05 2013 TETRA Chemicals Europe 1 TETRA Chemicals Europe The CC Specialists Leader in the production and distribution of CC (Calcium Chloride) Unique
Methods to increase work-related activities within the curricula. S Nyberg and Pr U Edlund KTH SoTL 2017
Methods to increase work-related activities within the curricula S Nyberg and Pr U Edlund KTH SoTL 2017 Aim of the project Increase Work-related Learning Inspire theachers Motivate students Understanding
The Algerian Law of Association. Hotel Rivoli Casablanca October 22-23, 2009
The Algerian Law of Association Hotel Rivoli Casablanca October 22-23, 2009 Introduction WHY the Associations? NGO s are indispensable to the very survival of societal progress Local, National or International
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and
Uttagning för D21E och H21E
Uttagning för D21E och H21E Anmälan till seniorelitklasserna vid O-Ringen i Kolmården 2019 är öppen fram till och med fredag 19 juli klockan 12.00. 80 deltagare per klass tas ut. En rangordningslista med
MÄTNING AV VÄGT REDUKTIONSTAL MEASUREMENT OF THE WEIGHTED SOUND TRANSMISSION LOSS
Beställare: Roca Industry AB Kontaktperson: Alexander Grinde MÄTIG AV VÄGT REDUKTIOSTAL MEASUREMET OF THE WEIGHTED SOUD TRASMISSIO LOSS Objekt: Glasdörr mm Mätningens utförande och omfattning: Tid för
The Swedish National Patient Overview (NPO)
The Swedish National Patient Overview (NPO) Background and status 2009 Tieto Corporation Christer Bergh Manager of Healthcare Sweden Tieto, Healthcare & Welfare christer.bergh@tieto.com Agenda Background
Retention of metals and metalloids in Atleverket treatment wetland Sylvia Waara & Tatsiana Bandaruk
Retention of metals and metalloids in Atleverket treatment wetland 2003-2012 Sylvia Waara & Tatsiana Bandaruk Landfill leachate is different from effluents discharged from STPs In methanogenic stage Very
Rev No. Magnetic gripper 3
Magnetic gripper 1 Magnetic gripper 2 Magnetic gripper 3 Magnetic gripper 4 Pneumatic switchable permanent magnet. A customized gripper designed to handle large objects in/out of press break/laser cutting
Questionnaire on Nurses Feeling for Hospital Odors
J. Japan Association on Odor Environment Vol. -1 No. 0,**0 437 *, ** * * Questionnaire on Nurses Feeling for Hospital Odors Tomoyo ITAKURA*, **, Megumi MITSUDA*, Takuzo INAGAKI*,,/. + +-/ 13.+... + +,,
En bild säger mer än tusen ord?
Faculteit Letteren en Wijsbegeerte Academiejaar 2009-2010 En bild säger mer än tusen ord? En studie om dialogen mellan illustrationer och text i Tiina Nunnallys engelska översättning av Pippi Långstrump
Den Disruptiva Utmaningen. Christian Sandström, Tekn Dr. Chalmers och Ratio. Disruptive, Computer Sweden 16 oktober 2014
Den Disruptiva Utmaningen Christian Sandström, Tekn Dr. Chalmers och Ratio Disruptive, Computer Sweden 16 oktober 2014 Disruptiveinnovation.se ChrisSandstrom www.disruptiveinnovation.se Christian.sandstrom@ratio.se
What Is Hyper-Threading and How Does It Improve Performance
What Is Hyper-Threading and How Does It Improve Performance Ali Muthanna, Lunds Universitet, IDA2, EDT621 Abstract Hyper-Threading (HT) is Intel s version of simultaneous multi-threading (SMT). Hyper-Threading
balans Serie 7 - The best working position is to be balanced - in the centre of your own gravity! balans 7,45
balans Serie 7 - The best working position is to be balanced - in the centre of your own gravity! balans 7,45 balans dynamic seating system TM Wheelbase aluminium Hjulkryss aluminium Back support upholstered,
FANNY AHLFORS AUTHORIZED ACCOUNTING CONSULTANT,
FANNY AHLFORS AUTHORIZED ACCOUNTING CONSULTANT, SWEDEN HOW TO CREATE BLOG CONTENT www.pwc.se How to create blog content Fanny Ahlfors Authorized Accounting Consultant 5 Inbound Methodology Attract Convert
6 th Grade English October 6-10, 2014
6 th Grade English October 6-10, 2014 Understand the content and structure of a short story. Imagine an important event or challenge in the future. Plan, draft, revise and edit a short story. Writing Focus
Thesis work at McNeil AB Evaluation/remediation of psychosocial risks and hazards.
Evaluation/remediation of psychosocial risks and hazards. Help us to create the path forward for managing psychosocial risks in the work environment by looking into different tools/support/thesis and benchmarking
Senaste trenderna från testforskningen: Passar de industrin? Robert Feldt,
Senaste trenderna från testforskningen: Passar de industrin? Robert Feldt, robert.feldt@bth.se Vad är på gång i forskningen? (ICST 2015 & 2016) Security testing Mutation testing GUI testing Model-based
Goals for third cycle studies according to the Higher Education Ordinance of Sweden (Sw. "Högskoleförordningen")
Goals for third cycle studies according to the Higher Education Ordinance of Sweden (Sw. "Högskoleförordningen") 1 1. Mål för doktorsexamen 1. Goals for doctoral exam Kunskap och förståelse visa brett
Beslut om bolaget skall gå i likvidation eller driva verksamheten vidare.
ÅRSSTÄMMA REINHOLD POLSKA AB 7 MARS 2014 STYRELSENS FÖRSLAG TILL BESLUT I 17 Beslut om bolaget skall gå i likvidation eller driva verksamheten vidare. Styrelsen i bolaget har upprättat en kontrollbalansräkning
Nolato Cerbo är en del av Nolato Medical, global och ledande leverantör av polymera produkter och system. Med vårt varumärke Cerbo erbjuder vi ett bre
Nolato Cerbo är en del av Nolato Medical, global och ledande leverantör av polymera produkter och system. Med vårt varumärke Cerbo erbjuder vi ett brett sortiment av standardprodukter för användning främst
Förslag till kandidatarbeten på NMT
Förslag till kandidatarbeten på NMT 2016-2017 Anna, Mari och Jan 1 2 Hur ser kandidatarbetet på NMT ut? Du undersöker olika områden gällande naturmaterial, t.ex. Analyser Framställningsprocesser Materialegenskaper
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
Här kan du sova. Sleep here with a good conscience
Här kan du sova med rent samvete Sleep here with a good conscience MÅNGA FRÅGAR SIG hur man kan göra en miljöinsats. Det är egentligen väldigt enkelt. Du som har checkat in på det här hotellet har gjort
Collaborative Product Development:
Collaborative Product Development: a Purchasing Strategy for Small Industrialized House-building Companies Opponent: Erik Sandberg, LiU Institutionen för ekonomisk och industriell utveckling Vad är egentligen
Accepterad monteringsanvisning 2016:1. Focus (RSK: ) 1 (12)
EN Table of contents 1 Instructions for use / assembly instructions 2 Assembly 4 Adjustment 5 Dimensions 6 Flow diagram 6 Operation 7 Spare parts 8 Cleaning 9 Test certificate 10 Contact information 12
Aborter i Sverige 2008 januari juni
HÄLSA OCH SJUKDOMAR 2008:9 Aborter i Sverige 2008 januari juni Preliminär sammanställning SVERIGES OFFICIELLA STATISTIK Statistik Hälsa och Sjukdomar Aborter i Sverige 2008 januari juni Preliminär sammanställning
MOLECULAR SHAPES MOLECULAR SHAPES
Molecules with 2 electron pair groups around Linear molecules have polar bonds, but are the central atom form a linear shape. usually non-polar. is 180 linear 2 electron pairs around the central atom 1
EASA Standardiseringsrapport 2014
EASA Standardiseringsrapport 2014 Inför EASA Standardiseringsinspektion hösten 2016 Presentatör Johan Brunnberg, Flygteknisk Inspektör & Del-M Koordinator Sjö- och luftfartsavdelningen Enheten för operatörer,
English. Things to remember
English Things to remember Essay Kolla instruktionerna noggrant! Gå tillbaka och läs igenom igen och kolla att allt är med. + Håll dig till ämnet! Vem riktar ni er till? Var ska den publiceras? Vad är
Olika uppfattningar om torv och
Olika uppfattningar om torv och hållbar utveckling KSLAs och torvkongressens konferens om torv den 31 augusti 2011 Magnus Brandel, projektledare Svenska torvproducentföreningen Denna presentation diskuterar
Accepterad monteringsanvisning 2016:1. Metris (RSK: ) Metris S (RSK: ) Metris (RSK: )
EN Table of contents 1 Instructions for use / assembly instructions 2 Assembly 4-5 Adjustment 6 Operation 7 Dimensions 8-9 Flow diagram 8-9 Spare parts 10-12 Cleaning 13 Test certificate 14 Contact information
Hur fattar samhället beslut när forskarna är oeniga?
Hur fattar samhället beslut när forskarna är oeniga? Martin Peterson m.peterson@tue.nl www.martinpeterson.org Oenighet om vad? 1.Hårda vetenskapliga fakta? ( X observerades vid tid t ) 1.Den vetenskapliga
Självkörande bilar. Alvin Karlsson TE14A 9/3-2015
Självkörande bilar Alvin Karlsson TE14A 9/3-2015 Abstract This report is about driverless cars and if they would make the traffic safer in the future. Google is currently working on their driverless car
I got the idea for Frozzypack a cold January morning.
Frozzypack produces and sells a unique lunchbox whit integrated cooling in the lid. Frozzypack was created by Carolina Sundberg who solved a problem she ran into in everyday life. Frozzypack tillverkar
Här kan du checka in. Check in here with a good conscience
Här kan du checka in med rent samvete Check in here with a good conscience MÅNGA FRÅGAR SIG hur man kan göra en miljöinsats. Det är egentligen väldigt enkelt. Du som har checkat in på det här hotellet
Kursutvärderare: IT-kansliet/Christina Waller. General opinions: 1. What is your general feeling about the course? Antal svar: 17 Medelvärde: 2.
Kursvärdering - sammanställning Kurs: 2AD510 Objektorienterad programmering, 5p Antal reg: 75 Program: 2AD512 Objektorienterad programmering DV1, 4p Antal svar: 17 Period: Period 2 H04 Svarsfrekvens: 22%
Tunga metaller / Heavy metals ICH Q3d & Farmakope. Rolf Arndt Cambrex Karlskoga
Tunga metaller / Heavy metals ICH Q3d & Farmakope Rolf Arndt Cambrex Karlskoga Tunga metaller / Heavy metals Rolf Arndt -Quality Assurance Cambrex Karlskoga - Svenska Farmakopekommitten / Working Party
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
ARC 32. Tvättställsblandare/Basin Mixer. inr.se
ARC 32 Tvättställsblandare/Basin Mixer inr.se SE Användning och skötsel Manualen är en del av produkten. Bevara den under hela produktens livscykel. Vi rekommenderar er att noggrant läsa igenom manualen
Att planera bort störningar
ISRN-UTH-INGUTB-EX-B-2014/08-SE Examensarbete 15 hp Juni 2014 Att planera bort störningar Verktyg för smartare tidplanering inom grundläggning Louise Johansson ATT PLANERA BORT STÖRNINGAR Verktyg för smartare