Conformational Transition of Glycoprotein Iba Mutants in Flow Molecular Dynamics Simulation
|
|
- Magnus Jan-Olof Olofsson
- för 5 år sedan
- Visningar:
Transkript
1 Cellular and Molecular Bioengineering, Vol., No., September (Ó ) pp. 9 DOI:./s9--- Conformational Transition of Glycoprotein Iba Mutants in Flow Molecular Dynamics Simulation QINGSHENG HUANG,, JIZHONG LOU,, JIANHUA WU, and CHENG ZHU,, School of Life Sciences, Sun Yat-sen University, Guangzhou, China; Coulter Department of Biomedical Engineering, Georgia Institute of Technology, Atlanta, GA, USA; Institute for Bioengineering and Bioscience, Georgia Institute of Technology, Atlanta, GA, USA; Woodruff School of Mechanical Engineering, Georgia Institute of Technology, Atlanta, GA, USA; Laboratory of Non-coding RNAs, Institute of Biophysics, Chinese Academy of Sciences, Beijing, China; and Institute of Biomechanics and Department of Biomedical Engineering, School of Bioscience and Bioengineering, South China University of Technology, Guangzhou, China (Received November ; accepted April ; published online May ) Associate Editor David Sept oversaw the review of this article. Abstract Glycoprotein Iba (GPIba) interacts with von Willebrand factor (VWF) inducing the tethering of platelets to injured vessel walls and subsequent hemostasis process. We have previously shown that the conformation of the b-switch region of GPIbaN can be regulated by flow. Flow induces a loop-to-b-hairpin conformational change in this region, which is a suggested mechanism for the flowenhanced binding of GPIba to VWF-A. To further evaluate the mechanism and obtain more complete evidences, here we performed flow molecular dynamics simulations of wild type and a number of mutants of the b-switch. The results demonstrate that the gain-of-function mutations GV, DV, and KV promote the conformational transition toward b-hairpin, while the loss-of-function mutation QV impedes the transition. The promotion is caused mainly by the improved polarity similarity of the paired residues on the b-hairpin, and also by the decreased flexibility of one strand of the b-switch. The gain-of-function mutations exert the influence locally, affecting only hydrogen bonds near the mutated residues. The impediment of the loss-of-function mutant may be non-essential hydrophobic interactions blocking the conformational change. Keywords Flow molecular dynamics, Conformational change, Glycoprotein Iba, von Willebrand factor, Platelettype von Willebrand disease. INTRODUCTION Glycoprotein Iba (GPIba) is a platelet adhesion receptor, the major component of the glycoprotein Ib IX V complex. The interaction of GPIba with Address correspondence to Jizhong Lou, Laboratory of Noncoding RNAs, Institute of Biophysics, Chinese Academy of Sciences, Beijing, China. Electronic mail: jlou@ibp.ac.cn 9 von Willebrand factor (VWF) induces the tethering of platelets to injured vessel walls and initiates hemostasis. This interaction is regulated by blood flow, with shear stress paradoxically enhancing the binding of wild type () GPIba to VWF. Malfunction of the regulation results in disorders of hemostasis, such as platelet-type von Willebrand disease (VWD),, which is associated with gain-of-function (GOF) mutations in GPIba b-switch region. These GOF mutations increase the binding affinity of GPIba to VWF and decrease the shear stress requirement, resulting in rapid clearance of the highest molecular weight multimers of VWF 9 from blood plasma. Thus, patients with platelet-type VWD have abnormalities of hemostasis, such as prolonged bleeding time and intermittent thrombocytopenia. Loss-of-function (LOF) mutants of GPIba have also been engineered, 9 with decreased binding affinities to VWF 9,9 and increased shear stress requirements. A structural mechanism of the flow-enhanced GPIba/VWF-A interaction was recently proposed, based on flow molecular dynamics (flow MD), of GPIba and two mutants, a GOF mutant M9V and a LOF mutant AV. The flow MD, showed that flow induced a loop-to-b-hairpin conformational change (Fig. a) on the b-switch region,, which is a binding site at the concave face of GPIba, and stabilized its b-hairpin conformation. The b-hairpin conformation is different from loop conformations in the absence of flow,,,, and it can be adopted, also after GPIba is bound to VWF-A, when this b-switch region aligns with the central b-sheet of A. Compared with, mutation M9V reduces the flow requirement for the conformational change, whereas AV increases it. -//9-9/ Ó Biomedical Engineering Society
2 9 HUANG et al. Thus, the GPIba b-switch is a prototype of peptide chains whose conformation is sensitive to both the sequence and the environment,, : it switches between ordered b-hairpin and disordered loop. As a type of secondary structure, a b-hairpin (Fig. b) consists of a linking reverse turn and two b-strands with a hydrogen bond (H-bond) pattern like an antiparallel b-sheet. The other secondary structure loop is structureless, without any significant H-bond pattern. The flow-induced loop-to-b-hairpin transition on the GPIba b-switch suggests that this sequence controls the GPIba/VWF-A interaction in a flow-regulated way. It has been pointed out that side chains of the b-switch were pushed by the flow. Zou et al. s theoretical analysis suggested that the conformational transition should involve a shift of balance between entropy and enthalpy. Nevertheless, previous studies, were concerned about only mutations M9V and AV, neglecting effects derived from the difference of mutation sites, since the two tested mutations are near the proximal end of the formed b-hairpin. In this study, we performed systematic flow MD simulations to measure b-hairpin propensities of various GPIba b-switch mutants (Table ), including M9V and AV which have been studied earlier. Mutations QV (LOF) 9,9 and KV (GOF) 9,9 are on respective strands of the formed b-hairpin and near the turn, and GV (GOF),9, and DV (GOF) 9 are right on the turn (Fig. b). M9V and AV were examined again so that we could have their data handy to compare with other mutants. Our simulations cover most b-switch mutations (naturally occurring or engineered) with known phenotypes. Based on the simulation results, we discuss the mechanism of the conformational change affected by these mutations. MATERIALS AND METHODS Molecular Dynamics Simulations We performed flow MD simulations of isolated GPIba b-switch (residues ) of seven sequences (Table ) in loop conformations:, QV, GV, DV, KV, AV, and M9V. All simulation systems were prepared with VMD. The loop conformation structure of was taken from the standalone GPIba structure (Fig. a, PDB id: QYY) ; the mutant peptides were modeled by mutating the corresponding residues of. After patched with the neutral termini, acetylated N-terminus (ACE) and N-methylamide C-terminus (CT), each peptide was soaked into a 9 9 A water box with a certain number of chloride ions to neutralize the system (Table ). Five independent simulations for each mutant were carried out with NAMD package and CHARMM force fields.,, During (a) (b) FIGURE. Structure of GPIba b-switch. (a) Structure of unliganded GPIbaN domain with b-switch (highlighted in licorice representation) in a loop conformation (solid licorice, PDB id: QYY ) and in a b-hairpin conformation (translucent licorice, PDB id: SQ ). (b) The H-bond pattern of the b-hairpin. H-bonds indicated by solid lines between N atom and O atom are numbered from to according to their positions. Residues highlighted by circles are the mutation sites studied with flow MD in this study. TABLE. Phenotypes and sequences of peptides examined with flow MD. Name Phenotype Sequence Added ions Wild type VYVWKQGVDVKAMTSNV Cl QV LOF 9,9 VYVWKVGVDVKAMTSNV Cl GV GOF,9, VYVWKQVVDVKAMTSNV Cl DV GOF 9 VYVWKQGVVVKAMTSNV Cl KV GOF 9,9 VYVWKQGVDVVAMTSNV None AV LOF 9 VYVWKQGVDVKVMTSNV Cl M9V GOF 9,, VYVWKQGVDVKAVTSNV Cl
3 Flow MD Simulation of Glycoprotein Iba Mutants 9 all simulations, the a carbon (C a ) atoms of residues,,, and, as well as the CAY atom of ACE and the CAT atom of CT, were fixed so that the b-switch was anchored as if the other portion of GPIbaN domain was present. Each system was first subjected to -step minimization and then -ns equilibration. During the equilibration, the temperature of the system was maintained at K via Langevin thermostat with a damping coefficient c =ps. In addition, pressure control targeting. kpa was applied with Langevin piston method. After the equilibration, flow MD simulation was performed in an NVT ensemble for ns. Water flow was generated along x-axis, the direction in which the b-switch elongated, by applying a.9-pn force to the oxygen atom of every water molecule within the leftmost.-nm-thin layer. To keep the flow stable, all oxygen atoms of water were subjected to damping forces by Langevin dynamics with a damping coefficient c =. ps. A uniform constant flow with a velocity about nm/ns was achieved soon after the starting of the simulation (within ps). We saved trajectories of atoms in the system every fs, and analyzed the data using the same frequency. Data Analysis We characterized the conformational change of the b-switch in flow MD as root mean square deviation (RMSD) of C a atoms, as formation of the b-hairpin H-bonds, and as rotation of residues near the distal end. Differences between groups were verified by the Wilcoxon test or by the Kruskal Wallis test. RMSD was calculated using either the unstructured loop (PDB id: QYY) or the b-hairpin (PDB id: SQ) as the reference, after aligning C a atoms of residues,,, and. of an H-bond is defined as the ratio of time that the H-bond is formed to time that the peptide has been subjected to flow. Formation of an H-bond means that the distance of participated oxygen and nitrogen atoms is less than. A. We measured formation frequency of seven H-bonds (Figs. b, h). Rotation of a residue is reflected by its backbone dihedral angles u and w, two parameters denoted by coordinates of a point on a Ramachandran plot. On a Ramachandran plot (Fig. ), b-strand conformations lie in the upper left quadrant, a-helical in the lower left, and left-handed helical in the upper right. 9 To find out the favorite conformation of a residue during simulation, we counted points within each region on the plot. By doing so, we inspected conformations of residues,, and of GV, DV, and, so as to determine if these mutations increase the stability of the b-hairpin by promoting the turn formation. To compare transition tendencies toward the b-hairpin in simulations of QV and KV, we calculated formation frequency of b conformations as a fraction of time that each residue (,,,,, and ) formed a b conformation (as a point in region enclosed by dotted line in the upper left quadrant, in Fig. ) in ns flow MD. RESULTS Conformational Transition of the Backbone In our flow MD simulation for both and mutants, RMSD between the simulated b-switch and the reference loop conformation (starting point) increased, while RMSD between the simulated b-switch and the reference b-hairpin (destination) decreased (Figs. a g), suggesting the tendency of a loop-to-b-hairpin conformational change. The time course of RMSD can be divided into two stages. The first stage is short, within ns of the beginning of the flow MD, which perhaps reflects the stretching of the peptide by flow. In this stage, RMSD with respect to the reference b-hairpin drops to a moderate value, while RMSD with respect to the reference loop increase steeply. The second stage starts after the first stage and lasts until the end of simulation, which may correspond to fine-tuning of the conformation. In this stage, the time course of RMSD behaves as a plateau. To verify whether the RMSD remains the same after the first stage, we ran one of the simulations for another ns to a total of ns. The ns simulation confirms that RMSD, especially the one with respect to the b-hairpin, remains unchanged until the end of the simulation (Fig. S). According to the hypothesis that the conformation of peptide depends on an entropy enthalpy balance induced by flow, the second stage may be driven or disturbed by entropy, thus the transition is slow. RMSD between the simulated b-switch and the b-hairpin is suitable (Fig. i) for evaluating the b-hairpin propensity of a peptide in flow, because it decreased more significantly in GOF than in LOF. In some simulations of LOF, for example in those of QV (Fig. b), the RMSD even slightly increased in the second stage. Shown by the Kruskal Wallis test for the null hypothesis that, GOF, and LOF come from the same population (Fig. i), averaged RMSD of the entire flow MD discriminates (p =.) between these three groups. In contrast, RMSD with respect to the loop conformation seems to be sensitive to thermal fluctuation (Fig. h). It reaches large values in all simulations, but the differences among the three groups are not significant (p =.).
4 HUANG et al. (d) DV M9V AV (i) (h) GV (f) KV (g) (e) (c) QV p=. 9 LOF GOF Cα RMSD to hairpin (Å) (b) Cα RMSD to loop (Å) (a) 9 p=. LOF GOF FIGURE. Ca atoms RMSD in flow MD. (a g) RMSD plotted against time for the indicated mutants. RMSD with respect to loop conformation (gray line) are calculated using the standalone GPIba structure (PDB id: QYY) as the reference, and RMSD with respect to b-hairpin conformation (black line) are calculated using the GPIba in complex with VWF-A (PDB id: SQ). The plotted RMSD is an average of five independent runs for each mutant. (h, i) Box plots of RMSD averaged of the entire flow MD runs. Sample of LOF contains observations from QV and AV, sample of observations, and sample of GOF observations from GV, DV, KV, and M9V. On each box, the central line is the median of the group, the lower and upper edges are the th and th percentiles, and the whiskers extend to the minimum and maximum. Above the boxes is the p-value of the Kruskal Wallis test for the null hypothesis that samples of three groups come from the same population. Among all GOF mutants, KV displayed the smallest RMSD with respect to the b-hairpin (Fig. ), implying its least flow requirement for conformational transition.9 Other GOF mutants displayed RMSDs between and KV, in which DV was the largest, very close to. Although the difference is not significant (p =. of the Kruskal Wallis test), such divergence is the same as observed9 in experiments of ristocetin-induced VWF binding, where KV mutant seemed to bind more VWF than other GOF mutants.9 Formation of Backbone H-Bonds In most of our flow MD simulations, formation frequency of backbone H-bonds monotonically increased with time (Fig. ), no matter what phenotype the peptide corresponds. Similar to what have been reported,, formation frequency of distal H-bonds (near residues and ) were smaller than the proximal ones (near residues and ), indicating H-bonds were formed sequentially from the proximal end to the distal end for all cases. Sequential formation of H-bonds indicates also the stepwise conformational change, as observed in the RMSD measurement. We compare the formation frequencies of H-bonds among all systems simulated (Fig. ). Under the same conditions, GOF mutants formed more H-bonds and formed them earlier (Figs. c e, g) than did (Fig. a). As a result, formation frequencies of H-bonds in GOF at the end of simulation were generally larger than that in. LOF mutants were opposite to GOF (Figs. b, f), which formed less H-bonds and formed them at later time under the same conditions. These results extend our previous finding, on M9V and AV to most mutants that have been studied experimentally, suggesting that the phenotype changes in these mutations may come from the same mechanism, that is, their modified behavior in the loop-to-b-hairpin conformational change induced by flow. To verify the enhancement of H-bond formation, we perform the Wilcoxon test (Table ). In KV simulations, the averaged formation frequencies of H-bonds HN:O, HN:O, and
5 Flow MD Simulation of Glycoprotein Iba Mutants 99 HN:O (H-bonds,, and in Fig. h and Table ) were larger than that of the other mutations. Similarly, M9V enhanced H-bonds 9HN:O and HN:9O (H-bonds and in Fig. h and Table ). C α RMSD to hairpin (Å) p=. DV GV M9V KV FIGURE. C a atoms RMSD averaged over the entire flow MD snapshots of and four GOF mutants. On each box, the central line is the median of the mutant, the lower and upper edges are the th and th percentiles, and the whiskers extend to the minimum and maximum. Above the boxes is the p-value of the Kruskal Wallis test for the null hypothesis that samples of the four GOF mutants come from the same population. H-bonds near the distal end were relatively hard to form in most simulations. The formation frequency of H-bond HN:O (H-bond in Fig. h) was almost zero in, while it was slightly larger in LOF mutants QV and AV, suggesting that this H-bond might not play an important role in determining the phenotype, in agree with the observation that this H-bond is absent in a few solved crystal structures (PDB id: SQ, M and UN),, where the b-hairpin is bound to VWF-A. In some crystal structures (PDB id: SQ and M),, residue forms an H-bond with residue instead of,,, through the carbonyl oxygen of residue and the amide of residue (H-bond HN:O). In our simulation, this H-bond (H-bond in Fig. h, inset) was formed more frequently in GOF than in or LOF. During the flow MD, its formation frequency was maintained at a relatively constant value, which did not increase with time (Fig. ), suggesting that flow does not accelerate the formation of this H-bond. It seems that this H-bond is important in maintaining the c-turn of the b-hairpin. If so, this observation supports (a).... (d). DV... (g).... M9V (b) QV.... (e). KV... (h).... 9HN:O HN:9O HN:O (c).. GV.. (f). AV... HN:O Hydrogen bond.. HN:O HN:O QV AV GV DV KV M9V HN:O FIGURE. of interstrand H-bonds of the b-hairpin in flow MD. (a g) plotted against time for the indicated mutants. The frequency is calculated as a running fraction of time during which the H-bond is formed and is averaged over five runs. Numbering of the H-bonds, from to, is indicated near the right margin of the graph, while for the H-bond it is indicated midway for the sake of clarity. Only the formation of proximal H-bonds is obvious. (h) H-bond formation frequency at ns. Each bar represents mean SEM of five independent runs. The donor/acceptor pairs of H-bonds are shown in the bottom. (h, inset) of H-bond at ns in flow MD.
6 TABLE. HUANG et al. The p-values of the Wilcoxon tests for the changes in formation frequency of H-bonds after introducing mutations. H-bond 9HN:O HN:9O HN:O HN:O HN:O HN:O HN:O QV fl. fl. fl. fl. fl. fl.9 fl. AV fl. fl. fl..9 fl. fl. fl. GV.. fl. fl. fl... DV fl.9 fl.9. fl. fl. fl.99.9 KV fl. fl.9 M9V Each arrow denotes that formation frequency of an H-bond in a mutant is larger ( ) or smaller (fl) than the average of the other six peptides (including ). The p-value results from the Wilcoxon test for the comparison between each mutant and the other six peptides. Underlines highlight the p-values supporting the inference that mutations enhance H-bonds nearby. the hypothesis that binding of VWF-A favors GPIba with a preformed b-hairpin. Formation of the Turn in GOF Mutants GV and DV In the complexes of GPIba/VWF-A, where GPIba b-switch assumes the b-hairpin conformations, residues,, and form a classic c-turn (PDB id: M) or an inverse c-turn (PDB id: SQ). Both turn conformations are different from the loop conformation, which was the starting point of these residues in our simulation. Thus, conformational transition of these residues, mainly residues and, was expected in flow MD. Indeed, such transition was observed in simulations of GV and DV, but not. In the simulations of, residues and mainly maintained b conformations (Fig. a) similar to their conformations at the beginning of the simulations. On the other hand, in one simulation of GV (Fig. b) and two simulations of DV (Fig. c), residues and yielded turn conformations similar to those observed in the complexes,, of GPIba/VWF-A: the classic c-turn and the inverse c-turn (Figs. a c, arrows with dashed lines). These two GOF mutations speeded up the conformational transition toward the turn. Influence of GV onto the Backbone Flexibility Backbone flexibility may affect the conformation of a peptide chain. When a glycine residue is mutated into valine, the flexibility decreases. 9, Thus, the glycineto-valine mutation of residue may change the conformational propensity of the b-switch. At the beginning of our flow MD, residue in and GV assumed almost the same left-helix conformation (in, u., w. ; in GV, u 9.9, w. ). In the subsequent simulation, the rotation of Gly in was active but with little hairpin-forming tendency, because of the flexibility of glycine and also the thermal fluctuation. In two simulations of, the conformation of the residue started deviating from left-handed helix after -ns flow MD, changed to a conformation later, and kept the conformation until the end (Fig. d). In the other three simulations, the conformation was fluctuating around left-handed helix all through the course. In contrast to, the valine residue in GV adjusted its torsion angles during the transition so as to fulfill the b conformation, since residue belongs to one of the b-strands in the formed b-hairpin. Though significant conformational change happened as late as.9 ns in flow MD (maybe due to the bulky side chain of Val), b conformations were accomplished at last in two simulations, where Val was packed with Val via hydrophobic interactions. To evaluate further the effect of mutation GV, we compare root mean square fluctuations (RMSF) of C a of residue in all peptides (Fig. a). RMSF in GV is smaller than the other peptides where residue is glycine. The Wilcoxon test (Fig. b; Fig. S) gives a small p-value (p =.9) for the null hypothesis that GV and the other peptides are the same. Effects of Mutations QV and KV In the formed b-hairpin, residues and are adjacent, (Fig. b), but their corresponding mutants to valine show different phenotypes 9,9 : QV is LOF, while KV is GOF. To figure out the difference during flow MD, we detailed the preference for b conformations of residues,,,,, and, since these residues are most possible to be spatially affected by the mutations. Although most residues adopted b conformations in flow MD (Fig. ), residues and largely excluded such conformations. Rotation of residue seems to be a bottleneck of the formation of b-hairpin, for its formation frequency of b conformations was very low in all three peptides. The bottleneck was dominant in simulation of LOF QV, where the formation frequency was 9 (Fig., inset), but it was less
7 (a) Flow MD Simulation of Glycoprotein Iba Mutants (b) SQ SQ ψ M UN ψ M UN - - GV - - φ φ (c) (d) SQ ψ M UN ψ GV - DV - φ - - φ FIGURE. Ramachandran plots for residues,, and at ns in flow MD of, GV, and DV. In each plot, solid lines enclose regions in which amino acid of a protein is allowed to enter, while dotted lines enclose regions in which amino acid with a small side chain is allowed to enter., (a c) Ramachandran plots for residues and in, GV, and DV. Arrow goes from residue to residue. Arrows with solid lines show our simulation data, and arrows with dashed lines show experimental values of three crystal structures of the GPIba/VWF-A complex (PDB id: M, SQ, and UN). One simulation of GV and two of DV (indicated by ticks) resemble the conformations of residues and in crystal structures. (d) Ramachandran plot for residue in and GV. Two points within the dotted polygon in the upper left quadrant indicate residue Val participates in a b-strand in two simulations of GV. (a) (b) C α RMSF (Å) C α RMSF (Å) p=.9 QV AV GV DV KV M9V GV Others FIGURE. C a atoms RMSF of residue in flow MD. (a) RMSF calculated using the entire ns flow MD. Each bar represents mean SEM of five independent runs. (b) Box plot of RMSF displaying the difference of GV and other six peptides. Sample of GV contains observations and sample of other peptides contains observations. On each box, the central line is the median of a group, the lower and upper edges are the th and th percentiles, and the whiskers extend to the minimum and maximum. Below the boxes is the p-value of the Wilcoxon test for the null hypothesis that GV is the same as other peptides. significant in simulation of GOF KV, where the frequency was higher, about.. Rotation of residue might be another but less important bottleneck (Fig. ), which could be due to its role of the counterpart of residue in forming H-bonds. Residues,,, and had high formation frequencies of b conformations, differences in which might not essential in evaluating the b-hairpin propensity. We performed on the frequency of these residues the Kruskal Wallis test for the null hypothesis that three peptides come from the same population (Fig. ), and the p-values show that the difference of residue in three peptides is the only significant one (p =.). DISCUSSION Secondary structure of protein is defined by its H-bond pattern and torsion and curvature of the backbone. Our flow MD simulations of GPIba
8 HUANG et al. Frequency Residue QV KV FIGURE. of b conformations of residue,,,,, and, in flow MD of QV,, and KV. is a fraction of time that each residue formed b conformations in ns flow MD, and is shown as a bar representing mean SEM of five independent runs. Values of residue are very low and shown in the inset as a histogram on a logarithmic scale. Above each cluster of bars is the p-value of the Kruskal Wallis test for the null hypothesis that three samples of the cluster are the same. b-switch show its b-hairpin propensity concerning the H-bond pattern and the torsion angles of its backbone. Though no simulation resulted in a perfect b-hairpin, RMSD between the simulated peptide and the b-hairpin decreased monotonically in and all GOF mutants. As a measurement of b-hairpin propensity of various peptides, RMSD correlates with the phenotype observed in experiments,,9,9, suggesting the relative benefits of mutations to their interactions with VWF- A. Besides the reported discrimination, between LOF,, and GOF, we notice a correlation between RMSD and VWF binding characteristics of the four GOF mutants (DV, GV, M9V, and KV in Fig. ). Dong et al. identified 9 these four as GOF mutants based on their VWF binding characteristics, and found KV seemed to bind even more VWF than the others in ristocetin of low concentrations. Considering the heightened response to ristocetin in Dong et al. s experiments, together with the acceleration of conformational transition in our simulations, we may conclude that GOF mutations enhance the VWF binding by lowering the energy barrier of the transition toward b-hairpin in GPIba b-switch. In GOF mutants, the introduced valine should compel the conformational transition by hydrophobic packing, because interactions of C b -branched residues (such as valine) stabilize b-hairpin., The effect of hydrophobic packing is entropy-driven, and it operates when two hydrophobic side chains are able to get close. From the observations of KV and M9V (Fig. h; Table ), we infer that, via hydrophobic packing, a mutation enhances only the assumed H-bonds nearby. Reduction of peptide s flexibility in some proper site may help b-hairpin maintain the straight shape. For example, flexibility of residue has a negative impact on the b-hairpin, and mutation of glycine into other residues may accelerate the formation of b-hairpin. This possibility relates our simulations of GV to a previous clinical observation on another GOF mutant GS, where the serine residue is not hydrophobic. However, the role of residue in the conformational transition is opposite to residue, mutation of which to glycine (VG) is GOF, improving the flexibility but decreasing the flow requirement., This opposition shows the location of the mutation site is crucial: residue locates on one of the strands of the b-hairpin, but residue is on the turn. The conformational transition takes a series of steps,, thus not only formation of H-bonds but also rotation of the backbone is important. Zou et al. reported that a partial formed b-hairpin containing only two to four H-bonds is common in simulation of for a long time in -m/s flow and in -m/s flow. In our simulations, some differences between and GOF can only be recognized by rotation of the backbone, specifically the transition of the distal end of the peptide (Fig. ). Formation of H-bond seems to be a too stringent criterion to judge the conformational change, because it concerns the conformation of both strands and measures the behavior of a group of residues. When the relevant residues are on the turn, or when they change their conformation asynchronously, a peptide chain with a larger tendency toward b-hairpin may not be found by this criterion. For example, GOF GV and DV did not surpass in the formation of some H-bonds (for example, H-bond in Fig. h and Table ), although they should benefit from hydrophobic packing because respective counterparts of residues and in the formed b-hairpin are native valine residues (residues and ). The criterion of backbone rotation, which measures individual residues, is suitable in the situation, because in this study it detects some kind of sequences of turn-promoting, which increase the folding rate of a b-hairpin. The GOF phenotype of KV has been explained by the introduced valine residue stabilizing the b-hairpin, while the LOF phenotype of QV has
9 Flow MD Simulation of Glycoprotein Iba Mutants been explained in part by steric hindrance. The reason of the latter seems unclear. We observed in one of the simulations of QV that hydrophobic interaction of Val and Trp made the peptide stuck, blocking the rotation of Gly. The blockade appeared after two proximal H-bonds (9HN:O and HN:9O) were formed, and delayed the stepwise conformational change, thus formation frequencies of the next four H-bonds dramatically decreased (H-bonds,,, and in Fig. h). This hindrance accounts for the decreased association rate 9 of QV, while the increased dissociation rate observed in experiment should also account for its phenotype. In conclusion, the conformation of GPIba b-switch is regulated by flow, and mutation in this region changes its phenotype by introducing hydrophobic packing and tuning the peptide s flexibility. Mutation exerts the mechanisms locally, affecting formation of H-bonds and rotation of residues nearby. Such knowledge may help us in prediction and design of sequences of flow sensors. ELECTRONIC SUPPLEMENTARY MATERIAL The online version of this article (doi:./ s9---) contains supplementary material, which is available to authorized users. ACKNOWLEDGMENTS The computational resources for the MD simulations were provided by the Interactive High Performance Computing Laboratory of the College of Computing, Georgia Institute of Technology and by the NSF Teragrid LRAC grant (MCAX). This work was supported by NIH grant HL9 (to C.Z.), NSFC grant (to J.W.) and AHA Scientist Development Grant N (to J.L.). REFERENCES Ambroggio, X. I., and B. Kuhlman. Design of protein conformational switches. Curr. Opin. Struct. Biol. ():,. Arya, M., A. B. Kolomeisky, G. M. Romo, M. A. Cruz, J. A. Lopez, and B. Anvari. Dynamic force spectroscopy of glycoprotein Ib IX and von Willebrand factor. Biophys. J. ():9,. Awasthi, S. K., S. C. Shankaramma, S. Raghothama, and P. Balaram. Solvent-induced beta-hairpin to helix conformational transition in a designed peptide. Biopolymers ():,. Blanco, F., M. Ramirez-Alvarado, and L. Serrano. Formation and stability of beta-hairpin structures in polypeptides. Curr. Opin. Struct. Biol. ():, 99. Buck, M., S. Bouguet-Bonnet, R. W. Pastor, and A. D. MacKerell. Importance of the CMAP correction to the CHARMM protein force field: dynamics of hen lysozyme. Biophys. J. 9():L L,. Chen, Z. Z., J. H. Lou, C. Zhu, and K. Schulten. Flowinduced structural transition in the beta-switch region of glycoprotein Ib. Biophys. J. 9():,. Doggett, T. A., G. Girdhar, A. Lawshe, J. L. Miller, I. J. Laurenzi, S. L. Diamond, and T. G. Diacovo. Alterations in the intrinsic properties of the GPIb alpha-vwf tether bond define the kinetics of the platelet-type von Willebrand disease mutation, GlyVal. Blood ():,. Doggett, T. A., G. Girdhar, A. Lawshe, D. W. Schmidtke, I. J. Laurenzi, S. L. Diamond, and T. G. Diacovo. Selectinlike kinetics and biomechanics promote rapid platelet adhesion in flow: the GPIb alpha-vwf tether bond. Biophys. J. ():9,. 9 Dong, J. F., A. J. Schade, G. M. Romo, R. K. Andrews, S. Gao, L. V. McIntire, and J. A. Lopez. Novel gain-offunction mutations of platelet glycoprotein Ib alpha by valine mutagenesis in the Cys(9) Cys() disulfide loop. J. Biol. Chem. ():,. Du, X. P. Signaling and regulation of the platelet glycoprotein Ib IX V complex. Curr. Opin. Hematol. (): 9,. Du, D. G., Y. J. Zhu, C. Y. Huang, and F. Gai. Understanding the key factors that control the rate of beta-hairpin folding. Proc. Natl Acad. Sci. USA ():9 9,. Dumas, J. J., R. Kumar, T. McDonagh, F. Sullivan, M. L. Stahl, W. S. Somers, and L. Mosyak. Crystal structure of the wild-type von Willebrand factor A-glycoprotein Ib alpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations. J. Biol. Chem. 9():,. Fukuda, K., T. Doggett, I. J. Laurenzi, R. C. Liddington, and T. G. Diacovo. The snake venom protein botrocetin acts as a biological brace to promote dysfunctional platelet aggregation. Nat. Struct. Mol. Biol. (): 9,. Furie, B., and B. C. Furie. Mechanisms of disease: mechanisms of thrombus formation. N. Engl. J. Med. 9(9):9 99,. Griffiths-Jones, S. R., A. J. Maynard, and M. S. Searle. Dissecting the stability of a beta-hairpin peptide that folds in water: NMR and molecular dynamics analysis of the beta-turn and beta-strand contributions to folding. J. Mol. Biol. 9(): 9, 999. Huizinga, E. G., S. Tsuji, R. A. P. Romijn, M. E. Schiphorst, P. G. de Groot, J. J. Sixma, and P. Gros. Structures of glycoprotein Ib alpha and its complex with von Willebrand factor A domain. Science 9(): 9,. Humphrey, W., A. Dalke, and K. Schulten. VMD: visual molecular dynamics. J. Mol. Graph. ():, 99. Kabsch, W., and C. Sander. Dictionary of protein secondary structure: pattern recognition of hydrogen-bonded and geometrical features. Biopolymers ():, 9. 9 Kumar, R. A., J. F. Dong, J. A. Thaggard, M. A. Cruz, J. A. Lopez, and L. V. McIntire. Kinetics of GPIbalphavWF-A tether bond under flow: effect of GPIbalpha
10 HUANG et al. mutations on the association and dissociation rates. Biophys. J. ():99 9,. Lou, J. Z., and C. Zhu. Flow induces loop-to-beta-hairpin transition on the beta-switch of platelet glycoprotein Ib alpha. Proc. Natl Acad. Sci. USA ():,. Lovell, S. C., I. W. Davis, W. B. Arendall, III, P. I. de Bakker, J. M. Word, M. G. Prisant, J. S. Richardson, and D. C. Richardson. Structure validation by Calpha geometry: phi, psi and Cbeta deviation. Proteins ():,. MacKerell, A. Jr., D. Bashford, M. Bellott, R. Dunbrack, Jr., J. Evanseck, M. Field, S. Fischer, J. Gao, H. Guo, and S. Ha. Self-consistent parameterization of biomolecules for molecular modeling and condensed phase simulations. FASEB J. ():A, 99. MacKerell, A. D., D. Bashford, M. Bellott, R. L. Dunbrack, J. D. Evanseck, M. J. Field, S. Fischer, J. Gao, H. Guo, S. Ha, D. Joseph-McCarthy, L. Kuchnir, K. Kuczera, F. T. K. Lau, C. Mattos, S. Michnick, T. Ngo, D. T. Nguyen, B. Prodhom, W. E. Reiher, B. Roux, M. Schlenkrich, J. C. Smith, R. Stote, J. Straub, M. Watanabe, J. Wiorkiewicz-Kuczera, D. Yin, and M. Karplus. All-atom empirical potential for molecular modeling and dynamics studies of proteins. J. Phys. Chem. B ():, 99. Matsubara, Y., M. Murata, K. Sugita, and Y. Ikeda. Identification of a novel point mutation in platelet glycoprotein Ib alpha Gly to Ser at residue, in a Japanese family with platelet-type von Willebrand disease. J. Thromb. Haemost. ():9,. Miller, J. L., and A. Castella. Platelet-type von Willebrand s disease: characterization of a new bleeding disorder. Blood ():9 9, 9. Moriki, T., M. Murata, T. Kitaguchi, H. Anbo, M. Handa, K. Watanabe, H. Takahashi, and Y. Ikeda. Expression and functional characterization of an abnormal platelet membrane glycoprotein Ib alpha (Met(9) fi Val) reported in patients with platelet-type von Willebrand disease. Blood 9():9, 99. Phillips, J. C., R. Braun, W. Wang, J. Gumbart, E. Tajkhorshid, E. Villa, C. Chipot, R. D. Skeel, L. Kale, and K. Schulten. Scalable molecular dynamics with NAMD. J. Comput. Chem. ():,. Ramachandran, G. N., and V. Sasisekharan. Conformation of polypeptides and proteins. Adv. Protein Chem. :, 9. 9 Richardson, J. S. The anatomy and taxonomy of protein structure. Adv. Protein Chem. : 9, 9. Ruggeri, Z. M., F. I. Pareti, P. M. Mannucci, N. Ciavarella, and T. S. Zimmerman. Heightened interaction between platelets and factor VIII/von Willebrand factor in a new subtype of von Willebrand s disease. N. Engl. J. Med. (9):, 9. Russell, S. D., and G. J. Roth. Pseudo-von Willebrand disease: a mutation in the platelet glycoprotein Ib alpha gene associated with a hyperactive surface receptor. Blood (): 9, 99. Smith, D. K., P. Radivojac, Z. Obradovic, A. K. Dunker, and G. Zhu. Improved amino acid flexibility parameters. Protein Sci. ():,. Tait, A. S., S. L. Cranmer, S. P. Jackson, I. W. Dawes, and B. H. Chong. Phenotype changes resulting in high-affinity binding of von Willebrand factor to recombinant glycoprotein Ib IX: analysis of the platelet-type von Willebrand disease mutations. Blood 9():,. Varughese, K. I., Z. M. Ruggeri, and R. Celikel. Platinuminduced space-group transformation in crystals of the platelet glycoprotein Ib alpha N-terminal domain. Acta Crystallogr. D Biol. Crystallogr. :,. Yago, T., J. Lou, T. Wu, J. Yang, J. J. Miner, L. Coburn, J. A. Lopez, M. A. Cruz, J. F. Dong, L. V. McIntire, R. P. McEver, and C. Zhu. Platelet glycoprotein lb alpha forms catch bonds with human vwf but not with type B von Willebrand disease vwf. J. Clin. Invest. (9):9,. Zou, X. Q., Y. X. Liu, Z. Z. Chen, G. I. Cardenas-Jiron, and K. Schulten. Flow-induced beta-hairpin folding of the glycoprotein Ib alpha beta-switch. Biophys. J. 99(): 9,.
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET National Swedish parental studies using the same methodology have been performed in 1980, 2000, 2006 and 2011 (current study). In 1980 and 2000 the studies
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
The Arctic boundary layer
The Arctic boundary layer Interactions with the surface, and clouds, as learned from observations (and some modeling) Michael Tjernström Department of Meteorology & the Bert Bolin Center for Climate Research,
This exam consists of four problems. The maximum sum of points is 20. The marks 3, 4 and 5 require a minimum
Examiner Linus Carlsson 016-01-07 3 hours In English Exam (TEN) Probability theory and statistical inference MAA137 Aids: Collection of Formulas, Concepts and Tables Pocket calculator This exam consists
MOLECULAR SHAPES MOLECULAR SHAPES
Molecules with 2 electron pair groups around Linear molecules have polar bonds, but are the central atom form a linear shape. usually non-polar. is 180 linear 2 electron pairs around the central atom 1
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
SUPPLEMENTARY FIGURE LEGENDS
SUPPLEMETARY FIGURE LEGEDS Supplementary Fig. 1. Flow cytometric analysis of wildtype, mutant and chimeric protein surface expression. Cells transduced with the individual constructs indicated were stained
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik
LUNDS TEKNISKA HÖGSKOLA Institutionen för Elektro- och Informationsteknik SIGNALBEHANDLING I MULTIMEDIA, EITA50, LP4, 209 Inlämningsuppgift av 2, Assignment out of 2 Inlämningstid: Lämnas in senast kl
Aborter i Sverige 2008 januari juni
HÄLSA OCH SJUKDOMAR 2008:9 Aborter i Sverige 2008 januari juni Preliminär sammanställning SVERIGES OFFICIELLA STATISTIK Statistik Hälsa och Sjukdomar Aborter i Sverige 2008 januari juni Preliminär sammanställning
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation
A study of the performance
A study of the performance and utilization of the Swedish railway network Anders Lindfeldt Royal Institute of Technology 2011-02-03 Introduction The load on the railway network increases steadily, and
A QUEST FOR MISSING PULSARS
LOFAR A QUEST FOR MISSING PULSARS Samayra Straal Joeri v. Leeuwen WHAT ARE MISSING ~ half of PWN are associated with a pulsar (32/56) PULSARS? less than 25% of all SNRs are associated with a pulsar (60/294)
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
Support Manual HoistLocatel Electronic Locks
Support Manual HoistLocatel Electronic Locks 1. S70, Create a Terminating Card for Cards Terminating Card 2. Select the card you want to block, look among Card No. Then click on the single arrow pointing
Fysisk aktivitet och hjärnan
1 Fysisk aktivitet och hjärnan Professor Ingibjörg H. Jónsdóttir Hälsan och stressmedicin, VGR Institutionen för kost och idrottsvetenskap Göteborgs Universitet Kvinnlig simultankapacitet troligen en myt
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Solutions to exam in SF1811 Optimization, June 3, 2014
Solutions to exam in SF1811 Optimization, June 3, 14 1.(a) The considered problem may be modelled as a minimum-cost network flow problem with six nodes F1, F, K1, K, K3, K4, here called 1,,3,4,5,6, and
12.6 Heat equation, Wave equation
12.6 Heat equation, 12.2-3 Wave equation Eugenia Malinnikova, NTNU September 26, 2017 1 Heat equation in higher dimensions The heat equation in higher dimensions (two or three) is u t ( = c 2 2 ) u x 2
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
Könsfördelningen inom kataraktkirurgin. Mats Lundström
Könsfördelningen inom kataraktkirurgin Mats Lundström Innehåll Fördelning av antal operationer utveckling Skillnader i väntetid Effekt av NIKE Skillnader i synskärpa före operation Skillnader i Catquest-9SF
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols.
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols. ExcelLoad simulates the maximum forces that may appear during a transport no matter if the
Supplementary Data. Figure S1: EIMS spectrum for (E)-1-(3-(3,7-dimethylocta-2,6-dienyl)-2,4,6-trihydroxyphenyl)butan-1-one (3d) 6'' 7'' 3' 2' 1' 6
Supplementary Data H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S1: EIMS spectrum for (E)-1-(-(,7-dimethylocta-,-dienyl)-,,-trihydroxyphenyl)butan-1-one (d) H 9'' ' 1' 1 ' ' '' 7'' 8'' 10'' H H Figure S:
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Introduktion till vetenskaplig metodik. Johan Åberg
Introduktion till vetenskaplig metodik Johan Åberg Innehåll Forskarvärlden Viktiga begrepp Referenshantering Den vetenskapliga rapporten Vetenskaplig diskussion Forskarvärlden Forskare mäts i antal publikationer
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and
Uttagning för D21E och H21E
Uttagning för D21E och H21E Anmälan till seniorelitklasserna vid O-Ringen i Kolmården 2019 är öppen fram till och med fredag 19 juli klockan 12.00. 80 deltagare per klass tas ut. En rangordningslista med
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance?
r Is it possible to protect prosthetic reconstructions in patients with a prefabricated intraoral appliance? - A pilot study Susan Sarwari and Mohammed Fazil Supervisors: Camilla Ahlgren Department of
6 th Grade English October 6-10, 2014
6 th Grade English October 6-10, 2014 Understand the content and structure of a short story. Imagine an important event or challenge in the future. Plan, draft, revise and edit a short story. Writing Focus
Windlass Control Panel v1.0.1
SIDE-POWER Windlass Systems 86-08950 Windlass Control Panel v1.0.1 EN Installation manual Behåll denna manual ombord! S Installations manual SLEIPNER AB Kilegatan 1 452 33 Strömstad Sverige Tel: +46 525
Profilinformation Flygteknink 2019, Ingo Staack
Profilinformation 2019 Flygteknik Roland Gårdhagen Ingo Staack Aeronautical Engineering Masterprofil Flygteknik Profilinformation Flygteknink 2019, Ingo Staack 1 2019-03-14 3 Från koncept till prototyp
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Gradientbaserad Optimering,
Gradientbaserad Optimering, Produktfamiljer och Trinitas Hur att sätta upp ett optimeringsproblem? Vad är lämpliga designvariabler x? Tjockleksvariabler (sizing) Tvärsnittsarean hos stänger Längdmått hos
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
STORSEMINARIET 3. Amplitud. frekvens. frekvens uppgift 9.4 (cylindriskt rör)
STORSEMINARIET 1 uppgift SS1.1 A 320 g block oscillates with an amplitude of 15 cm at the end of a spring, k =6Nm -1.Attimet = 0, the displacement x = 7.5 cm and the velocity is positive, v > 0. Write
Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM
Rastercell Digital Rastrering Hybridraster, Rastervinkel, Rotation av digitala bilder, AM/FM rastrering Sasan Gooran (VT 2007) Önskat mått * 2* rastertätheten = inläsningsupplösning originalets mått 2
Lösningar till Tentamen i Reglerteknik AK EL1000/EL1100/EL
Lösningar till Tentamen i Reglerteknik AK EL/EL/EL 9-6- a. Ansätt: G(s) = b s+a, b >, a >. Utsignalen ges av y(t) = G(iω) sin (ωt + arg G(iω)), ω = G(iω) = b ω + a = arg G(iω) = arg b arg (iω + a) = arctan
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private
EBBA2 European Breeding Bird Atlas
Methodology Sergi Herrando, Verena Keller, Petr Voříšek et al. objectives 1. To document breeding evidence for all bird species at a resolution of 50x50 km 2. To estimate abundance for all bird species
Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!!
Exam Molecular Bioinformatics X (MB) - March, - Page of Skriv svar på varje uppgift på separata blad. Lycka till!! Write the answers to each of the questions on separate sheets of paper. ood luck!! ) Sequence
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
Examples on Analog Transmission
Examples on Analog Transmission Figure 5.25 Types of analog-to-analog modulation Figure 5.26 Amplitude modulation Figure 5.29 Frequency modulation Modulation och demodulation Baudrate = antal symboler
Övning 5 ETS052 Datorkommuniktion Routing och Networking
Övning 5 TS5 Datorkommuniktion - 4 Routing och Networking October 7, 4 Uppgift. Rita hur ett paket som skickas ut i nätet nedan från nod, med flooding, sprider sig genom nätet om hop count = 3. Solution.
Kristina Säfsten. Kristina Säfsten JTH
Att välja metod några riktlinjer Kristina Säfsten TD, Universitetslektor i produktionssystem Avdelningen för industriell organisation och produktion Tekniska högskolan i Jönköping (JTH) Det finns inte
F ξ (x) = f(y, x)dydx = 1. We say that a random variable ξ has a distribution F (x), if. F (x) =
Problems for the Basic Course in Probability (Fall 00) Discrete Probability. Die A has 4 red and white faces, whereas die B has red and 4 white faces. A fair coin is flipped once. If it lands on heads,
Tentamen i Matematik 2: M0030M.
Tentamen i Matematik 2: M0030M. Datum: 203-0-5 Skrivtid: 09:00 4:00 Antal uppgifter: 2 ( 30 poäng ). Examinator: Norbert Euler Tel: 0920-492878 Tillåtna hjälpmedel: Inga Betygsgränser: 4p 9p = 3; 20p 24p
SVENSK STANDARD SS-ISO :2010/Amd 1:2010
SVENSK STANDARD SS-ISO 14839-1:2010/Amd 1:2010 Fastställd/Approved: 2010-11-08 Publicerad/Published: 2010-11-30 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 01.040.17; 17.160 Vibration och stöt
Materialplanering och styrning på grundnivå. 7,5 högskolepoäng
Materialplanering och styrning på grundnivå Provmoment: Ladokkod: Tentamen ges för: Skriftlig tentamen TI6612 Af3-Ma, Al3, Log3,IBE3 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles
HAGOS. Frågeformulär om höft- och/eller ljumskproblem
HAGOS Frågeformulär om höft- och/eller ljumskproblem Knee Surg Sports Traumatol Arthrosc DOI 10.1007/s00167-013-2721-7 H I P Cross-cultural adaptation to Swedish and validation of the Copenhagen Hip and
DVA336 (Parallella system, H15, Västerås, 24053)
DVA336 (Parallella system, H15, Västerås, 24053) Respondents: 28 Answer Count: 9 Answer Frequency: 32,14 % Teaching methods The teaching methods in the course, that is their practical implementation and
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
Schenker Privpak AB Telefon VAT Nr. SE Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr Säte: Borås
Schenker Privpak AB Interface documentation for web service packageservices.asmx 2012-09-01 Version: 1.0.0 Doc. no.: I04304b Sida 2 av 7 Revision history Datum Version Sign. Kommentar 2012-09-01 1.0.0
Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power Networks
DEGREE PROJECT IN ELECTRICAL ENGINEERING, SECOND CYCLE, 30 CREDITS STOCKHOLM, SWEDEN 2017 Semantic and Physical Modeling and Simulation of Multi-Domain Energy Systems: Gas Turbines and Electrical Power
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
En bild säger mer än tusen ord?
Faculteit Letteren en Wijsbegeerte Academiejaar 2009-2010 En bild säger mer än tusen ord? En studie om dialogen mellan illustrationer och text i Tiina Nunnallys engelska översättning av Pippi Långstrump
Om oss DET PERFEKTA KOMPLEMENTET THE PERFECT COMPLETION 04 EN BINZ ÄR PRECIS SÅ BRA SOM DU FÖRVÄNTAR DIG A BINZ IS JUST AS GOOD AS YOU THINK 05
Om oss Vi på Binz är glada att du är intresserad av vårt support-system för begravningsbilar. Sedan mer än 75 år tillverkar vi specialfordon i Lorch för de flesta olika användningsändamål, och detta enligt
EXPERT SURVEY OF THE NEWS MEDIA
EXPERT SURVEY OF THE NEWS MEDIA THE SHORENSTEIN CENTER ON THE PRESS, POLITICS & PUBLIC POLICY JOHN F. KENNEDY SCHOOL OF GOVERNMENT, HARVARD UNIVERSITY, CAMBRIDGE, MA 0238 PIPPA_NORRIS@HARVARD.EDU. FAX:
Kurskod: TAMS11 Provkod: TENB 07 April 2015, 14:00-18:00. English Version
Kurskod: TAMS11 Provkod: TENB 07 April 2015, 14:00-18:00 Examiner: Xiangfeng Yang (Tel: 070 2234765). Please answer in ENGLISH if you can. a. You are allowed to use: a calculator; formel -och tabellsamling
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Beslut om bolaget skall gå i likvidation eller driva verksamheten vidare.
ÅRSSTÄMMA REINHOLD POLSKA AB 7 MARS 2014 STYRELSENS FÖRSLAG TILL BESLUT I 17 Beslut om bolaget skall gå i likvidation eller driva verksamheten vidare. Styrelsen i bolaget har upprättat en kontrollbalansräkning
Consumer attitudes regarding durability and labelling
Consumer attitudes regarding durability and labelling 27 april 2017 Gardemoen Louise Ungerth Konsumentföreningen Stockholm/ The Stockholm Consumer Cooperative Society louise.u@konsumentforeningenstockholm.se
Boiler with heatpump / Värmepumpsberedare
Boiler with heatpump / Värmepumpsberedare QUICK START GUIDE / SNABBSTART GUIDE More information and instruction videos on our homepage www.indol.se Mer information och instruktionsvideos på vår hemsida
Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands
Skill-mix innovation in the Netherlands dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands m.kroezen@erasmusmc.nl The skill-mix innovation of interest BEFORE AFTER How did the Netherlands
Teenage Brain Development
Teenage Brain Development In adults, various parts of the brain work together to evaluate choices, make decisions and act accordingly in each situation. The teenage brain doesn't appear to work like this.
SWESIAQ Swedish Chapter of International Society of Indoor Air Quality and Climate
Swedish Chapter of International Society of Indoor Air Quality and Climate Aneta Wierzbicka Swedish Chapter of International Society of Indoor Air Quality and Climate Independent and non-profit Swedish
The Algerian Law of Association. Hotel Rivoli Casablanca October 22-23, 2009
The Algerian Law of Association Hotel Rivoli Casablanca October 22-23, 2009 Introduction WHY the Associations? NGO s are indispensable to the very survival of societal progress Local, National or International
KOL med primärvårdsperspektiv ERS 2014. Björn Ställberg Gagnef vårdcentral
KOL med primärvårdsperspektiv ERS 2014 Björn Ställberg Gagnef vårdcentral Nationella programrådet Astma och KOL Identifierade insatsområden Nationella programrådet Astma och KOLinsatsområden för KOL Diagnostik,
Technique and expression 3: weave. 3.5 hp. Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2.
Technique and expression 3: weave 3.5 hp Ladokcode: AX1 TE1 The exam is given to: Exchange Textile Design and Textile design 2 ExamCode: February 15 th 9-13 Means of assistance: Calculator, colorpencils,
f(x) =, x 1 by utilizing the guidance given by asymptotes and stationary points. cos(x) sin 3 (x) e sin2 (x) dx,
MÄLARDALEN UNIVERSITY School of Education, Culture and Communication Department of Applied Mathematics Examiner: Lars-Göran Larsson EXAMINATION IN MATHEMATICS MAA151 Single Variable Calculus, TEN2 Date:
Questionnaire on Nurses Feeling for Hospital Odors
J. Japan Association on Odor Environment Vol. -1 No. 0,**0 437 *, ** * * Questionnaire on Nurses Feeling for Hospital Odors Tomoyo ITAKURA*, **, Megumi MITSUDA*, Takuzo INAGAKI*,,/. + +-/ 13.+... + +,,
Kursutvärderare: IT-kansliet/Christina Waller. General opinions: 1. What is your general feeling about the course? Antal svar: 17 Medelvärde: 2.
Kursvärdering - sammanställning Kurs: 2AD510 Objektorienterad programmering, 5p Antal reg: 75 Program: 2AD512 Objektorienterad programmering DV1, 4p Antal svar: 17 Period: Period 2 H04 Svarsfrekvens: 22%
Normalfördelning. Modeller Vi har alla stött på modeller i olika sammanhang. Ex:
Normalfördelning 1 Modeller Vi har alla stött på modeller i olika sammanhang. Ex: Leksaksbilar Modelljärnvägar Dockskåp 2 En leksaksbil är i vissa avseenden en kopia av en riktig bil. Men den skiljer sig
Supplementary information for. MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing
Electronic Supplementary Material (ESI) for Lab on a Chip. This journal is The Royal Society of Chemistry 2019 Supplementary information for MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing Alphonsus
Biblioteket.se. A library project, not a web project. Daniel Andersson. Biblioteket.se. New Communication Channels in Libraries Budapest Nov 19, 2007
A library project, not a web project New Communication Channels in Libraries Budapest Nov 19, 2007 Daniel Andersson, daniel@biblioteket.se 1 Daniel Andersson Project manager and CDO at, Stockholm Public
2 Uppgifter. Uppgifter. Svaren börjar på sidan 35. Uppgift 1. Steg 1. Problem 1 : 2. Problem 1 : 3
1 2 Uppgifter Uppgifter Svaren börjar på sidan 35. Uppgift 1. Steg 1 Problem 1 : 2 Problem 1 : 3 Uppgifter 3 Svarsalternativ. Answer alternative 1. a Svarsalternativ. Answer alternative 1. b Svarsalternativ.
The Municipality of Ystad
The Municipality of Ystad Coastal management in a local perspective TLC The Living Coast - Project seminar 26-28 nov Mona Ohlsson Project manager Climate and Environment The Municipality of Ystad Area:
Designmönster för sociala användningssituationer
Designmönster för sociala användningssituationer Baserat på Interaction design patterns for computers in sociable use, kommande artikel i International Journal of Computer Applications in Technology, matar@ida.liu.se
NYANLÄNDA OCH LÄRANDE
NYANLÄNDA OCH LÄRANDE En forskningsöversikt om nyanlända elever i den svenska skolan VETENSKAPSRÅDETS RAPPORTSERIE 6:2010 NYANLÄNDA OCH LÄRANDE en forskningsöversikt om nyanlända elever i den svenska
Methods to increase work-related activities within the curricula. S Nyberg and Pr U Edlund KTH SoTL 2017
Methods to increase work-related activities within the curricula S Nyberg and Pr U Edlund KTH SoTL 2017 Aim of the project Increase Work-related Learning Inspire theachers Motivate students Understanding
Introduktion till vetenskaplig metodik. Johan Åberg
Introduktion till vetenskaplig metodik Johan Åberg Innehåll Forskarvärlden Viktiga begrepp Referenshantering Den vetenskapliga rapporten Vetenskaplig diskussion Forskarvärlden Forskare mäts i antal publikationer
Tentamen Biokemi 2 KEM090
Tentamen Biokemi 2 KEM090 2011 10 28 Max: 70 poäng Godkänt: 35 poäng Väl godkänt: 52 poäng Inga hjälpmedel tillåtna OBS! Besvara inte mer än en fråga per sida! Markera varje sida med personlig kod, datum
Kurskod: TAMS11 Provkod: TENB 28 August 2014, 08:00-12:00. English Version
Kurskod: TAMS11 Provkod: TENB 28 August 2014, 08:00-12:00 Examinator/Examiner: Xiangfeng Yang (Tel: 070 2234765) a. You are permitted to bring: a calculator; formel -och tabellsamling i matematisk statistik
Hur fattar samhället beslut när forskarna är oeniga?
Hur fattar samhället beslut när forskarna är oeniga? Martin Peterson m.peterson@tue.nl www.martinpeterson.org Oenighet om vad? 1.Hårda vetenskapliga fakta? ( X observerades vid tid t ) 1.Den vetenskapliga
INSTALLATION INSTRUCTIONS
INSTALLATION - REEIVER INSTALLATION INSTRUTIONS RT0 RF WIRELESS ROOM THERMOSTAT AND REEIVER MOUNTING OF WALL MOUTING PLATE - Unscrew the screws under the - Pack contains... Installation - Receiver... Mounting
Measuring child participation in immunization registries: two national surveys, 2001
Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of
S 1 11, S 2 9 and S 1 + 2S 2 32 E S 1 11, S 2 9 and 33 S 1 + 2S 2 41 D S 1 11, S 2 9 and 42 S 1 + 2S 2 51 C 52 S 1 + 2S 2 60 B 61 S 1 + 2S 2 A
MÄLARDALEN UNIVERSITY School of Education, Culture and Communication Department of Applied Mathematics Examiner: Lars-Göran Larsson EXAMINATION IN MATHEMATICS MAA151 Single Variable Calculus, TEN Date:
Health café. Self help groups. Learning café. Focus on support to people with chronic diseases and their families
Health café Resources Meeting places Live library Storytellers Self help groups Heart s house Volunteers Health coaches Learning café Recovery Health café project Focus on support to people with chronic
Alias 1.0 Rollbaserad inloggning
Alias 1.0 Rollbaserad inloggning Alias 1.0 Rollbaserad inloggning Magnus Bergqvist Tekniskt Säljstöd Magnus.Bergqvist@msb.se 072-502 09 56 Alias 1.0 Rollbaserad inloggning Funktionen Förutsättningar Funktionen
Sammanfattning hydraulik
Sammanfattning hydraulik Bernoullis ekvation Rörelsemängdsekvationen Energiekvation applikationer Rörströmning Friktionskoefficient, Moody s diagram Pumpsystem BERNOULLI S EQUATION 2 p V z H const. Quantity
State Examinations Commission
State Examinations Commission Marking schemes published by the State Examinations Commission are not intended to be standalone documents. They are an essential resource for examiners who receive training
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
Kursplan. EN1088 Engelsk språkdidaktik. 7,5 högskolepoäng, Grundnivå 1. English Language Learning and Teaching
Kursplan EN1088 Engelsk språkdidaktik 7,5 högskolepoäng, Grundnivå 1 English Language Learning and Teaching 7.5 Higher Education Credits *), First Cycle Level 1 Mål Efter genomgången kurs ska studenten