Text Mining for Biomedicine
|
|
- Jan-Erik Fransson
- för 6 år sedan
- Visningar:
Transkript
1 Why? Text Mining for Biomedicine Individual gene study large scale analysis He Tan Genomics Biology: increasing number of genomes, sequences, proteins Laboratory for Intelligent Information Systems Institutionen för datavetenskap Difficulty interpreting large scale experimental results, e.g. Y2H, microarrays, etc. 1 2 Why? Text Mining for Biomedicine 3 4 Disciplines Status Information retrieval finding the papers Entity recognition identifying the entities Information extraction formalizing the facts Text mining finding nuggets in the literature Integration combining text and biological data Literature mining for the biologist: from information retrieval to biological discovery Jensen et al., Nature Reviews Genetics,
2 Challenges KDD Cup 2002 TREC Genomics Tracks BioNLP/JNLPBA 2004 LLL 2005 BioCreative I (2004) & II (2006) Biomedical Language Heavy use of domain specific terminology e.g. chemoattractant, fibroblasts, angiogenesis No standard nomenclatures supported by scientific community HUGO Gene Nomenclature? Rapid growth of new names and new senses This disorder maps to chromosome 7q11-21, and this locus was named CLAM. [PMID: ] Most words with low frequency (data sparseness) 7 8 Biomedical Language short forms and abbreviations are often used e.g. vascular endothelial growth factor (VEGF) genes have often synonyms e.g. Thermoactinomyces candidus vs. Thermoactinomyces vulgaris Orthographic variants e.g. TNF α, TNF-alpha and TNF alpha (without hyphen) Biomedical Language A name may refer to a particular gene may include homologues of this gene in other organisms may denote an RNA, DNA, or the protein the gene encodes may be restricted to a specific splice variant Neurofibromatosis 2 [disease] NF2 Neurofibromin 2 [protein] Neurofibromatosis 2 gene [gene] 9 10 Text Mining and Natural language processing (NLP) NLP techniques to analyze, understand and generate natural language used by human, e.g. free text Text mining generally relies on NLP in e.g. IR, NER, IE The framework of NLP Tokenization text tokens Lemmatization word its lemma POS tagging e.g. NP-VP-NP B-I-O tagging define the begin and the end of the name entity Semantics interpretation Pragmatics analysis word syntax
3 Example Lexical Resources GENIA Tagger Collections of lexical items Additional information Part of speech Spelling variants Useful for entity recognition interaction Resources UMLS SPECIALIST Lexion, BioLexicon WordNet UMLS SPECIALIST Lexicon SPECIALIST Text Tools Content English lexicon Many biomedical terms 360,000 lexical items Part of speech Variant information {base=hemoglobin base form spelling_variant=haemoglobin entry=e identifier cat=noun POS variants=uncount no plural variants=reg} plural (hemoglobins) Annotated corpora Annotated Corpora in Biomedicine Analysis Determining features of domain language Development and evaluation gold standard Training data-driven methods Tasks POS, BIO, semantics (entities, relations/events) Useful for ER and IE Corpus LLL (train) HPRD50 PDG/PICorpus BioCreative I PPI BioInfer AIMed GENIA Genetag #sentence /9372(term/event) # entities Resources for Semantic Mining: Corpora and Ontologies, Tutorial, SMBM
4 GENIA corpus GENIA corpus POS annotation Treebank Coreference annotation Term annotation Event annotation Cellular localization Disease-Gene association Pathway corpus Acronyms Text Mining and Ontologies Many resources available AcroMine ARGH: Biomedical Acronym Stanford Biomedical Abbreviation Server AcroMed SaRAD GO UMLS ontologies OBO Knowledge extraction Semantics interpretation text Text Mining and Ontologies The Gene Ontology Controlled vocabulary for the annotation of gene products Databases Semantic Interpretation of data Mathematical Models ontologies Semantic interpretation of models in Systems Biology Knowledge extraction Semantics interpretation text terms, 98.4% with definitions biological_process 2233 cellular_component 8427 molecular_function November 10, 2008 at 2:00 Pacific time five types of relationships: is_a, part_of, regulates, positively_regulates and negatively_regulates
5 GO Annotations NF 2 neurofibromin 2 (merlin( merlin) ) [ Homo sapiens ] GoPubMed Medical Subject Headings (MeSH) UMLS Metathesaurus Controlled vocabulary for indexing articles from the MEDLINE/PubMED database. 24,767 headings in 2008 MeSH arranged in hierarchical structure + 97,000 entry terms, e.g. "Vitamin C" is an entry term to "Ascorbic Acid." Content over 100 source vocabularies 6M names, 1.5M concepts 8M relations common presentation Other subdomains NCBI Clinical taxonomy Repositories SNOMED CT FMA UMLS Genetic Knowledge base GO OMIM MeSH Biomedical literature Model organisms Anatomy Genome annotations UMLS Metathesaurus Neurofibromatosis type 2(NF2) is often not recognisedas a distinct entity from peripheral neurofibromatosis. NF2 is a predominantly intracranial condition whose hallmark is bilateral vestibular schwannomas. NF2 results from a mutationin the genenamed merlin, located on chromosome 22. UMLS Semantic NetWork Content 135 high-level categories 7000 relations among them UMLS: C MeSH: D NOMEDCT: S OMIM: Clinical Repositories Genetic Knowledge base Other subdomains NCBI taxonomy SNOMED CT FMA UMLS GO OMIM MeSH Biomedical literature Model organisms Anatomy Genome annotations
6 UMLSKS UMLS tools MetaMap entity recognition system exploits both the SPECIALIST lexicon and Metathesaurus SemRep exploits UMLS Semantic Network semantic interpretation information extraction Are they sufficient for Bio-TM? Ontologies GO, SNOMED CT, UMLS, etc OBO ontologies GENIA, BioInfer ontologies, etc inconsistent and imprecise practice in the naming of biomedical concepts (terminology) Incomplete ontologies as a result of rapid knowledge expansion. Information Retrieval To find those documents from a collection of documents which satisfy a given information demand Mitotic cyclin (Clb2)-bound Cdc28 (Cdk1 homolog) directly phosphorylated Swe1 and this modification served as a priming step to promote subsequent Cdc5-dependent Swe1 hyperphosphorylation and degradation Information Retrieval Information Retrieval Ad hoc information retrieval The user enters a query/a set of keywords The system attempts to retrieve the relevant texts
7 Ad hoc IR systems Ad hoc IR systems Query is typically, Boolean model e.g. yeast AND cell cycle By automatically expanding queries with additional search terms, recall can be improved Stemming removes common endings (yeast / yeasts) Stop word removal, such as the and an Case folding (yeast / YEAST) Thesauri can be used to expand queries with synonyms and/or abbreviations (yeast / S. cerevisiae) Ad hoc IR systems Document Similarity The similarity of two documents can be defined based on their word content Each document is represented in a vector of word. Word is weighted according to their frequency within the document and the document collection. The similarity is calculated based on those vectors Document Clustering Document Clustering Unsupervised clustering algorithms All pairwise document similarities are calculated Clusters of similar documents In ad hoc IR systems Rather than matching the query against each document only, the N most similar documents are also considered
8 Document Classification Document Classification Statistical machine learning methods A pre-defined set of document classes Each class is defined by manually assigning a number of documents to it classified documents Information Retrieval ihop (information Hyperlinked over Proteins ) The art is to find the relevant papers even if they do not actually match the query Biological database: Organism: [ Saccharomyces cerevisiae ] GO process: cell cycle Mitotic cyclin (Clb2)-bound Cdc28 (Cdk1 homolog) directly phosphorylated Swe1 and this modification served as a priming step to promote subsequent Cdc5-dependent Swe1 hyperphosphorylation and degradation The next logical step is to use ontologies to make complex inferences (yeast cell cycle / Cdc28) ihop ihop
9 Wikiprofessional WikiProfessional Opinions from leading scientists Fusing literature and biological databases through text mining Interactivity and user interfaces Tool integration Text mining resources Text mining for biology - the way forward: opinions from leading scientists Russ B Altman, et al. Genome Biology 2008, 9(Suppl 2):S7 51 9
PubMed lathund Örebro universitetsbibliotek Medicinska biblioteket.
PubMed lathund 2016-02-04 Örebro universitetsbibliotek Medicinska biblioteket medbibl@oru.se 1 Skriv in dina söktermer och klicka på För att få se vad som har hänt bakom kulissen, titta på Search details.
Sri Lanka Association for Artificial Intelligence
Sri Lanka Association for Artificial Intelligence First Sinhala Chatbot in action Budditha Hettige Department of Statistics and Computer Science, Faculty of Applied Science, University of Sri Jayewardenepura,
PubMed lathund Örebro universitetsbibliotek Medicinska biblioteket.
PubMed lathund 2018-07-19 Örebro universitetsbibliotek Medicinska biblioteket medbibl@oru.se 1 Skriv in dina söktermer och klicka på Du kan välja hur träffarna ska sorteras. T ex efter Best Match eller
Room E3607 Protein bioinformatics Protein Bioinformatics. Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski
Room E3607 Protein bioinformatics 260.841 Protein Bioinformatics Computer lab Tuesday, May 17, 2005 Sean Prigge Jonathan Pevsner Ingo Ruczinski Outline of today s lab Topic Suggested time 1 Find a protein
Introduction to the Semantic Web. Eva Blomqvist
Introduction to the Semantic Web Eva Blomqvist eva.blomqvist@liu.se Outline The original vision Meaning of data Current applications Revisiting the vision and looking ahead Scientific American, May 2001:
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation
Goals for third cycle studies according to the Higher Education Ordinance of Sweden (Sw. "Högskoleförordningen")
Goals for third cycle studies according to the Higher Education Ordinance of Sweden (Sw. "Högskoleförordningen") 1 1. Mål för doktorsexamen 1. Goals for doctoral exam Kunskap och förståelse visa brett
Exam Molecular Bioinformatics X3 (1MB330) - 1 March, Page 1 of 6. Skriv svar på varje uppgift på separata blad. Lycka till!!
Exam Molecular Bioinformatics X (MB) - March, - Page of Skriv svar på varje uppgift på separata blad. Lycka till!! Write the answers to each of the questions on separate sheets of paper. ood luck!! ) Sequence
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
Mapping sequence reads & Calling variants
Universitair Medisch Centrum Utrecht Mapping sequence reads & Calling variants Laurent Francioli 2014-10-28 l.francioli@umcutrecht.nl Next Generation Sequencing Data processing pipeline Mapping to reference
Kursplan. JP1040 Japanska III: Språkfärdighet. 15 högskolepoäng, Grundnivå 1. Japanese III: Language Proficiency
Kursplan JP1040 Japanska III: Språkfärdighet 15 högskolepoäng, Grundnivå 1 Japanese III: Language Proficiency 15 Higher Education Credits *), First Cycle Level 1 Mål Efter avslutad kurs ska de studerande
The present situation on the application of ICT in precision agriculture in Sweden
The present situation on the application of ICT in precision agriculture in Sweden Anna Rydberg & Johanna Olsson JTI Swedish Institute for Agricultural and Environmental Engineering Objective To investigate
RUP är en omfattande process, ett processramverk. RUP bör införas stegvis. RUP måste anpassas. till organisationen till projektet
RUP är en omfattande process, ett processramverk RUP bör införas stegvis RUP måste anpassas till organisationen till projektet Volvo Information Technology 1 Även RUP har sina brister... Dåligt stöd för
Kursplan. FR1050 Franska: Skriftlig språkfärdighet I. 7,5 högskolepoäng, Grundnivå 1. French Written Proficiency I
Kursplan FR1050 Franska: Skriftlig språkfärdighet I 7,5 högskolepoäng, Grundnivå 1 French Written Proficiency I 7.5 Higher Education Credits *), First Cycle Level 1 Mål Kursen syftar till att utveckla
Maskinöversättning 2008
Maskinöversättning 2008 F4 Översättningsstrategier, forts + Återanvändning av översättning LABEL byta SOURCE =byta.vb.1 TARGET =change.vb.1 TRANSFER LABEL byta-filter SOURCE
Läkemedelsverkets Farmakovigilansdag
Swedish Medical Products Agency s Patient- and Consumer Advisory Board Brita Sjöström May 29, 2018 Patientrådet@mpa.se https://lakemedelsverket.se/patient-konsument-rad The vision of the Swedish Medical
District Application for Partnership
ESC Region Texas Regional Collaboratives in Math and Science District Application for Partnership 2013-2014 Applying for (check all that apply) Math Science District Name: District Contacts Name E-mail
Molecular Biology Primer
Molecular Biology Primer Starting 19 th century Cellular biology: Cell as a fundamental building block 1850s+: ``DNA was discovered by Friedrich Miescher and Richard Altmann Mendel s experiments with garden
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
Alias 1.0 Rollbaserad inloggning
Alias 1.0 Rollbaserad inloggning Alias 1.0 Rollbaserad inloggning Magnus Bergqvist Tekniskt Säljstöd Magnus.Bergqvist@msb.se 072-502 09 56 Alias 1.0 Rollbaserad inloggning Funktionen Förutsättningar Funktionen
PORTSECURITY IN SÖLVESBORG
PORTSECURITY IN SÖLVESBORG Kontaktlista i skyddsfrågor / List of contacts in security matters Skyddschef/PFSO Tord Berg Phone: +46 456 422 44. Mobile: +46 705 82 32 11 Fax: +46 456 104 37. E-mail: tord.berg@sbgport.com
Mis/trusting Open Access JUTTA
Mis/trusting Open Access JUTTA HAIDER, @JUTTAHAIDER Open Access och jag - en kärleksrelation JUTTA HAIDER, @JUTTAHAIDER Open Access har blivit vuxen, vuxen nog att tåla konstruktiv kritik. Vetenskap såsom
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
Det här med levels.?
Det här med levels.? Eller: När ska det vara praktik i Modulen? 1 Appendix I Basic knowledge requirements 1. KNOWLEDGE LEVELS CATEGORY A, B1, B2 AND C AIRCRAFT MAINTENANCE LICENCE Basic knowledge for categories
Introduktion till vetenskaplig metodik. Johan Åberg
Introduktion till vetenskaplig metodik Johan Åberg Innehåll Forskarvärlden Viktiga begrepp Referenshantering Den vetenskapliga rapporten Vetenskaplig diskussion Forskarvärlden Forskare mäts i antal publikationer
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands
Skill-mix innovation in the Netherlands dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands m.kroezen@erasmusmc.nl The skill-mix innovation of interest BEFORE AFTER How did the Netherlands
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
en uppsatstävling om innovation Sammanfattning av de vinnande bidragen
en uppsatstävling om innovation Sammanfattning av de vinnande bidragen INNEHÅLLSFÖRTECKNING Förord Jurynsbeslut Jurynsmotiveringar Organiseraförbrukarinvolveringochöppeninnovationi fuzzyfrontend EnfallstudieavGetingeInfectionControlskomplexadesinfektor
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Authentication Context QC Statement. Stefan Santesson, 3xA Security AB stefan@aaa-sec.com
Authentication Context QC Statement Stefan Santesson, 3xA Security AB stefan@aaa-sec.com The use case and problem User identities and user authentication is managed through SAML assertions. Some applications
Oförstörande provning (NDT) i Del M Subpart F/Del 145-organisationer
Oförstörande provning (NDT) i Del M Subpart F/Del 145-organisationer Ref. Del M Subpart F & Del 145 2012-05-02 1 Seminarium för Teknisk Ledning HKP 3maj, 2012, Arlanda Inledning Allmänt Viktigare krav
Schenker Privpak AB Telefon VAT Nr. SE Schenker ABs ansvarsbestämmelser, identiska med Box 905 Faxnr Säte: Borås
Schenker Privpak AB Interface documentation for web service packageservices.asmx 2012-09-01 Version: 1.0.0 Doc. no.: I04304b Sida 2 av 7 Revision history Datum Version Sign. Kommentar 2012-09-01 1.0.0
Kursplan. MT1051 3D CAD Grundläggande. 7,5 högskolepoäng, Grundnivå 1. 3D-CAD Basic Course
Kursplan MT1051 3D CAD Grundläggande 7,5 högskolepoäng, Grundnivå 1 3D-CAD Basic Course 7.5 Higher Education Credits *), First Cycle Level 1 Mål Studenten ska efter avslutad kurs ha inhämtat grunderna
Uttagning för D21E och H21E
Uttagning för D21E och H21E Anmälan till seniorelitklasserna vid O-Ringen i Kolmården 2019 är öppen fram till och med fredag 19 juli klockan 12.00. 80 deltagare per klass tas ut. En rangordningslista med
Kursplan. FÖ1038 Ledarskap och organisationsbeteende. 7,5 högskolepoäng, Grundnivå 1. Leadership and Organisational Behaviour
Kursplan FÖ1038 Ledarskap och organisationsbeteende 7,5 högskolepoäng, Grundnivå 1 Leadership and Organisational Behaviour 7.5 Credits *), First Cycle Level 1 Mål Efter genomförd kurs skall studenterna
A metadata registry for Japanese construction field
A metadata registry for Japanese construction field LCDM Forum, Japan October 25 th -27 th - 2006 TAKEYA, Isobe LCDM Forum Secretariat Document No. GEC-2005-002 LCDM Forum, Japan LCDM Forum, Japan Non-profit
Collaborative Product Development:
Collaborative Product Development: a Purchasing Strategy for Small Industrialized House-building Companies Opponent: Erik Sandberg, LiU Institutionen för ekonomisk och industriell utveckling Vad är egentligen
Kursplan. EN1088 Engelsk språkdidaktik. 7,5 högskolepoäng, Grundnivå 1. English Language Learning and Teaching
Kursplan EN1088 Engelsk språkdidaktik 7,5 högskolepoäng, Grundnivå 1 English Language Learning and Teaching 7.5 Higher Education Credits *), First Cycle Level 1 Mål Efter genomgången kurs ska studenten
Support for Artist Residencies
1. Basic information 1.1. Name of the Artist-in-Residence centre 0/100 1.2. Name of the Residency Programme (if any) 0/100 1.3. Give a short description in English of the activities that the support is
översikt 1. informationsförädling är, typ: 2. Squirrelprototypen 3. möjligheter för framtiden [5] ICALL/2
[5] ICALL/2 Datalingvistikprogrammet Datorstödd språkinlärning och språkteknologi 27/9 2005 översikt 1. informationsförädling är, typ: 2. Squirrelprototypen 3. möjligheter för framtiden 1 informationsförädling
CM FORUM. Introduktion till. Configuration Management (CM) / Konfigurationsledning. Tobias Ljungkvist
Introduktion till Configuration Management (CM) / Konfigurationsledning Tobias Ljungkvist 2017-08-30 1 CM enligt SS-EN ISO 10007_2004 Konfigurationsledning är en ledningsaktivitet som tillämpar teknisk
FÖRBERED UNDERLAG FÖR BEDÖMNING SÅ HÄR
FÖRBERED UNDERLAG FÖR BEDÖMNING SÅ HÄR Kontrollera vilka kurser du vill söka under utbytet. Fyll i Basis for nomination for exchange studies i samråd med din lärare. För att läraren ska kunna göra en korrekt
1. Unpack content of zip-file to temporary folder and double click Setup
Instruktioner Dokumentnummer/Document Number Titel/Title Sida/Page 13626-1 BM800 Data Interface - Installation Instructions 1/8 Utfärdare/Originator Godkänd av/approved by Gäller från/effective date Mats
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private
ENTERPRISE WITHOUT BORDERS Stockholmsmässan, 17 maj 2016
ENTERPRISE WITHOUT BORDERS Stockholmsmässan, 17 maj 2016 JAW Junior Achievement Worldwide JA-YE Junior Achievement Young Enterprise European Commission Creating more enterprising and entrepreneurial
Hållbar utveckling i kurser lå 16-17
Hållbar utveckling i kurser lå 16-17 : Jag tillhör akademin / My position is in the School of Jag tillhör akademin / My position is in the School of Humaniora och medier / Humanities and Media Studies
Introduktion till vetenskaplig metodik. Johan Åberg
Introduktion till vetenskaplig metodik Johan Åberg Innehåll Forskarvärlden Viktiga begrepp Referenshantering Den vetenskapliga rapporten Vetenskaplig diskussion Forskarvärlden Forskare mäts i antal publikationer
Second handbook of research on mathematics teaching and learning (NCTM)
Second handbook of research on mathematics teaching and learning (NCTM) The effects of classroom mathematics teaching on students learning. (Hiebert & Grouws, 2007) Inledande observationer Undervisningens
Design Service Goal. Hantering av demonterbara delar som ingår i Fatigue Critical Baseline Structure List. Presentatör
Design Service Goal Hantering av demonterbara delar som ingår i Fatigue Critical Baseline Structure List Presentatör Thobias Log Flygteknisk Inspektör Sjö- och luftfartsavdelningen Enheten för operatörer,
Scaled Agile Framework
Scaled Agile Framework Grunder för självorganisation Vad är det och är det bra? @svante_lidman svante.lidman@coreboost.se 1 Vem är Svante? Senaste 6-7 åren Konsultat inom Large-Scale Lean/Agile De +20
SVENSK STANDARD SS-EN 13612/AC:2016
SVENSK STANDARD SS-EN 13612/AC:2016 Fastställd/Approved: 2016-04-01 Publicerad/Published: 2016-04-12 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 11.100; 11.100.10 In vitro-diagnostik Utvärdering
Kursplan. NA1032 Makroekonomi, introduktion. 7,5 högskolepoäng, Grundnivå 1. Introductory Macroeconomics
Kursplan NA1032 Makroekonomi, introduktion 7,5 högskolepoäng, Grundnivå 1 Introductory Macroeconomics 7.5 Higher Education Credits *), First Cycle Level 1 Mål Det övergripande målet med kursen är att studenterna
Theory 1. Summer Term 2010
Theory 1 Summer Term 2010 Robert Elsässer 1 Introduction Summer Term 2010 Robert Elsässer Prerequisite of Theory I Programming language, such as C++ Basic knowledge on data structures and algorithms, mathematics
Kursplan. NA3009 Ekonomi och ledarskap. 7,5 högskolepoäng, Avancerad nivå 1. Economics of Leadership
Kursplan NA3009 Ekonomi och ledarskap 7,5 högskolepoäng, Avancerad nivå 1 Economics of Leadership 7.5 Higher Education Credits *), Second Cycle Level 1 Mål Studenterna skall efter genomgången kurs: kunna
SweLL & legal aspects. Elena Volodina
SweLL & legal aspects Elena Volodina WG5 meeting, Bolzano, September, 7, 2017 SweLL Research infrastructure for Swedish as a Second Language Elena Volodina Lena Granstedt, Julia Prentice, Monica Reichenberg,
Kursplan. FÖ3032 Redovisning och styrning av internationellt verksamma företag. 15 högskolepoäng, Avancerad nivå 1
Kursplan FÖ3032 Redovisning och styrning av internationellt verksamma företag 15 högskolepoäng, Avancerad nivå 1 Accounting and Control in Global Enterprises 15 Higher Education Credits *), Second Cycle
OPPOSITION FOR MASTER S PROJECT
Kerstin Frenckner, tel 08 790 9754, e-mail:. kfrenck@csc.kth.se2 February 12, 2009 Copyright CSC, KTH OPPOSITION FOR MASTER S PROJECT The duties of an opponent are to: Critically review the report in question
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
ISO STATUS. Prof. dr Vidosav D. MAJSTOROVIĆ 1/14. Mašinski fakultet u Beogradu - PM. Tuesday, December 09,
ISO 9000 - STATUS Prof. dr Vidosav D. MAJSTOROVIĆ 1/14 1 ISO 9000:2000, Quality management systems - Fundamentals and vocabulary Establishes a starting point for understanding the standards and defines
1. Varje bevissteg ska motiveras formellt (informella bevis ger 0 poang)
Tentamen i Programmeringsteori Institutionen for datorteknik Uppsala universitet 1996{08{14 Larare: Parosh A. A., M. Kindahl Plats: Polacksbacken Skrivtid: 9 15 Hjalpmedel: Inga Anvisningar: 1. Varje bevissteg
Kundfokus Kunden och kundens behov är centrala i alla våra projekt
D-Miljö AB bidrar till en renare miljö genom projekt där vi hjälper våra kunder att undersöka och sanera förorenad mark och förorenat grundvatten. Vi bistår dig som kund från projektets start till dess
medier som data några forskningsperspektiv
medier som data några forskningsperspektiv pelle snickars, kb onsdag 12 oktober 11 90 000 afghanistan war logs Mike Dewar, Visualisation of Activity in Afghanistan using the Wikileaks data Vimeo 16 August
3rd September 2014 Sonali Raut, CA, CISA DGM-Internal Audit, Voltas Ltd.
3rd September 2014 Sonali Raut, CA, CISA DGM-Internal Audit, Voltas Ltd. Role and responsibility of Internal Audit Sharing of best practices Model of operation In conduct of audit assignment Other functions
EBBA2 European Breeding Bird Atlas
Methodology Sergi Herrando, Verena Keller, Petr Voříšek et al. objectives 1. To document breeding evidence for all bird species at a resolution of 50x50 km 2. To estimate abundance for all bird species
Health café. Self help groups. Learning café. Focus on support to people with chronic diseases and their families
Health café Resources Meeting places Live library Storytellers Self help groups Heart s house Volunteers Health coaches Learning café Recovery Health café project Focus on support to people with chronic
Libers språklåda i engelska Grab n go lessons
Libers språklåda i engelska 7-9 - Grab n go lessons PROVLEKTION Libers språklåda i engelska Grab n go lessons (47-90988-9) Författarna och Liber AB Får kopieras 1 Two stories in one Förberedelser Kopiera
Sociala medieströmmar metoder för analys och samarbete via nya medieformat. Pelle Snickars, Umeå universitet & Lars Degerstedt, Södertörns högskola
Sociala medieströmmar metoder för analys och samarbete via nya medieformat Pelle Snickars, Umeå universitet & Lars Degerstedt, Södertörns högskola från text som omvärldsinformation till andra typer
State Examinations Commission
State Examinations Commission Marking schemes published by the State Examinations Commission are not intended to be standalone documents. They are an essential resource for examiners who receive training
Kursplan. IK1004 Java - Grafiska användargränssnitt med Swing. 7,5 högskolepoäng, Grundnivå 1. Java - GUI Programming with Swing - Undergraduate Level
Kursplan IK1004 Java - Grafiska användargränssnitt med Swing 7,5 högskolepoäng, Grundnivå 1 Java - GUI Programming with Swing - Undergraduate Level 7.5 Higher Education Credits *), First Cycle Level 1
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
Kursplan. PR1017 Portugisiska: Muntlig språkfärdighet II. 7,5 högskolepoäng, Grundnivå 1. Portuguese: Oral Proficiency II
Kursplan PR1017 Portugisiska: Muntlig språkfärdighet II 7,5 högskolepoäng, Grundnivå 1 Portuguese: Oral Proficiency II 7.5 Higher Education Credits *), First Cycle Level 1 Mål Efter avslutad kurs ska den
Sara Skärhem Martin Jansson Dalarna Science Park
Sara Skärhem Martin Jansson Dalarna Science Park Sara Skärhem Martin Jansson Vad är innovation? På Wikipedia hittar man: En innovation är en ny idé, till exempel i form av en produkt, lösning, affärsidé,
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
Ontologier. Cassandra Svensson 2014-01-09
Ontologier Cassandra Svensson 2014-01-09 Sammanfattning Jag har läst Annika Flycht-Ericssons avhandling Design and Use of Ontoligies in information-providing Dialogue Systems. Med Annikas text som utgångspunkt
Pre-Test 1: M0030M - Linear Algebra.
Pre-Test : M3M - Linear Algebra. Test your knowledge on Linear Algebra for the course M3M by solving the problems in this test. It should not take you longer than 9 minutes. M3M Problem : Betrakta fyra
Biblioteket.se. A library project, not a web project. Daniel Andersson. Biblioteket.se. New Communication Channels in Libraries Budapest Nov 19, 2007
A library project, not a web project New Communication Channels in Libraries Budapest Nov 19, 2007 Daniel Andersson, daniel@biblioteket.se 1 Daniel Andersson Project manager and CDO at, Stockholm Public
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
Stad + Data = Makt. Kart/GIS-dag SamGIS Skåne 6 december 2017
Smart@Helsingborg Stadsledningsförvaltningen Digitaliseringsavdelningen the World s most engaged citizens Stad + Data = Makt Kart/GIS-dag SamGIS Skåne 6 december 2017 Photo: Andreas Fernbrant Urbanisering
Att analysera företagsdynamik med registerdata (FAD) Martin Andersson
CENTER FOR INNOVATION, RESEARCH AND COMPETENCE IN THE LEARNING ECONOMY Att analysera företagsdynamik med registerdata (FAD) Martin Andersson CIRCLE, Lunds universitet Industriell Ekonomi och Management,
Syns du, finns du? Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap
Examensarbete 15 hp kandidatnivå Medie- och kommunikationsvetenskap Syns du, finns du? - En studie över användningen av SEO, PPC och sociala medier som strategiska kommunikationsverktyg i svenska företag
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
Vässa kraven och förbättra samarbetet med hjälp av Behaviour Driven Development Anna Fallqvist Eriksson
Vässa kraven och förbättra samarbetet med hjälp av Behaviour Driven Development Anna Fallqvist Eriksson Kravhantering På Riktigt, 16 maj 2018 Anna Fallqvist Eriksson Agilista, Go See Talents linkedin.com/in/anfaer/
http://marvel.com/games/play/31/create_your_own_superhero http://www.heromachine.com/
Name: Year 9 w. 4-7 The leading comic book publisher, Marvel Comics, is starting a new comic, which it hopes will become as popular as its classics Spiderman, Superman and The Incredible Hulk. Your job
KOL med primärvårdsperspektiv ERS 2014. Björn Ställberg Gagnef vårdcentral
KOL med primärvårdsperspektiv ERS 2014 Björn Ställberg Gagnef vårdcentral Nationella programrådet Astma och KOL Identifierade insatsområden Nationella programrådet Astma och KOLinsatsområden för KOL Diagnostik,
Bridging the gap - state-of-the-art testing research, Explanea, and why you should care
Bridging the gap - state-of-the-art testing research, Explanea, and why you should care Robert Feldt Blekinge Institute of Technology & Chalmers All animations have been excluded in this pdf version! onsdag
Kvalitetsarbete I Landstinget i Kalmar län. 24 oktober 2007 Eva Arvidsson
Kvalitetsarbete I Landstinget i Kalmar län 24 oktober 2007 Eva Arvidsson Bakgrund Sammanhållen primärvård 2005 Nytt ekonomiskt system Olika tradition och förutsättningar Olika pågående projekt Get the
Accomodations at Anfasteröd Gårdsvik, Ljungskile
Accomodations at Anfasteröd Gårdsvik, Ljungskile Anfasteröd Gårdsvik is a campsite and resort, located right by the sea and at the edge of the forest, south west of Ljungskile. We offer many sorts of accommodations
Bates, M.J. (1989).The design of browsing and berrypicking techniques for the online search interface. Online Review, 13(5), pp
The lookup-based has promoted out understanding of IR in many ways [---]. Under this paradigm, the query is treated as a one-time conception of the searcher s information need. Although the assumptions