Cloning, expression and characterization of a novel type of feruloyl esterase from Fusarium oxysporum in Pichia pastoris
|
|
- Barbro Dahlberg
- för 6 år sedan
- Visningar:
Transkript
1 UPTEC X ISSN AUG 2008 RICKARD LINDER Cloning, expression and characterization of a novel type of feruloyl esterase from Fusarium oxysporum in Pichia pastoris Master s degree project
2 Molecular Biotechnology Programme Uppsala University School of Engineering UPTEC X Date of issue Author Rickard Linder Title (English) Cloning, expression and characterization of a novel type of feruloyl esterase from Fusarium oxysporum in Pichia pastoris Title (Swedish) Abstract Lately, many articles concerning feruloyl esterases (FAEs) have been published, especially after the mapping of certain genomes. There is a growing interest in using these enzymes at a larger (industrial) scale, due to their broad range of potential. One of the areas where FAEs have been proved to be particularly valuable is within the production of bioethanol. An enzyme, possibly being a new feruloyl esterase from the fungus Fusarium oxysporum was successfully cloned and expressed in Pichia pastoris. This new enzyme has been demonstrated to show esterase activity. However to validate weather it really is a feruloyl esterase will require further investigations. Keywords Feruloyl esterase, Fusarium oxysporum, gene cloning, Pichia pastoris, expression Supervisors Scientific reviewer Project name Paul Christakopoulos National Technical University of Athens Dimitris Kekos National Technical University of Athens Sponsors Language ISSN English Security Classification Supplementary bibliographical information Pages 31 Biology Education Centre Biomedical Center Husargatan 3 Uppsala Box 592 S Uppsala Tel +46 (0) Fax +46 (0)
3 Cloning, expression and characterization of a novel type of feruloyl esterase from Fusarium oxysporum in Pichia pastoris Rickard Linder Sammanfattning Feruloylesteras är namnet på ett enzym (dvs ett protein som katalyserar en specifik kemisk reaktion) som genom att bryta en esterbindning har förmågan att frigöra ämnet ferulasyra från de långa sockerartskedjorna som utgör viktiga komponenter i den generella strukturen hos växternas cellväggar. Ferulasyra kan bland annat användas för att framställa vanillin och vaniljsyra, ämnen som ger vaniljsmak. Detta gör enzymet intressant från industriell synvinkel, inte bara på grund av förmågan att frigöra denna värdefulla molekyl, men också på grund av dess viktiga roll vid själva nedbrytningen av växtcellväggarna, den största källan av förnyelsebar energi på jorden. Ett av de områden där feruloylesteraser har visat sig vara speciellt värdefulla är inom produktionen av bioetanol. Svampen Fusarium oxysporum är för detta ändamål ytterst intressant då den inte bara bär på gener som kodar för feruloylesteras utan även gener för att framställa de enzymer som behövs för att utföra en därefter följande fermentering. Detta examensarbete har gått ut på att klona en gen från Fusarium oxysporum som kodar för feruloylesteras och sedan uttrycka den i jästen Pichia pastoris och på så vis kunna studera dess enzymatiska aktivitet. Examensarbete 20 p i programmet Molekylär bioteknik Uppsala universitet Augusti 2008
4 Index INTRODUCTION... 5 REACTION MECHANISM OF FAE... 6 APPLICATIONS OF FAES AND FERULIC ACIDS... 7 CLASSIFICATION OF FAES...10 AIM OF THE THESIS...12 MATERIALS AND METHODS...13 CHEMICALS AND REAGENTS...13 STRAINS, VECTORS AND MEDIA...13 CELL CULTIVATION...13 DNA ISOLATION...14 CLONING OF THE GENE FROM FOXG_ TRANSFORMATION OF P. PASTORIS AND SCREENING OF RECOMBINANT TRANSFORMANTS...17 PRODUCTION OF THE ENZYME...18 ENZYME AND PROTEIN ASSAYS...20 RESULTS AND DISCUSSIONS...21 AMPLIFICATION OF FOXG_ CLONING OF THE GENE FROM FOXG_ INTO PCR -BLUNT VECTOR...22 AMPLIFICATION OF FOXG_ , USING NEW PRIMERS...23 CLONING OF THE GENE FROM FOXG_ INTO PCR -BLUNT VECTOR...24 AMPLIFICATION OF FOXG_ CLONING OF THE GENE FROM FOXG_ INTO PCR -BLUNT VECTOR...27 CLONING OF THE GENE FROM FOXG_ INTO PPICZΑ VECTOR...28 TRANSFORMATION OF P. PASTORIS AND EXPRESSION OF THE ENZYME...28 CONCLUSIONS...29 REFERENCES...30
5 Introduction Feruloyl esterases (EC ), also known as ferulic acid esterases (FAE), cinnamic acid esterases, or cinnamoyl esterases, represent a subclass of the carboxylic ester hydrolases, a group of enzymes that release hydroxycinnamic acids (such as ferulic acid (FA)) and their dimmers, from common polysaccharides found in the cell walls of all plants, such as hemicelluloses and pectins ([1], [2], [6]). Figure 1 illustrates how hydroxycinnamic acids, esterified with arabinoxylans, are linked to the hemicellulose fibers either as sidechains or as crosslinks. The job of the feruloyl esterases is to break these ester bonds. Fig. 1: Structure of arabinoxylan, the main component of the hemicellulose, found in plant cell walls. A: β- (1-4) linkage in xylan backbone, B: Xylose-arabinose linkage, C: 5-O-feruloyl lignin, D: 5-O-diferuloyl group (5-5 linked dimer), E: 5-O-diferuloyl group(8-5 dimer), F: 3-O-acetyl group, G: arabinose-lignin. [3] 5
6 For a complete degradation of this biomass component (lignin-carbohydrate complex), it is necessary, on one hand, enzymes capable of cleaving the main xylan backbone (called xylanases); and, on the other hand, enzymes assisting the xylanases by breaking down the crosslinks and sidechains of the arabinoxylan. Thus, feruloyl esterases play a very important role: to increase the accessibility of degrading enzymes to lignocellulose fibers, which will determine their subsequent hydrolysis. Reaction mechanism of FAE The primary structural analysis of FAEs has shown that these enyzmes possess an Asp/His/Ser catalytic triad at their active site. This means that the FAE-catalyzed reaction is very similar to the hydrolytic action of serine proteases, lipases, and other esterases, a reaction which is taking place by mean of a covalent acylenzyme intermediate, as illustrated in figure 2. Fig. 2: The proposed two-step mechanism of feruloyl esterases, taking place through an initial acylation step followed by a subsequent deacetylation step [6] The action mechanism takes place in two steps: 1) The acylation step: the Ser O is activated by the catalytic His and, through a nucleophilic attack on the carboxyl carbon of the substrate, a tetrahedral intermediate is 6
7 formed. His-catalyzed protonation of the ester oxygen, is releasing the carbohydrate moiety as the product and also, the acylenzyme complex is formed. In the tetrahedral intermediate, the substrate carbonyl oxygen anion is stabilized by the formation of hydrogen bonds with two main chain NH groups in the oxyanion anion hole. 2) The deacylation step: a second tetrahedral intermediate is formed by a nucleophilic attack of a water molecule, by mean of a His-assisted general basis catalysis. The breackdown of the intermediate is caused by the His-catalyzed protonation of the Ser-O; the ferulic acid is released as a product. [6] The active site doesn t have the same substrate recognition requirements for all FAEs; the nature of interaction can be mainly hydrophobic, side-chain or solvent mediated with either the polar substituents of the ferulic acid aromatic ring or the second ferulate moiety. The ferulic acid binding pocket of these enzymes is located in a long and narrow cavity on the molecular surface, created by a number of side chains (of the amino acids from the structure of enzyme) for the recognition of the aromatic ring substitutions and the sugar part of the substrate. The distance between the aromatic ring and the ester bond is a determinant factor for the catalytic activity. [6] Applications of FAEs and ferulic acids FAEs have a very high potential for industrial applications such as the food, pulp and paper and bio-fuel industries. One area in which the FAE enzymatic preparations are widely used is the bakery industry. In this context, together with a number of glycanases and oxidases, FAEs have been implicated in the improvement of bread-making quality. Their main effect is in solubilizing the arabinoxylan fraction of the dough, resulting in increased bread volume and an improved quality of the dough. Other applications: increasing the feed conversion efficiency of animal food, clarifying juices, and producing oligosaccharides that are used as functional food additives or alternative sweeteners [4]. Biomass degradation requires synergistic action between feruloyl esterases and several cellulolytic, xylanolytic and/or pectinolytic enzymes. FAE are involved in lignocellulosic network disorganization as helper enzymes due to their ability to hydrolyse ester bonds between sugar residues and phenolic compounds and therefore facilitate the access of hydrolases to the backbone of cell wall polymers. Untangling the crosslinks among various carbohydrate polymers increases accessibility of the cellulose and hemicellulose fractions to enzymatic hydrolysis. This can potentially increase the yield of hexose and 7
8 pentose sugar in the bioconversion as feedstock for yeast fermentation to biofuel or other value-added chemicals ([4], [6]). The high specificity of biological conversions presents an interesting alternative to chemical bleaching. Hemicellulases and oxidoreductases such as xylanases and laccases are being used in pulp bleaching to decrease chlorine consumption and increase the final brightness of the pulp. Enzymatic degradation of the hemicellulose-lignin complexes present in pulps leaves the cellulose fibers intact and strongly reduces the amount of bleaching chemicals (chlorine) required. This not only results in a reduction in costs of chemicals but also reduces the environmental problems caused by the use of chlorine ([1], [4]). A second non-food application of feruloyl esterases is the production of fuel ethanol from renewable lignocellulosic materials. A. niger FaeA was used in association with xylanases and laccases for conversion of lignocellulosic biomass to fermentable sugars for the production of bioethanol. In the saccharification step, efficacy of the enzymatic treatment was evaluated by measuring sugar yield with the best results obtained with a combination of FaeA and xylanase treatment ([1]). The importance of feruloyl esterase also relates to the enzyme product ferulic acid and ferulated oligosaccharides, which have a potential application for food and medicine uses, so that the ferulic acid derivates are used like strong antioxidants and have gel-forming properties. Ferulic acid can perform several biological functions such as UV absorber, anti-oxidant and anti-inflammatory activity. It is one of the major antioxidant constituents in beer, while its occurrence in orange juice is responsible for the off-flavour formation during storage. FA it has been also shown to possess some activity toward peroxynitrite and oxidized low-density lipoprotein (oxldl) in vitro. FA has been evaluated in synaptosomes and neuronal cultures exposed to peroxyl, and hydroxyl radical insult via several oxidative stress indexes and may be a promising candidate as an antioxidant in neurodegenerative disorders such as Alzheimer s disease. Any reactive radical colliding with FA easily abstracts a hydrogen atom to form a phenoxy radical. This radical is highly resonance stabilized, since the unpaired electron may be present not only on oxygen but it can be delocalized across the entire molecule. In fact, the antioxidant activity of phenolic acids is largely due to their chemical structure and the presence of hydroxy groups on the aromatic ring. The presence of two hydroxy groups on caffeic acid compared to one on ferulic acid can therefore explain its higher antioxidant efficiency. 8
9 Fig. 3. Structures of ferulic acids from plant cell wall [4], [6] FA has also a potential use as feedstock for the biocatalytic conversion into other valuable molecules such as styrenes, polymers, epoxides alkylbenzenes, vanillic acid derivatives, protocatechuic acid-related catechols, guaiacol, catechol and vanillin (the last is one of the most universally used aromatic molecules in the food, pharmaceutical and cosmetic industries). There has recently been considerable growing interest in FAEs and their potential application in obtaining FA from agro-industrial waste materials such as those produced by the milling, brewing and sugar industries (wheat bran, maize bran, maize fiber, brewer s (or barley) spent grain, sugar beet pulp, coastal bermuda grass, oat hulls, jojobameal, wheat straw, coffee pulp and apple marc [2], residue of rice bran oil); FA can be lately transformed by microorganisms to natural vanillic acid and vanillin, the main flavour component of vanilla [1]. 9
10 Classification of FAEs Feruloyl esterases can be isolated from a wide range of microorganisms when they are grown on complex substrates such as xylan, pectin, wheat bran or sugar beet pulp. More than 30 FAEs have been purified and characterized from several microorganisms including fungi and bacteria, showing significant variations in physical characteristics such as molecular weight, isoelectric points and optimum hydrolytic reaction conditions [7]. Feruloyl esterases have been initially classified as either type A or type B, based on their ability to release diferulic acids from esterified substrates and their specificity for different aromatic substrates [8]. Few years back, a more elaborate classification (according to their primary amino acid sequence identity, specificity for the hydrolysis of hydroxycinnamic acid methyl esters, ability to release 5,5 -diferulic acid from model and complex substrates and inducible plant cell wall materials), has been proposed to consist of four subclasses: type A, B, C, and D ([5], [9]). FAEs appear to be a very diverse set of enzymes, with little unifying sequence and physical characteristics to link them. The nomenclature of FAEs follows both the source of the enzyme and the type of the esterases (e.g. the type-a FAE produced by F. oxysporum is termed FoFaeA). It is extremely common for esterases to act on a broad range of substrates. [2] Multiple sequence alignments of known feruloyl esterase amino acid sequences suggest that they can be subdivided by sequence similarities with lipase, acetylxylan esterase, chlorogenate esterase/tannase, and xylanase. These four subclasses, FAE types A, B, C, and D, are also distinguished by their substrate specificity. [6]. An overview of classification criteria of FAEs is shown in table 1. Type A FAEs show preference for the phenolic moiety of the substrate containing methoxy substituents, especially at meta-position(s), as occurs in ferulic and sinapinic acids, while type B FAEs shows complementally activity to type A esterases, showing preference to substrates containing one or two hydroxyl substitutions like in p-coumaric or caffeic acid. Furthermore, type A and D FAEs in contrast to type B and C are also able to release low quantities of difa. Type C and D FAEs exhibit broad specificity against synthetic hydroxycinnamic acids (ferulic, p-coumaric, caffeic and sinapic acid) showing difference only in the ability to release 5-5 difa. Nature has evolved several types of FAEs that differ in affinity for 5-O- and 2-O-feruloylated a- L-arabinofuranosyl residues. Type A esterases are active only on substrates containing FA ester linked to the O-5 and not on substrates containing FA ester linked to the O-2 linkages of L-arabinofuranose. In contrast, type B FAEs are active on substrates containing FA ester linked to both O-5 and O-2 of Larabinofuranose with different preferences depending on the esterase studied. The inability 10
11 of type A FAEs to hydrolyze the O-2 linkage between FA and L-arabinofuranose residues could be a new criterion for the classification in this subclass of esterases. Type C and D FAEs are able to hydrolyse both linkages. [2] Table 1: Overview of classification criteria of FAE FAE type Hydrolysis of methyl esters of hydroxycinnamic acids Release of diferulic Affinity for 5-O and 2-O feruloylated L- arabinofuranose MFA MSA MCA MpCA acid 5-O 2-O A * * * Yes (5,5 ) Yes No B * * * No Yes Yes C * * * * No Yes Yes D * * * * Yes (5,5 ) Yes Yes Type A is active on methyl ferulate (MFA), methyl p-coumarate (MpCA), and methyl sinapate (MSA). These FAEs have sequences related to those of lipases and are able to hydrolyze synthetic ferulate dehydrodimers. Examples of this group of enzymes include Aspergillus niger FAE-A (AnFaeA). Type B FAEs are specific against MFA, MpCA, methyl caffeate (MCA), but not MSA. These enzymes do not release diferulic acid and show sequence similarities to carboxylic esterase family 1-acetyl xylan esterase. Penicillium funiculosum FAE-B and Neurospora crassa FAE-I belong to this group. Type C and D act on all four hydroxycinnamic acid methyl esters. Type C enzymes do not release diferulic acids from model and complex substrates, whereas type D enzymes are able to hydrolyse dimers. Type C and D shows sequence similarities to chlorogenate esterase (tannase) and xylanase, respectively. Type C includes A. niger FAE-B (AnFaeB) and Talaromyces stipitatus FAE-C. Type D enzymes include Piromyces equi EstA and Celluvibrio japonicus EstD. [6] 11
12 Aim of the thesis In the recent years, many articles have been published about subjects such as purification and characterization of different types of FAEs from various microorganisms, especially after the mapping of certain genomes There is a growing interest in using these enzymes at a larger, industrial, scale, due to their broad range of potential, not only in agriculture and food processing, but also in paper and bio-fuel industry. One of the areas where FAEs have been proved to be particularly valuable is within the production of bioethanol. The fungus Fusarium oxysporum is, for this purpose, highly interesting, as it in its genome not only has the genes encoding for FAEs, but also the genes responsible for the subsequent fermentation of the sugars made accessible by the FAEs. In order to clone and express a feruloyl esterase from Fusarium oxysporum in Pichia pastoris, the following steps were planed to be taken: 1) Identification of the hypothetical protein DNA sequence to clone from the recently released genomic DNA of Fusarium oxysporum ( 2) Design of primers for directional cloning of the specific gene into the ppiczα expression plasmid, containing the tightly regulated AOX1 promoter and the Saccharomyces cerevisiae α-factor secretion signal, located immediately upstream of the multiple cloning site. Primers have also been designed for the exclusion of the intron region positioned in the target gene using fusion PCR technique. 3) DNA sequencing of the recombinant ppiczα plasmid. 4) Transformation of P. pastoris using the electroporation method. 5) Identification of recombinant colonies using fluorescent screening assay. 6) Expression experiments in order to choose the best producer of the recombinant feruloyl esterase. 7) Purification and biochemical characterization including SDS/IEF-PAGE and substrate specificity experiments against various model substrates for the classification of this esterase. 12
13 Materials and methods Chemicals and reagents Vent high-fidelity DNA polymerase was purchased from New England Biolabs (Ipswich, Massachusetts, USA). NucleoSpin Extract II and NucleoSpin Plasmid Kits were purchased from Macherey Nagel (Düren, North Rhine-Westphalia, Germany). Zero Blunt PCR Cloning Kit, ppiczα vectors and EasySelect Pichia Expression Kit were purchased from Invitrogen (Carlsbad, California, USA) while restriction enzymes were purchased from Takara (Ōtsu, Shiga, Japan). All chemicals were of analytical grade. Strains, vectors and media For the cloning of the feruloyl esterase gene from F. oxysporum, E. coli One Shot Top10 (Invitrogen) and Zero Blunt PCR Cloning Kit (Invitrogen) were used as the host vector system. P. pastoris host strain X-33 and ppiczαc (Invitrogen) were used for protein expression. The wildtype (WT) strain of F. oxysporum isolated from cumin (by prof. Christakopoulos and his research group in 1989), was maintained on potato dextrose agar at 4 C. E. coli was grown at 37 C in LB medium containing 50 µg kanamycin ml 1 for selection of clones transformed with the Zero Blunt PCR vector. P. pastoris was routinely grown in shaking flasks at 30 C in a rich medium containing 1% (w/v) yeast extract, 2% (w/v) peptone, 0.1 M potassium phosphate buffer, ph 6.0, 1.34% (w/v) yeast nitrogen base, % biotin and 1% (v/v) glycerol (BMGY) before induction or 0.5% (v/v) methanol (BMMY) for induction. For maintaining cultures and plates, 1% (w/v) yeast extract, 2% (w/v) peptone and 2% (w/v) dextrose (YPD) medium was used, and for selection of transformants, YPD plates containing 1 M sorbitol (YPDS) and 100 µg ml 1 Zeocin at final concentration were used. Cell cultivation From a stock culture of Fusarium oxysporum cells were transferred into slants prepared with solid agar growth medium (39 g/l of Potato Dextrose Agar (PDA) and 1 g/l of yeast extract) and incubated four days. After this a new transfer was done, this time to flasks with liquid medium (1 g/l KH 2 PO 4, 0.3 g/l CaCl 2, 0.3 g/l MgSO 4 7H 2 O, 15.6 g/l NaH 2 PO 4 2H 2 O, 1.52 g/l Na 2 HPO 4 2H 2 O(or 1.2 g/l Na 2 HPO 4 ) and 10 g/l (NH 4 ) 2 HPO 4 ). These flasks were incubated at 30 º C and 30 RPM, initially for three days, and then later extended another day, as the growth of F. oxysporum had not been as great as desired. 13
14 In addition, a second transfer to liquid medium was made in parallel to the first, just in case the first would turn out to be contaminated. An examination in light microscope however revealed that this was not to be the case. Meanwhile a transfer was also made from a stock culture of Pichia pastoris to solid YPD agar medium (1% yeast extract, 2% peptone, 2% dextrose, 2% nutrient agar) on plates, incubated at 30 º C, to be used further on in the experiment. After the flasks with liquid media had been incubated, their content was transferred into a number (4 per flask) of 25 ml sterilin tubes, placed in ice. These tubes were centrifuged in pairs at 180 RPM for 7 minutes. The supernatant was discarded while the pelleted biomass was gathered in weighted beakers and the mass of the wet biomass could be determined to 13.4 g. The beakers were stored for 5 minutes at -80ºC before being placed in freeze dryer to remove the water. After having been freeze dried the content from all beakers was gathered in a single weighted sterilin tube and the weight of the dry biomass was 0.96 g. DNA isolation Cellular DNA from Fusarium oxysporum was isolated by a modified version of the method of Lee, Milgroom & Taylor for isolation of total genomic DNA from fungi. Freeze-dried cells staying in a sterilin tube were powdered using a spatula. Two eppendorf tubes were filled with around 100 mg of biomass each. 750 µl of lysis buffer (50 mm Tris-HCl, ph 7.5, 50 mm EDTA, 3% SDS and 1% 2- mercaptoethanol) was added into each tube, then mixed and followed by incubation at 65 C for one hour. After incubation the tubes were mixed once more and 700 µl of a mixture of chloroform/isoamylic alcohol, 24:1 (v/v) was added. The solution was now mixed (inverted) to form an emulsion that was centrifuged at 10,000 RPM for 10 minutes at room temperature. The upper (aqueous) phase was then carefully removed and transferred to a new tube in which 700 µl of chloroform was added, the content was mixed and after that centrifuged again in the same way for another 10 minutes. The upper (aqueous) phase was then once more carefully removed and transferred to a new tube in which this time 20µl 3M NaOAc was added, followed by 1ml of isopropanol. After that the tubes had been mixed (inverted) they were centrifuged for 30 seconds to pellet the DNA and the supernatant was discarded. Following another centrifugation the tubes were then left open to become dry. 300µl of EB buffer (as a substitute for Tris EDTA buffer) was added and the tubes were incubated at 65 o C for 15 minutes. After the incubation 10 µl of NaOAc and 1 ml of ethanol were added, the tubes were centrifuged for 2 minutes and the supernatant was 14
15 discarded. Next 700 µl of ethanol and 300 µl of water were added, effectively resulting in the addition of 1ml of 70% ethanol. After having been gently mixed, the tubes were now centrifuged again and the supernatant discarded. Once more the tubes were staying with open lid to get dry. Finally 100µl of EB buffer was added and the tubes were marked and placed for storage at 20 o C. Cloning of the gene from FOXG_ The gene to be studied, the sequence from the ORF FOXG_ , was amplified by PCR from genomic DNA using primers having a design based on the available information of the sequenced Fusarium oxysporum genome (F. oxysporum Sequencing Project, Broad Institute of Harvard and MIT; The two primers were designed in the following way: 5 -GCATCGATGGCGCTGCCCTCCAATGGAAC-3 including a site for ClaI (underlined) and 5 -CGTCTAGATACACAGGGATCTTGAAAGCATTG-3 including a site for XbaI (underlined). After the ordered primers had arrived a calculated amount of water (137 µl and 109 µl respectively) was added to achieve a stock solution of 100 pmol/µl of each primer. These were left to stay 1 hour in order for the primers to properly dissolve before 25µl of each stock solution was transferred into an eppendorf tube together with 25 µl of water to prepare 50µl of a 50 pmol/µl solution of each primer. A high-fidelity Vent DNA polymerase producing blunt ends was used for the DNA amplification, which was carried out with an initial denaturation of 5 minutes at 94 C, followed by 30 cycles of denaturation (25 s at 94 C), annealing (25 s at 56 C) and extension (120 s at 72 C) finally followed by 5 minutes of further extension at 72 C. In order to determine the DNA sequence, the PCR product was cloned into the pcr-blunt vector according to the method described by the Zero Blunt PCR Cloning Kit. After an agarose gel electrophoresis had been run, the fragment was extracted from the gel according to the protocol of the kit NucleoSpin Extract II (Macherey Nagel) and then ligated into the pcr -Blunt vector by mixing 5µl fragment, 2µl water, 1µl 10x ligation buffer, 1µl pcr -Blunt vector and 1µl T4 DNA ligase and incubating it at 16ºC for 90 minutes. Next an eppendorf tube containing 100µl of E. coli One Shot TOP10 cells was taken out from -80ºC freezer and placed in ice. After having stayed around 5 minutes in ice, 5µl of ligation reaction was added to the tube while gently stirring with the tip of the pipette. The tube was then incubated in the ice for 30 minutes before receiving a heat shock of 42ºC for 90 seconds and then placed back again in the ice. Next 200µl of LB medium (10 g/l tryptone, 5g/l yeast extract and 10 g/l NaCl, ph 7.4) was added and the tube was incubated at 37ºC for 1 hour. 15
16 After that 200 µl of the content from the tube was spread on one LB Km plate (LB medium with 15 g/l nutrient agar and 50 mg/l) while the remaining part was spread on another LB Km plate. Plates were incubated at 37ºC over night, using kanamycin resistance to screen for transformants. Next, selected colonies (transformants resistant to kanamycin) from the plates were transferred into sterilin tubes containing 5 ml of LB medium with 50 µg/ml of kanamycin added. The tubes were incubated at 37ºC and 180 RPM over night. After that the plasmids were isolated from the tubes according to the protocol of the kit NucleoSpin Plasmid. To verify the presence of the fragment of interest, a portion of the isolated plasmids from each tube was digested with restriction enzymes by preparing a mixture of 5 µl plasmid, 2 µl 10x M buffer, 1 µl ClaI, 1µl XbaI and 11 µl water, incubated at 37ºC for 2 hours and then analysed by agarose gel electrophoresis. The samples indicating the strongest presence of the fragment were chosen to be sent for sequencing and two marked eppendorf tubes, each filled with 15 µl of sample, was prepared for each chosen sample (one for the forward primer and the other for the backward primer). While waiting for the result of the sequencing to be returned, more E. coli One Shot TOP10 cells were transformed with plasmids in order to have a bigger amount available. To be able to achieve secreted expression of the gene, the E. coli/p. pastoris vector, ppiczαc, was used. This vector contains the tightly regulated AOX1 promoter and the S. cerevisiae α-factor secretion signal located immediately upstream of the multiple cloning site. After that the result from the sequencing had turned out positive, one of the plasmid samples was chosen for expression. The sample (containing the pcrblunt vector carrying the gene) was digested by preparing a mixture of 40 µl plasmid, 6 µl 10x M buffer, 2 µl ClaI, 2µl XbaI and 6 µl water, incubated at 37ºC for several hours before adding another 2 µl of ClaI and 2µl of XbaI and incubating at 37ºC over night. Following that, the fragment was extracted by running an agarose gel electrophoresis, cutting the fragment out from the gel and then once more follow the protocol of the kit NucleoSpin Extract II (Macherey Nagel). Another agarose gel electrophoresis was run afterwards to verify the presence of fragment in the purified sample. To clone the gene into the ppiczαc vector three different ligation mixes were prepared, each one with a different ratio between amount of vector and amount of insert. The composition of each mixture is given in table 2. 16
17 Table 2: Composition of different ligation mixtures used to clone the gene into the ppiczαc vector. Ligation Water 10x Ligation Buffer ppiczαc vector Insert T4 DNA ligase mixture [µl] [µl] [µl] [µl] [µl] 1: : : V tot [µl] The tubes prepared with the different ligation mixtures were incubated at 16ºC for several hours before being stored at 20ºC until the day of transformation. To amplify the resulting ppiczαc vector with foxg gene, plasmids from each of the three ligation mixtures were transformed into E. coli One Shot TOP10 cells in the same way as before, except that in this case low salt LB medium was used (10 g/l tryptone, 5g/l yeast extract and 5 g/l NaCl, ph 7.5) and the cells were plated on low salt LB plates (Low salt LB medium with 15 g/l nutrient agar and 25 mg/l kanamycin). The next day, in the same way as before selected colonies (this time transformants resistant to) from the plates were transferred into sterilin tubes containing 5 ml of low salt LB medium with 25 µg/ml of Zeocin added. The tubes were then incubated as before at 37ºC and 180 RPM over night. After that, just as before, the plasmids were isolated, a portion of the isolated plasmids was digested with restriction enzymes and then analysed by agarose gel electrophoresis to confirm the presence of the fragment and the successful cloning of the gene into the vector ppiczαc, now ready to be transformed into P. pastoris. Transformation of P. pastoris and screening of recombinant transformants In order to be transformed into P. pastoris the circular plasmid ppiczαc/foxg was first going to be linearized with SacI. This was done by preparing a digestion mix consisting of 35 µl plasmid, 5 µl SacI, 10 µl 10x L buffer and 50 µl water, incubated at 37ºC for several hours and then washed (to remove by SacI) by adding 600 µl of wash buffer A4 from the kit NucleoSpin Plasmid, transfer everything into a NucleoSpin Plasmid Column placed in a collecting tube, centrifuge for 1 min, discard flow through and then follow the last two steps of the protocol of the kit. To prepare for the transformation a sterilin tube containing 5ml of YPD medium (10 g/l yeast extract, 20 g/l peptone and 20 g/l dextrose) was inoculated with cells from a stock culture of P. pastoris and incubated at 30ºC and 200 RPM over night. After that 50 µl was transferred from the sterilin tube with cells into each one of three 250 ml flasks containing 100 ml of YPD medium. The flasks were incubated at 30ºC and 200 RPM over night. 17
18 Next, one flask was used to measure OD 600 while the content of the other two was pored over into a sterilized centrifugation tube. The tube was centrifuged at 1500 x g for 5 minutes and the supernatant discarded. Next the pellet was resuspended with 250 ml icecold (0ºC) sterile water, centrifuged in the same way again and the supernatant once more discarded. Again the pellet was resuspended with another 250 ml ice-cold (0ºC) sterile water, centrifuged in the same way and the supernatant discarded. After this the pellet was resuspended with 20 ml of ice-cold (0ºC) sterile 1M sorbitol, centrifuged in the same way and the supernatant discarded. Following this the pellet was resuspended with 1 ml of ice-cold (0ºC) sterile 1M sorbitol to a final volume of approximately 1.5 ml. The transformation of P. pastoris was done by electroporation, according to the EasySelect Pichia Expression Kit. Normally 80 µl of cells is mixed with 30µl of linearized plasmid, but in this case, since the linear plasmid had been eluted into 50 µl of water instead of 30 µl, 80 µl of cells was added directly to the tube containing the linear plasmid and the content was transferred into an electroporation cuvette. After having been incubated 5 minutes on ice, the cuvette received a pulse of 2000 V during 5ms generated by the electroporation machine. Immediately after the electroporation 1 ml of ice-cold (0ºC) sterile 1M sorbitol was added to the cuvette and the content was transferred into a 15 ml Falcon tube. The tube was incubated at 30ºC for 2 hours. After that 300 µl was transferred from the tube to each one of three YPDS plates (YPD medium with 1M sorbitol (182.2g/l), 20 g/l agar and 100 mg/l Zeocin ) and the rest was transferred to a fourth YPDS plate. The plates were incubated at 30ºC for three days, using Zeocin resistance to screen for transformants. When three days had past the plates were taken out from the incubator and placed in fridge. Production of the enzyme To start preparing for expression, cells were transferred from each one of the three colonies visible over onto marked areas of a MD plate (13.4 g/l yeast nitrogen base (YNB), 0.4 mg/l biotin, 20 g/l dextrose and 15 g/l agar) using the tip of a pipette. The plate was incubated at 30 C over night. Next, using a loop, three baffled 250 ml flasks (sterilized, with cotton in neck and marked 1,2 and 3) containing 50 ml of BMGY medium (10 g/l yeast extract, 20 g/l peptone, 0.1M potassium phosphate buffer, ph=6, 13.4 g/l yeast nitrogen base (YNB), 0.4 mg/l biotin, 10 ml/l glycerol) were inoculated with cells from the corresponding sector (1,2 and 3) of the MD plate. The flasks were incubated at 30 C and ~200 RPM over night. After that a smaller amount (~5-10 ml) was transferred from each one of the three flasks into marked sterilin tubes in order to measure OD 600. Another amount of the same size 18
19 was transferred to a fourth sterilin tube, to be centrifuged and used to set OD 600 =0 for medium without cells. 1:4 dillutions were prepared of the four samples (1,2,3, only medium) by adding 250 µl of sample together with 750 µl of water into a spectrophotometer cuvette. Table 3 gives the results from the measurements of OD 600 and the subsequent calculations of preculture volumes using equation V preculture = (1) OD 600 Table 3: Measurements of OD 600 and calculated preculture volumes for each one of the three samples. V preculture Sample 1:4 OD 600 [ml] Based on these calculations around 20 ml (the preculture) was transferred from each one of the three flasks into (marked and sterile) sterilin tubes. The tubes were centrifuged for five minutes and the supernatant was discarded. Next the cells were to be resuspended in BMMY (10 g/l yeast extract, 20 g/l peptone, 0.1M potassium phosphate buffer, ph=6, 13.4 g/l yeast nitrogen base (YNB), 0.4 mg/l biotin, 5 ml/l methanol) medium to induce expression of the enzyme. 20 ml of BMMY medium was transferred into each one of the sterilin tubes, while another 80 ml of BMMY medium was transferred into each one of three (sterilized, with cotton and marked) baffled 250 ml flasks. The cells were then resuspended by inverting and vortexing the sterilin several times before the content was transferred into the baffled 250 ml flasks, now containing a total volume of 100 ml each. The flasks were incubated at 30 C and 200 RPM over night. The following three days 500 µl of methanol was added every day to each one of the flasks to maintain the induction of enzyme expression. The fourth day a small amount (~5 ml) of cell culture was transferred from each one of the flasks into (used and marked) sterilin tubes before the adding of methanol. This small amount was to be used for an assay of esterase activity. 19
20 Enzyme and protein assays Esterase activity was assayed using as substrate and the visual detection of green colour (due to the release of p-nitrophenol) as a sign of positive outcome. To begin with, some 2 ml were transferred from the each one of the three-sterilin tubes with cell culture into (marked) 2 ml eppendorf tubes. These were centrifuged for about two minutes to pellet the cells. Next a small amount of p-nitrophenyl acetate was added to each one of three (marked) 1.5 ml eppendorf tubes, followed by around 900 µl of phosphate buffer, ph=6 and 100 µl of supernatant from the tubes with centrifuged cell culture. The tubes were then incubated at 40 C for a while until the possible detection of greenish colour. 20
21 Results and discussions Amplification of FOXG_ Recently, in the Fusarium oxisporum genome, ten translated ORFs were identified, based on primary sequence similarities, as potential FAEs, which is consistent with the expectation that F. oxysporum is capable of producing more than one type of FAE. One of these ORFs, FOXG_ , encodes putative FAE with 46 47% identity with NcFaeD from N. crassa and CjFaeD from Cellvibrio japonicus, showing type A or D FAE activity [7]. This sequence was the one initially chosen for study. The amplification through PCR of the sequence from the ORF FOXG_ turned out to be much harder than expected and came to require a rather big number of repeated attempts. Not until the temperature for hybridisation (annealing) had been varied several times, another DNA sample had been used as template, another polymerase had been used and even another set of primers from another company, was it possible to achieve satisfying results. Figure 4 shows the result of the first attempt to amplify the gene, yielding only weak, hardly visible bands at the expected product size when running an agar gel electrophoresis with the product from the amplification. Fig. 4: Agarose gel electrophoresis of the product resulting from the first attempt to amplify the sequence from FOXG_ In lanes 1-3, a weak band at the size of bp can be noticed, in particular for the first two. Fig. 5: Agarose gel electrophoresis showing the amplified product visible in lane 1. Fig. 6: Agarose gel electrophoresis used for gel extraction. The product band can be seen slightly above another band of similar intensity, of which both were cut and processed separately, in lanes 1 and 2. 21
22 Many unsuccessful attempts then followed until finally the amplified product could be seen again, as shown in figure 5. The product from this amplification was used for gel extraction and the resulting gel, from which a slice containing the product band was cut, can be seen in figure 6: Cloning of the gene from FOXG_ into pcr -Blunt vector Samples of plasmids, purified from ten different transformed colonies, were each one digested with restriction enzymes (PstI, XbaI) and analysed by agarose gel electrophoresis. As can be seen in figure 7, all ten samples have fragments at the size of the vector, but only the first sample contains a fragment of the expected gene size. Fig. 7: Agarose gel electrophoresis showing the result from the first cloning of the sequence from FOXG_ into pcr -Blunt vector. Fragments at the size of the vector can be seen in all 10 samples, but only in sample 1 can be seen a fragment at the size of the gene. To verify that the fragment of expected size really is the gene, a crosstest was performed, by running a PCR with a different combination of primers, using the regular set, together with another one, designed to eliminate the intron in the middle of the gene. If the fragment really is the gene then the result from the crosstest should be the detection of a fragment at about half the size of the actual fragment. However, as can be seen in figure 8, even after two such tests repeated, very little (at best) of such fragment size could be seen. 22
23 Fig. 8: Agarose gel electrophoresis showing the result of a PCR crosstest, using combinations of different primers to test the presence of the gene. The strong band in lane 1 and 2, at around the size of the whole gene, in contrast to the hardly visible band at the expected fragment size for this combination (about half the size of the gene) demonstrates that the fragment is most likely not the gene of interest. Instead, the main band appears to be at the size of the whole gene, something that suggests that the fragment obtained is not the gene in question. Amplification of FOXG_ , using new primers Since the fragment obtained did not turn out to be the gene, a new strategy was tried, to amplify the gene using a new set of primers ordered from a different company. Unfortunately this seemed to have little effect, as it still turned out hard to amplify the gene. Not until after several attempts and the use of another DNA sample as template and another polymerase could a fragment of the expected size be seen, first on a gel run with product from a PCR with T annealing =56 C, as seen in figure 9, then on another gel this time with T annealing =58 C, as seen in figure 10. The products from both these amplifications were used for gel extraction. Figure 11 shows the resulting gel that a slice was cut from. 23
24 Fig. 9: Agarose gel electrophoresis showing the result of a PCR run with the new primers ordered, T annealing =56 C and two different samples, one with concentrated DNA as template the other with diluted (1/10) DNA. A band of the expected size can be seen in the sample with concentrated DNA (lane 2) but not in the one with diluted DNA (lane 1). Fig. 10: Agarose gel electrophoresis showing the result of another PCR, this time with two samples, one with T annealing =58 C (lane 1) and the other with T annealing =60 C (lane 2). A weak band can be seen in lane 1. Fig. 11: Agarose gel electrophoresis used for gel extraction, lane 1 and 2 originating from the 56 C product while the other two (lane 3 and 4) originating from the 58 C product. Both pairs of bands were cut out with a scalpel and placed in eppendorf tubes, 56 C product being purified while 58 C product was stored in freezer. Cloning of the gene from FOXG_ into pcr -Blunt vector Just as before plasmids samples from different colonies (this time five), were digested with restriction enzymes (now SacI and XbaI) and analysed by agarose gel electrophoresis. As can be seen in figure 12, all five samples have fragments at the size of the vector, while the samples (1), 3,4 and 5 contain a fragment of the expected gene size. Sample four was chosen to proceed with as it showed the strongest and clearest band at the right size. A crosstest was done, as previously, this time indicating a positive result, bands at the sizes ~300 bp and ~400 bp respectively. So, the sample was sent away for sequencing. The result that came back from the sequencing however, turned out negative. Finally it was decided to stop working with this sequence altogether and instead make an attempt to clone another similar ORF, namely FOXG_
25 Fig. 12. Agarose gel electrophoresis showing the result from the second cloning of FOXG_ into pcr -Blunt vector. It is hard to know the exact reason how come this sequence turned out so hard to obtain, one possible explanation could be minor differences between the genome of the F. oxysporum strain used in the laboratoty (F3) and the one used to map the genome in the USA. Such differences are usually relatively small, but perhaps in the case of this particular ORF, they happen to be of significant importance for the primers ability to match to the sequence? 25
26 Amplification of FOXG_ Since the attempt to clone FOXG_ was unsuccessful, another similar sequence from the F. oxysporum genome was chosen, namely the sequence of the ORF FOXG_ In order to have an idea what to expect when cloning this ORF, a BLAST search of the translated protein sequence was made. The result is shown in figures A and B in the appendix. At a first glance it seems clear that this enzyme most likely belongs to the tannase and feruloyl esterase family. Judging from the top scoring hits it s very tempting to say that it is a tannase, but it s important to keep in mind that tannases and feruloyl esterases, type C share a great deal of similarities in terms of sequence, so it would be rather risky to make such a conclusion, especially since these two classes of enzymes have different properties and act upon different substrates. Not until a proper investigation has been made concerning the activity and substrate specificity of the enzyme is it possible to conclude what type of enzyme it really is. The PCR amplification of the sequence from the ORF FOXG_ turned out to be a whole lot easier than how it had been with FOXG_ As can be seen in figure 13, already the first PCR run resulted in clear bands at the expected size of the fragment. In this case three reactions had been run, all with different concentrations of DNA as template, one being a 1/10 dillution, the next a 1/6 dillution and the last a 1/3 dillution. Between these, the 1/10 product was chosen for gel extraction. The successful extraction of the fragment from the 1/10 product can be seen in figure 14, showing the positive result of the subsequent cleanup after gel extraction. 26
27 Fig. 13: Agarose gel electrophoresis showing the result (positive) of the first amplification of FOXG_ Three reactions had been run, all with different DNA concentration as template. From left to right:1/10 dilution of DNA (lane 1), 1/6 dilution (lane 2) and 1/3 dilution (lane 3). Among these the 1/10 dilution was used to prepare for extraction. Fig. 14: Agarose gel electrophoresis of the extracted fragment after gel cleanup. A weak band can be seen in lane 1, indicating a successful cleanup. Cloning of the gene from FOXG_ into pcr -Blunt vector In the same way as previously plasmids samples originating from different colonies (this time four), were digested with restriction enzymes (in this case ClaI and XbaI) and analysed by agarose gel electrophoresis. The result is shown in figure 15. It can be seen (in the lower row) that all four samples have fragments at the size of the vector, while the samples 1,2 and 4 contains a fragment of the expected gene size as well. Sample 1 and sample 4 shows the clearest bands and were therefore chosen to be sent for sequencing. Fig. 15: Agarose gel electrophoresis showing the result of cloning FOXG_ into pcr - Blunt vector. Bands at the size of the vector can be seen in all four samples while bands at the size of the fragment can be seen in samples 1,2 and 4. 27
28 Cloning of the gene from FOXG_ into ppiczα vector As before plasmids samples coming from different colonies (this time ten), were digested with restriction enzymes (in this case ClaI and XbaI) and analysed by agarose gel electrophoresis. The first attempt however turned out unsuccessful so another ten colonies were chosen and plasmids were purified from each one of them. As can be seen in figure 16, the result was positive this time and it was possible to proceed with the transformation of Pichia pastoris and the subsequent expression of the enzyme. Fig.16: Agarose gel electrophoresis showing the result of the second attempt (successful) to clone FOXG_ into ppiczα vector. Positive result (band at the size of the fragment) can be seen for samples 2 and 7. Note that band seen in the lane immediately to the right of the markers in the left is merely the result of spillage from the well to the right of it (sample 1) and that the number of samples really is ten. Transformation of P. pastoris and expression of the enzyme The presence of colonies on YPDS plates with Zeocin suggests that cells of P. pastoris were successfully transformed. After having been induced for expression during four days an esterase assay was carried out using p-nitrophenyl acetate as substrate, resulting in a green colour if positive (due to the release of p-nitrophenol). Figure 17 shows that among the three sample that were tested, all three yielded a positive result for esterase activity. 28
29 Fig.17: Eppendorf tubes (marked 1, 2 and 3) containing p-nitrophenyl acetate, phosphate buffer, ph=6 and a sample from the supernatant of the transformed P. pastoris cultures, induced to express the enzyme, pictured next to control samples (marked C1, C2 and C3) lacking the supernatant sample. Green colour (caused by the release of p-nitrophenol) indicating esterase activity in the tubes containing supernatant sample, demonstrating the presence of an enzyme with esterase activity. The outcome of this assay clearly shows that the enzyme expressed from the ORF FOXG_ has esterase activity. It is however not possible in this moment to say if it is a feruloyl esterase. Strictly speaking this cannot be said for sure until it has been established if the enzyme is capable of releasing ferulic acid from plant cell wall. Unfortunately due to lack of time any further investigation of activity could not be covered with this report. Conclusions The isolation and cloning of the ORF FOXG_ , due to some unknown reason, turned out much more difficult than expected and because of the time available being limited, the investigation was postponed. Concerning the ORF FOXG_ , this one was, on the other hand, successfully cloned and later on also expressed in P. pastoris. It could be shown that the ORF encodes an enzyme that possesses esterase activity. It could however not be concluded weather it is the question of a feruloyl esterase or not. 29
30 References 1. Benoit, I., Danchin, E. G. J.; Bleichrodt, R.-J.; De Vries, R. P., Biotechnol. Lett. (2008), 30, Topakas, E., Vafiadi, C., Christakopoulos, P., Proc. Biochem. (2007), 42, Mathew, S., Abraham, T.E., Crit. Rev. Biotechnol., (2004), 24(2 3), De Vries, R. P., Visser, J., Microbiol Molec. Biol. Rev., (2001), Vafiadi, C., Topakas, E., Bakx, E. J., Schols, H. A., Christakopoulos, P., Molecules (2007), 12, Wong, D. W. S., Applied Biochem. Biotechnol., (2006), 133, Moukouli, M., Topakas, E., Christakopoulos, P., Appl. Microbiol. Biotechnol. (2008), 79, Crepin, V. F., Faulds, C. B., Connerton, I. F., Biochem. J. (2003), 370, Crepin, V. F., Faulds, C. B., Connerton, I. F., Appl. Microbiol. Biotechnol. (2004), 63,
31 Appendix Fig. A: Graphical overview of the result from a BLAST search of the translated protein sequence from the ORF FOXG_
32 Fig. B: Listing of the highest scoring results from a BLAST search of the translated protein sequence from the ORF FOXG_
Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:
Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
TN LR TT mg/l N b) 2,6-Dimethylphenole
TN LR TT 0.5-14 mg/l N b) 2,6-Dimethylphenole 283 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
TN HR TT b) i) 5-140 mg/l N 2,6-Dimethylphenole 284 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the
MOLECULAR SHAPES MOLECULAR SHAPES
Molecules with 2 electron pair groups around Linear molecules have polar bonds, but are the central atom form a linear shape. usually non-polar. is 180 linear 2 electron pairs around the central atom 1
Iron VARIO PP mg/l Fe g) 1,10-Phenanthroline
Iron VARIO PP 0.02-1.5 mg/l Fe g) 1,10-Phenanthroline 221 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
Formaldehyde M. TT 0.1-5 mg/l HCHO SO 4 / Chromotropic acid 177 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption
Beijer Electronics AB 2000, MA00336A, 2000-12
Demonstration driver English Svenska Beijer Electronics AB 2000, MA00336A, 2000-12 Beijer Electronics AB reserves the right to change information in this manual without prior notice. All examples in this
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET National Swedish parental studies using the same methodology have been performed in 1980, 2000, 2006 and 2011 (current study). In 1980 and 2000 the studies
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
Dokumentnamn Order and safety regulations for Hässleholms Kretsloppscenter. Godkänd/ansvarig Gunilla Holmberg. Kretsloppscenter
1(5) The speed through the entire area is 30 km/h, unless otherwise indicated. Beware of crossing vehicles! Traffic signs, guardrails and exclusions shall be observed and followed. Smoking is prohibited
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
1. Compute the following matrix: (2 p) 2. Compute the determinant of the following matrix: (2 p)
UMEÅ UNIVERSITY Department of Mathematics and Mathematical Statistics Pre-exam in mathematics Linear algebra 2012-02-07 1. Compute the following matrix: (2 p 3 1 2 3 2 2 7 ( 4 3 5 2 2. Compute the determinant
Support Manual HoistLocatel Electronic Locks
Support Manual HoistLocatel Electronic Locks 1. S70, Create a Terminating Card for Cards Terminating Card 2. Select the card you want to block, look among Card No. Then click on the single arrow pointing
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation
Country report: Sweden
Country report: Sweden Anneli Petersson, PhD. Swedish Gas Centre Sweden Statistics for 2006 1.2 TWh produced per year 223 plants 138 municipal sewage treatment plants 60 landfills 3 Industrial wastewater
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
A study of the performance
A study of the performance and utilization of the Swedish railway network Anders Lindfeldt Royal Institute of Technology 2011-02-03 Introduction The load on the railway network increases steadily, and
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
This exam consists of four problems. The maximum sum of points is 20. The marks 3, 4 and 5 require a minimum
Examiner Linus Carlsson 016-01-07 3 hours In English Exam (TEN) Probability theory and statistical inference MAA137 Aids: Collection of Formulas, Concepts and Tables Pocket calculator This exam consists
2.1 Installation of driver using Internet Installation of driver from disk... 3
&RQWHQW,QQHKnOO 0DQXDOÃ(QJOLVKÃ'HPRGULYHU )RUHZRUG Ã,QWURGXFWLRQ Ã,QVWDOOÃDQGÃXSGDWHÃGULYHU 2.1 Installation of driver using Internet... 3 2.2 Installation of driver from disk... 3 Ã&RQQHFWLQJÃWKHÃWHUPLQDOÃWRÃWKHÃ3/&ÃV\VWHP
Writing with context. Att skriva med sammanhang
Writing with context Att skriva med sammanhang What makes a piece of writing easy and interesting to read? Discuss in pairs and write down one word (in English or Swedish) to express your opinion http://korta.nu/sust(answer
Tunga metaller / Heavy metals ICH Q3d & Farmakope. Rolf Arndt Cambrex Karlskoga
Tunga metaller / Heavy metals ICH Q3d & Farmakope Rolf Arndt Cambrex Karlskoga Tunga metaller / Heavy metals Rolf Arndt -Quality Assurance Cambrex Karlskoga - Svenska Farmakopekommitten / Working Party
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
Boiler with heatpump / Värmepumpsberedare
Boiler with heatpump / Värmepumpsberedare QUICK START GUIDE / SNABBSTART GUIDE More information and instruction videos on our homepage www.indol.se Mer information och instruktionsvideos på vår hemsida
Webbregistrering pa kurs och termin
Webbregistrering pa kurs och termin 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en länk till Studieöversiktssidan. På den sidan
Materialplanering och styrning på grundnivå. 7,5 högskolepoäng
Materialplanering och styrning på grundnivå Provmoment: Ladokkod: Tentamen ges för: Skriftlig tentamen TI6612 Af3-Ma, Al3, Log3,IBE3 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles
INSTALLATION INSTRUCTIONS
INSTALLATION - REEIVER INSTALLATION INSTRUTIONS RT0 RF WIRELESS ROOM THERMOSTAT AND REEIVER MOUNTING OF WALL MOUTING PLATE - Unscrew the screws under the - Pack contains... Installation - Receiver... Mounting
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH 2016 Anne Håkansson All rights reserved. Svårt Harmonisera -> Introduktion, delar: Fråga/
GERDA Cryostat Rn emanation
GERDA Cryostat Rn emanation K.T. Knöpfle, B. Schwingenheuer, H. Simgen, G. Zuzel MPI für Kernphysik, Heidelberg General remarks Tolerable rate: ~8 (14) mbq 10-4 cts/(kg kev y) assuming homogenous Rn distribution
Kundfokus Kunden och kundens behov är centrala i alla våra projekt
D-Miljö AB bidrar till en renare miljö genom projekt där vi hjälper våra kunder att undersöka och sanera förorenad mark och förorenat grundvatten. Vi bistår dig som kund från projektets start till dess
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas
Michael Q. Jones & Matt B. Pedersen University of Nevada Las Vegas The Distributed Application Debugger is a debugging tool for parallel programs Targets the MPI platform Runs remotley even on private
BOENDEFORMENS BETYDELSE FÖR ASYLSÖKANDES INTEGRATION Lina Sandström
BOENDEFORMENS BETYDELSE FÖR ASYLSÖKANDES INTEGRATION Lina Sandström Frågeställningar Kan asylprocessen förstås som en integrationsprocess? Hur fungerar i sådana fall denna process? Skiljer sig asylprocessen
SWESIAQ Swedish Chapter of International Society of Indoor Air Quality and Climate
Swedish Chapter of International Society of Indoor Air Quality and Climate Aneta Wierzbicka Swedish Chapter of International Society of Indoor Air Quality and Climate Independent and non-profit Swedish
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
Solutions to exam in SF1811 Optimization, June 3, 2014
Solutions to exam in SF1811 Optimization, June 3, 14 1.(a) The considered problem may be modelled as a minimum-cost network flow problem with six nodes F1, F, K1, K, K3, K4, here called 1,,3,4,5,6, and
Kursutvärderare: IT-kansliet/Christina Waller. General opinions: 1. What is your general feeling about the course? Antal svar: 17 Medelvärde: 2.
Kursvärdering - sammanställning Kurs: 2AD510 Objektorienterad programmering, 5p Antal reg: 75 Program: 2AD512 Objektorienterad programmering DV1, 4p Antal svar: 17 Period: Period 2 H04 Svarsfrekvens: 22%
PORTSECURITY IN SÖLVESBORG
PORTSECURITY IN SÖLVESBORG Kontaktlista i skyddsfrågor / List of contacts in security matters Skyddschef/PFSO Tord Berg Phone: +46 456 422 44. Mobile: +46 705 82 32 11 Fax: +46 456 104 37. E-mail: tord.berg@sbgport.com
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Discovering!!!!! Swedish ÅÄÖ. EPISODE 6 Norrlänningar and numbers 12-24. Misi.se 2011 1
Discovering!!!!! ÅÄÖ EPISODE 6 Norrlänningar and numbers 12-24 Misi.se 2011 1 Dialogue SJs X2000* från Stockholm är försenat. Beräknad ankoms?d är nu 16:00. Försenat! Igen? Vad är klockan? Jag vet inte.
6 th Grade English October 6-10, 2014
6 th Grade English October 6-10, 2014 Understand the content and structure of a short story. Imagine an important event or challenge in the future. Plan, draft, revise and edit a short story. Writing Focus
Tentamen i Matematik 2: M0030M.
Tentamen i Matematik 2: M0030M. Datum: 203-0-5 Skrivtid: 09:00 4:00 Antal uppgifter: 2 ( 30 poäng ). Examinator: Norbert Euler Tel: 0920-492878 Tillåtna hjälpmedel: Inga Betygsgränser: 4p 9p = 3; 20p 24p
Grass to biogas turns arable land to carbon sink LOVISA BJÖRNSSON
Grass to biogas turns arable land to carbon sink LOVISA BJÖRNSSON Project funding and reporting, Thomas Prade & Mikael Lantz (2016) Grass for biogas - Arable land as carbon sink. Report 2016:280. Energiforsk,
Webbreg öppen: 26/ /
Webbregistrering pa kurs, period 2 HT 2015. Webbreg öppen: 26/10 2015 5/11 2015 1. Du loggar in på www.kth.se via den personliga menyn Under fliken Kurser och under fliken Program finns på höger sida en
Uttagning för D21E och H21E
Uttagning för D21E och H21E Anmälan till seniorelitklasserna vid O-Ringen i Kolmården 2019 är öppen fram till och med fredag 19 juli klockan 12.00. 80 deltagare per klass tas ut. En rangordningslista med
Könsfördelningen inom kataraktkirurgin. Mats Lundström
Könsfördelningen inom kataraktkirurgin Mats Lundström Innehåll Fördelning av antal operationer utveckling Skillnader i väntetid Effekt av NIKE Skillnader i synskärpa före operation Skillnader i Catquest-9SF
Workplan Food. Spring term 2016 Year 7. Name:
Workplan Food Spring term 2016 Year 7 Name: During the time we work with this workplan you will also be getting some tests in English. You cannot practice for these tests. Compulsory o Read My Canadian
FÖRBERED UNDERLAG FÖR BEDÖMNING SÅ HÄR
FÖRBERED UNDERLAG FÖR BEDÖMNING SÅ HÄR Kontrollera vilka kurser du vill söka under utbytet. Fyll i Basis for nomination for exchange studies i samråd med din lärare. För att läraren ska kunna göra en korrekt
12.6 Heat equation, Wave equation
12.6 Heat equation, 12.2-3 Wave equation Eugenia Malinnikova, NTNU September 26, 2017 1 Heat equation in higher dimensions The heat equation in higher dimensions (two or three) is u t ( = c 2 2 ) u x 2
Om oss DET PERFEKTA KOMPLEMENTET THE PERFECT COMPLETION 04 EN BINZ ÄR PRECIS SÅ BRA SOM DU FÖRVÄNTAR DIG A BINZ IS JUST AS GOOD AS YOU THINK 05
Om oss Vi på Binz är glada att du är intresserad av vårt support-system för begravningsbilar. Sedan mer än 75 år tillverkar vi specialfordon i Lorch för de flesta olika användningsändamål, och detta enligt
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
The present situation on the application of ICT in precision agriculture in Sweden
The present situation on the application of ICT in precision agriculture in Sweden Anna Rydberg & Johanna Olsson JTI Swedish Institute for Agricultural and Environmental Engineering Objective To investigate
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols.
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols. ExcelLoad simulates the maximum forces that may appear during a transport no matter if the
The Arctic boundary layer
The Arctic boundary layer Interactions with the surface, and clouds, as learned from observations (and some modeling) Michael Tjernström Department of Meteorology & the Bert Bolin Center for Climate Research,
Questionnaire on Nurses Feeling for Hospital Odors
J. Japan Association on Odor Environment Vol. -1 No. 0,**0 437 *, ** * * Questionnaire on Nurses Feeling for Hospital Odors Tomoyo ITAKURA*, **, Megumi MITSUDA*, Takuzo INAGAKI*,,/. + +-/ 13.+... + +,,
Laser Diffraction System Verification
Laser Diffraction System Verification mark.bumiller@horiba.com 2007 HORIBA, Ltd. All rights reserved. Calibration vs. Verification Calibration : enter standard sample(s), adjust instrument response to
Övning 5 ETS052 Datorkommuniktion Routing och Networking
Övning 5 TS5 Datorkommuniktion - 4 Routing och Networking October 7, 4 Uppgift. Rita hur ett paket som skickas ut i nätet nedan från nod, med flooding, sprider sig genom nätet om hop count = 3. Solution.
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and
Beslut om bolaget skall gå i likvidation eller driva verksamheten vidare.
ÅRSSTÄMMA REINHOLD POLSKA AB 7 MARS 2014 STYRELSENS FÖRSLAG TILL BESLUT I 17 Beslut om bolaget skall gå i likvidation eller driva verksamheten vidare. Styrelsen i bolaget har upprättat en kontrollbalansräkning
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
Signatursida följer/signature page follows
Styrelsens i Flexenclosure AB (publ) redogörelse enligt 13 kap. 6 och 14 kap. 8 aktiebolagslagen över förslaget till beslut om ökning av aktiekapitalet genom emission av aktier och emission av teckningsoptioner
Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen
Examensarbete Projektmodell med kunskapshantering anpassad för Svenska Mässan Koncernen Malin Carlström, Sandra Mårtensson 2010-05-21 Ämne: Informationslogistik Nivå: Kandidat Kurskod: 2IL00E Projektmodell
Support for Artist Residencies
1. Basic information 1.1. Name of the Artist-in-Residence centre 0/100 1.2. Name of the Residency Programme (if any) 0/100 1.3. Give a short description in English of the activities that the support is
S 1 11, S 2 9 and S 1 + 2S 2 32 E S 1 11, S 2 9 and 33 S 1 + 2S 2 41 D S 1 11, S 2 9 and 42 S 1 + 2S 2 51 C 52 S 1 + 2S 2 60 B 61 S 1 + 2S 2 A
MÄLARDALEN UNIVERSITY School of Education, Culture and Communication Department of Applied Mathematics Examiner: Lars-Göran Larsson EXAMINATION IN MATHEMATICS MAA151 Single Variable Calculus, TEN Date:
Kursplan. EN1088 Engelsk språkdidaktik. 7,5 högskolepoäng, Grundnivå 1. English Language Learning and Teaching
Kursplan EN1088 Engelsk språkdidaktik 7,5 högskolepoäng, Grundnivå 1 English Language Learning and Teaching 7.5 Higher Education Credits *), First Cycle Level 1 Mål Efter genomgången kurs ska studenten
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
Kvalitetsarbete I Landstinget i Kalmar län. 24 oktober 2007 Eva Arvidsson
Kvalitetsarbete I Landstinget i Kalmar län 24 oktober 2007 Eva Arvidsson Bakgrund Sammanhållen primärvård 2005 Nytt ekonomiskt system Olika tradition och förutsättningar Olika pågående projekt Get the
3 rd October 2017
3 rd October 2017 Failures of Scaffold False work Failures Form work Bursting Trench Support Failure Hoarding Failures Can be expensive and result in fatalities and serious injuries Cardiff
EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09
EXTENAL ASSESSENT SAPLE TASKS SWEDISH BEAKTHOUGH LSPSWEB/0Y09 Asset Languages External Assessment Sample Tasks Breakthrough Stage Listening and eading Swedish Contents Page Introduction 2 Listening Sample
State Examinations Commission
State Examinations Commission Marking schemes published by the State Examinations Commission are not intended to be standalone documents. They are an essential resource for examiners who receive training
The Municipality of Ystad
The Municipality of Ystad Coastal management in a local perspective TLC The Living Coast - Project seminar 26-28 nov Mona Ohlsson Project manager Climate and Environment The Municipality of Ystad Area:
x 2 2(x + 2), f(x) = by utilizing the guidance given by asymptotes and stationary points. γ : 8xy x 2 y 3 = 12 x + 3
MÄLARDALEN UNIVERSITY School of Education, Culture and Communication Department of Applied Mathematics Examiner: Lars-Göran Larsson EXAMINATION IN MATHEMATICS MAA151 Single Variable Calculus, TEN2 Date:
En bild säger mer än tusen ord?
Faculteit Letteren en Wijsbegeerte Academiejaar 2009-2010 En bild säger mer än tusen ord? En studie om dialogen mellan illustrationer och text i Tiina Nunnallys engelska översättning av Pippi Långstrump
(Aloe vera L.) Downloaded from jcb.sanru.ac.ir at 20: on Thursday October 24th Liliaceae
71... 1390 /7 / / (Aloe vera L.) 2 2 1..... (Aloe vera L.).... MS (2 ). P (1 ) I (0/25 ) -1-2 90/12/21 : 89/6/22 : IAA (0/1 ) (0/5 0/2 ) Kin (1-0/5 ). I (1 ) (1-0/2 ). 10/66 1/36 (2 ) + Kin (0/5 ) + (2
ASSEMBLY INSTRUCTIONS SCALE SQUARE - STANDARD
ASSEMBLY INSTRUCTIONS ALL COMPONENTS Metal profile 0 mm Gripper Ceiling attachments Screws for ceiling attachements (not included) Wires Metal profile 60 mm Metal profile 00 mm Felt - Full Felt - Half
Skill-mix innovation in the Netherlands. dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands
Skill-mix innovation in the Netherlands dr. Marieke Kroezen Erasmus University Medical Centre, the Netherlands m.kroezen@erasmusmc.nl The skill-mix innovation of interest BEFORE AFTER How did the Netherlands
Methods to increase work-related activities within the curricula. S Nyberg and Pr U Edlund KTH SoTL 2017
Methods to increase work-related activities within the curricula S Nyberg and Pr U Edlund KTH SoTL 2017 Aim of the project Increase Work-related Learning Inspire theachers Motivate students Understanding
81152 TRANSFER CASE SHIFT HANDLE
Installation Instructions for TRANSFER CASE SHIFT HANDLE for 2007 2018 JEEP JK WRANGLER 1 2 3 ITEM NO. PART NO. DESCRIPTION QTY. 1 4101359 SHIFT KNOB, JEEP WRANGLER JK, MOLDED 1 2 1794720 JAM NUT, 3/8
Measuring child participation in immunization registries: two national surveys, 2001
Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of
ASSEMBLY INSTRUCTIONS SCALE CIRCLE - STANDARD
ASSEMBLY INSTRUCTIONS ALL COMPONENTS Metal profile 0 mm Gripper Ceiling attachments Screws for ceiling attachements (not included) Wires Metal profile 60 mm Metal profile 00 mm Felt - Full Felt - Half
f(x) =, x 1 by utilizing the guidance given by asymptotes and stationary points. cos(x) sin 3 (x) e sin2 (x) dx,
MÄLARDALEN UNIVERSITY School of Education, Culture and Communication Department of Applied Mathematics Examiner: Lars-Göran Larsson EXAMINATION IN MATHEMATICS MAA151 Single Variable Calculus, TEN2 Date:
Hur fattar samhället beslut när forskarna är oeniga?
Hur fattar samhället beslut när forskarna är oeniga? Martin Peterson m.peterson@tue.nl www.martinpeterson.org Oenighet om vad? 1.Hårda vetenskapliga fakta? ( X observerades vid tid t ) 1.Den vetenskapliga
SVENSK STANDARD SS-ISO 8779:2010/Amd 1:2014
SVENSK STANDARD SS-ISO 8779:2010/Amd 1:2014 Fastställd/Approved: 2014-07-04 Publicerad/Published: 2014-07-07 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 23.040.20; 65.060.35; 83.140.30 Plaströrssystem
Hampaförpackningar Idag och imorgon
Hampaförpackningar Idag och imorgon Lars Sickert Tetra Pak LS/2012-03-28 TP206, JH/0208 1 Today s package portfolio TP106, JH/0208 A systems supplier of Processing solutions Packaging solutions Distribution
Consumer attitudes regarding durability and labelling
Consumer attitudes regarding durability and labelling 27 april 2017 Gardemoen Louise Ungerth Konsumentföreningen Stockholm/ The Stockholm Consumer Cooperative Society louise.u@konsumentforeningenstockholm.se
TTM011 Students in the BSc program Textile engineering
Textile chemistry with environmental chemistry 7.5 ECTS Ladokcode: The exam is given to: TTM011 Students in the BSc program Textile engineering ExamCode: Date of exam: 2016-03-23 Time: 09:00 13:00 Means
Supplementary information for. MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing
Electronic Supplementary Material (ESI) for Lab on a Chip. This journal is The Royal Society of Chemistry 2019 Supplementary information for MATE-Seq: Microfluidic Antigen-TCR Engagement Sequencing Alphonsus
(D1.1) 1. (3p) Bestäm ekvationer i ett xyz-koordinatsystem för planet som innehåller punkterna
Högsolan i Sövde (SK) Tentamen i matemati Kurs: MA4G Linjär algebra MAG Linjär algebra för ingenjörer Tentamensdag: 4-8-6 l 4.-9. Hjälpmedel : Inga hjälpmedel utöver bifogat formelblad. Ej ränedosa. Tentamen
Senaste trenderna från testforskningen: Passar de industrin? Robert Feldt,
Senaste trenderna från testforskningen: Passar de industrin? Robert Feldt, robert.feldt@bth.se Vad är på gång i forskningen? (ICST 2015 & 2016) Security testing Mutation testing GUI testing Model-based
Hållbar utveckling i kurser lå 16-17
Hållbar utveckling i kurser lå 16-17 : Jag tillhör akademin / My position is in the School of Jag tillhör akademin / My position is in the School of Humaniora och medier / Humanities and Media Studies
Självkörande bilar. Alvin Karlsson TE14A 9/3-2015
Självkörande bilar Alvin Karlsson TE14A 9/3-2015 Abstract This report is about driverless cars and if they would make the traffic safer in the future. Google is currently working on their driverless car
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
Item 6 - Resolution for preferential rights issue.
Item 6 - Resolution for preferential rights issue. The board of directors in Tobii AB (publ), reg. no. 556613-9654, (the Company ) has on November 5, 2016, resolved to issue shares in the Company, subject