The effect of metribuzin on the density of proteolytic microorganisms and proteolytic activity in different types of soil
|
|
- Elsa Larsson
- för 6 år sedan
- Visningar:
Transkript
1 Pestic. Phytomed. (Belgrade), 33(3-4), 2018, UDC : : DOI: Original scientific paper The effect of metribuzin on the density of proteolytic microorganisms and proteolytic activity in different types of soil Ljiljana Šantrić*, Ljiljana Radivojević, Marija Sarić-Krsmanović, Jelena Gajić Umiljendić and Rada Đurović-Pejčev Institute of Pesticides and Environmental Protection, Banatska 31b,11080 Belgrade, Serbia *Corresponding author: Received: 3 December 2018 Accepted: 11 December 2018 SUMMARY Soil texture and other physical and chemical characteristics of soil are important factors influencing the retention of herbicides in soil ecosystems. A laboratory experiment was conducted to estimate the response of proteolytic microorganisms to applications of metribuzin in different types of soil (loamy and sandy) in terms of density and protease activity. The following concentrations were tested: 12.0, 24.0, and mg a.i.kg -1 soil. Samples were collected 7,14 and 30 days after treatment with metribuzin. Metribuzin did not affect the number of proteolytic microorganisms in loamy soil. In sandy soil, their number was reduced 26.7% by the highest concentration 7 days after application. Protease activity was reduced in both types of soil on the 7 th and 14 th day and the percentage of reduction was 21% for loamy soil and 29.9% for sandy soil. Statistical analysis of data showed that the correlation between test parameters was positive in both types of soil (r 2 =1 for loamy soil, and r 2 =0.81 for sandy soil). The study shows that metribuzin causes a passable impact on microbial population and enzymatic activity which depends on the type of soil. Keywords: Metribuzin; Soil; Proteolytic microorganisms; Protease Introduction Soil is a complex multiphase and dynamical system, functionally making a system in which various physical, chemical, biochemical and biological processes are continually evolving. These processes are of crucial importance for the functioning of ecosystem (Marhan et al., 2007). Soil type may be the key factor determining the bacterial community and presence of other microorganisms (Girvan et al., 2003). Considering the factors involved in transformation of organic matter, circulation of nutrients, and in creation of soil structure, microorganisms play the key role. Moreover, soil enzymes are important catalysts in biochemical transformations of matter. They are constantly synthetized, accumulated or decomposed, which is of great importance for agricultural production (Deborah, et al., 2013). Proteolytic microorganisms belong to the group of aminoheterotrophs, which require proteins as a source of N. Proteases have an important role in mineralization of nitrogen, making it available to plants and microorganisms. (Caldwell, 2005). Proteolytic activity in soil can be influenced 233
2 Ljiljana Šantrić et al. by various factors, such as organic C concentration, total N concentration, clay content and other soil factors. Some studies suggest that proteolytic activity may be inhibited when the number of proteolytic microorganisms is reduced (Sardans et al., 2008; Baboo et al., 2013). In agricultural practice, herbicide applications have an important place in plant protection. The behavior and destiny of these compounds in soil depend on their chemical and physical properties and on how they interact with biotic and abiotic soil components (Pal et al., 2006; Maqueda et al., 2009). The use of these compounds can influence the number of microorganisms, their composition, as well as their enzymatic activity. The extent to which herbicides will influence microbiological activity depends on the compound itself, the type and composition of soil, as well as microbiological parameters (Zaid et al., 2014). Metribuzin is a herbicide used in the production of potato, soybean, tomato and other crops. Metribuzin is a member of the substituted as-triazinone group of herbicides. Its activity is due to an interference with photosystem II electron transport in plant chloroplasts. This herbicide can affect the balance of microbiological parameters which crucially ensure the fertility and ecosystems of soil (Šantrić et al., 2016). The objective of this paper was to assess the effects of different rates of metribuzin application on certain microbiological variables (number of proteolytic microorganisms and protease activity). Another goal was to compare herbicide effects on the microbial activity in soils with different physical and chemical properties. MATERIALS AND METHODS The herbicide metribuzin (4-amino-6-tert-butyl- 3-(methylthio)-as-triazin-5(4H)-one) tested in the experiment was the product Sencor, manufactured by Bayer, and its rates of application were: 12.0, 24.0, and mg kg -1 soil. The lowest tested concentrations equaled the recommended rates, while the other three were double, 10-fold and 100-fold higher than the recommended rates. The two largest concentrations (10-fold and 100-fold) have been used to assess the potential hazard for microorganisms in soil during undesirable events, such as spilling of pesticides (in this case a herbicide) in high quantities into soil, which may occur through damage of devices used for their application, as well as in transport or industrial accidents (Cycoń & Piotrowska-Seget, 2015). The laboratory experiment was carried out in two agricultural soils. The loamy soil (from Zemun Polje location in Belgrade) and sandy soil (Tavankut) chosen for the study had never been treated with pesticides before. Physico-chemical characteristics of the loamy soil were: sand 49.80%, silt 33.40, clay 16.80, total carbon 2.30%, total nitrogen 0.25%, organic matter 3.96% and ph The properties of the sandy soil were: sand 91.44%, silt 1.32%, clay 7.24%, total carbon 0.53%, total nitrogen 0.06%, organic matter 0.91% and ph According to the WRB (International Union of Soil Sciences, 2015), the former type of soil belongs to the group of chernozems, while the sandy soil is classified into the group of Arenosols. Soil samples were collected from the upper layer (0-10 cm), and were carefully dried, sieved to pass 5 mm mesh, and stored at 4 o C. Before using them, the soil samples were air-dried at room temperature for 24 hours. Each herbicide concentration was pipetted on the surface of 1 kg of soil before homogenization on a rotary stirrer for 30 minutes. After homogenization by mixing, the soil was portioned out in pots. Untreated soil served as a control. The experiments were conducted in four replications. The pots were kept in a controlled-environment chamber at 20±2 o C, 50% air humidity and 12/12 h day/night photoperiod throughtout the experiment. The samples were subsampled for analysis 7, 14 and 30 days after treatment (DAT). Proteolytic microorganisms were counted by a soil dilution plate technique using agar medium supplemented with gelatin. Inoculated agar plates (three replicates) were incubated at 28 o C for 5 days. The counts are presented as the number of microorganisms per 1 gram of dry soil (Jarak & Đurić, 2006). Protease activity was determined by Romeiko s (1969) method. It is based on titrimetric determination of protease activity in gelatin medium. Proteolytic activity of soil was calculated from an applied 4% FeCl 3. Protease activity is expressed as the number of gelatin units per 1 g of air dry soil. Ten gelatin units required 0.2 ml of FeCl 3. Data were statistically processed in Statistica 8.0 software. A two-way analysis of variance was used to compare means of the examined microbial parameters. The LSD test was used to compare treatments and assessments of each parameter when differences in F values were statistically significant (p<0.05). RESULTS AND DISCUSSION The data presented in Figure 1 show that metribuzin caused no statistically significant changes (p>0.05) in the density of proteolytic microorganisms in loamy soil. Their density was minimal (log 4.79) 7 DAT with the highest concentration ( mg a.i.kg -1 soil) and 2.3% lower than the control data. Similarly, proteolytic microorganisms in sandy soil reacted to metribuzin application without a significant change. Their density decreased around 26.7% only 7 DAT with the highest concentration and differences were statistically significant (p<0.05) (Figure 1b). 234
3
4
5 Pestic. Phytomed. (Belgrade), 33(3-4), 2018, However, metribuzin affected the activity of protease both in loamy and sandy soils (Figure 2). A significant decrease in the activity of that enzyme was detected 7 and 14 DAT (p<0.05) in both types of soil. In loamy soil 7 days after metribuzin application (120.0 and mg a.i. kg -1 soil), proteolytic activity was minimal (19.75 gelatin units/g soil), i.e. 21.0% lower than the control data. Also, these concentrations decreased the activity of protease in sandy soil by 29.9% and the minimal value was gelatin units/g soil (Figure 2a). The data in Figure 2b show that metribuzin (1200 mg a.i.kg -1 soil) significantly decreased (p<0.05) proteolytic activity in loamy soil 14 DAT. The minimum recorded value (18.75 gelatin units/g soil) was 20.2% lower than the control. In sandy soil, three concentrations (24, 120 and 1200 mg a.i.kg - 1 soil) significantly decreased the activity of protease (33.8%). The lowest recorded value of proteolytic activity in that soil was gelatin units/g soil. The results presented in Figures 1 and 2 showed that proteolytic activity is a more sensitive parameter than counts of proteolytic microorganisms after metribuzin application. Several studies have shown so far that enzymes are more sensitive parameters than microbial density for detecting changes in microbial populations (Weaver et al., 2004; Abbas et al., 2015). Those research studies noted an inactivation of most soil enzymes due to herbicide attachment to the active site of enzymes, thus preventing substrate attachment to the enzymes. Beilińska and Pranagal (2007) also reported a negative effect of triazine herbicides on the activity of enzymes catalyzing the most essential processes of soil organic matter transformation. This process continues to deepen over the years and is expected to gradually cause humus deficit in soil. However, in a study testing several herbicides (butachlor, pyrozosulfuran, paraquat and glyphosate), Baboo at al. (2013) noticed a trend of increasing protease activity from the 7 th to 28 th day of incubation in all treatments. Šantrić et al., (2014) showed that nicosulfuron caused no statistically significant changes in the number of proteolytic microorganisms in loamy and sandy soil. However, Przybulewska and Taborska (2008) reported that the use of triazine herbicides over many successive years had increased the abundance of proteolytic microorganisms resistant to that group of herbicides. Further statistical analysis (Table 1) revealed a very significant difference in counts of proteolytic microorganisms between the test soils (p<0.01). However, the results showed that the effects of different concentrations of metribuzin on proteolytic microorganism counts were significant only 14 DAT. Statistical analysis also revealed a very significant difference in protease activity between the tested soils (p<0.01). The effects of different metribuzin concentrations on proteolytic activity were very significant (p<0.01) 7 and 14 DAT. There were no statistical differences 30 DAT. The influence that soil texture has both on microbial function and microbial community composition has been examined by many researchers. Soil texture has been shown to be a major contributor to differences in microbial activity and microbial community composition (Banks et al., 2014; Girvan et al., 2003). Correlations between microbial groups and soil enzyme activity may provide information about how microorganism community composition influences the production of enzymes and cycling of specific nutrients. In the present study (Figure 3 and 4), protease activity was positively correlated with proteolytic microorganisms in loamy soil (r 2 =1; p<0.05) and in sandy soil (r 2 =0.81; p<0.05). The results revealed that proteolytic activity could be used as an indicator of the status of soil bacterial com munity, and show that proteases in the test soils were mainly produced by soil bacteria. Also, some Table 1. Two-way ANOVA test revealing the level of significance of interactions between soils and treatments Proteolityc microorgansms Protease activity days F soils p F treatment p F soils p F treatment p Non-significant (p>0.05);* (0.01<p<0.05); ** (p<0.01) 237
6
7 Pestic. Phytomed. (Belgrade), 33(3-4), 2018, ACKNOWLEDGEMENT The study was part of grants TR and III of the Ministry of Education, Science and Technological Development of the Republic of Serbia. REFERENCES Abbas, Z., Akmal, M., Khan, K.S., & Hassan F.U. (2015). Response of soil microorganisms and enzymes activity to application of buctril super (bromoxynil) under rainfed conditions. International Journal of Agriculture & Biology, 17, doi: /j.apsoil Baboo, M., Pasayat, M., Samal, A., Kujur, M., Maharana, J. K., & Patel, A. K. (2013). Effect of four herbicides on soil organic carbon, microbial biomass-c, enzyme activity and microbial populations in agricultural soil. International Journal of Research in Environmental Science and Technology, 3(4), Banks, M.L., Kennedy, A.C., Kremer, R.J., & Eivazi, F. (2014). Soil microbial community response to surfactants and herbicides in two soils. Applied Soil Ecology, 74, doi: /j.apsoil Beilińska, E.J., & Pranagal, J. (2007). Enzymatic activity of soil contaminated with triazine herbicides. Polish Journal of Environmental Studies, 16(2), Caldwell, B.A. (2005). Enzyme activities as a component of soil biodiversity: A review. Pedobiologia, 49(6), doi: /j.pedobi Cycoń, M., & Piotrowska-Seget, Z. (2015). Biochemical and microbial soil functioning after application of the insecticide imidacloprid. Journal Environmental Science, 27, doi: /j.jes Deborah, B.V. Mohiddin, M., & Madhuri, J. (2013). Interaction effets of selected pesticides on soil enzymes. Toxicology International, 20(3), doi: / Girvan, M.S., Bullimore, J., Pretty, J.N., Osborn, A.M., & Ball, A.S. (2003). Soil type is the primary determinant of the composition of the total and active bacterial communities in arable soils. Applied and Environmental Microbiology, 69(3), doi: /aem International Union of Soil Sciences (2015). World reference base for soil resources 2014, update International soil classification system for naming soils and creating legends for soil maps. (World Soil Resources Reports No. 106). Rome, Italy: FAO. Jarak, M. & Đurić, S. (2006). Praktikum iz mikrobiologije (Practicum in microbiology). Novi Sad, Serbia: Faculty of Agriculture. Marhan, S., Kandeler, E., & Scheu, S. (2007). Phospholipid fatty acid profiles and xylanase activity in particle size fractions of forest soil and casts of Lumbricus terrestris L. (Oligochaeta, Lumbricidae). Applied Soil Ecology, 35(2), doi: /j.apsoil Maqueda, C., Villaverde, J., Sopeña, F., Undabeytia, T., & Morillo, E. (2009). Effects of soil characteristics on Metribuzin dissipation using clay-gel based formulations. Journal of Agricultural and Food Chemistry, 57(8), doi: /jf803819q Pal, R., Chakrabarti, K., Chakraborty, A., & Chowdhury, A. (2006). Degradation and effects of pesticides on soil microbiological parameters-a review. International Journal of Agricultural Research, 1(3), Przybulewska, K., & Taborsaka, J. (2008). An attempt to determine the resistence of microorganisms from triazine-contaminated soils. Ecological Chemistry and Engineering S, 15, Romeiko, I.N. (1969). Proteolitičeskaja aktivnost dernogopodzolistaj počvi pri raznih sposobah vspaški. Počvovedenie, 10, Šantrić, Lj., Radivojević, Lj., Gajić Umiljendić, J., Đurović- Pejčev, R. & Sarić-Krsmanović, M. (2014). Assessment of microbial activity and biomass in different soils exposed to nicosulfuron. Pesticides & Phytomedicine, 29(3), doi: /pif Šantrić, Lj., Radivojević, Lj., Gajić Umiljendić, J., Sarić- Krsmanović, M. & Đurović-Pejčev, R. (2016). Effects of herbicides on growth and number of actinomycetes in soil and in vitro. Pesticides & Phytomedicine, 31(3-4), doi: /pif s Sardans, J., Peñuelas, J., & Estiarte, M. (2008). Changes in soil enzymes related to C and N cycle and in soil C and N content under prolonged warming and drought in a Mediterranean shrubland. Applied Soil Ecology, 39, doi: /j.apsoil Sun, J., Zou, L., Li, W., Wang, Y., Xia, Q., & Peng, M. (2018). Soil microbial and chemical properties influenced by continuous cropping of banana. Scentia Agricola, 75(5), Weaver, M.A, Zablotowicz, R.M., & Locke, M.A. (2004). Laboratory assessment of atrazine and fluometuron degradation in soils from a constructed wetland. Chemosphere, 57, doi: /j. chemosphere Zaid, A.M., Mayouf, M., & Farouj, Y.S. (2014). The effects of post-emergance herbicides on soil microflora and nitrogen fixing bacteria in pea field. International Journal of Chemical, Environmental & Biological Sciences, 2(1),
8 Ljiljana Šantrić et al. Efekat metribuzina na broj proteolitičkih mikroorganizama i proteolitičku aktivnost različitih tipova zemljišta REZIME Tekstura zemljišta i druge fizičke i hemijske karakteristike zemljišta predstavljaju važne faktore koji utiču na zadržavanje herbicida u zemljišnim ekosistemima. Postavljen je laboratorijski ogled da bi se procenio odgovor proteolitičkih mikroorganizama i aktivnosti proteaze na primenu metribuzina u različitim tipovima zemljišta (ilovača i peskuša). Ispitivane su sledeće koncentracije. 12,0, 24,0; 120,0 i 1200,0 mg a.s. kg -1 zemljišta. Uzorci su uzeti 7, 14 i 30 dana nakon primene metribuzina. Metribuzin nije uticao na broj proteolitičkih mikroorganizama u ilovači. U peskuši broj je smanjen za 26,7% sedam dana nakon primene najveće koncentracije. Aktivnost proteaze bila je smanjena u oba tipa zemljišta sedmog i četrnaestog dana, u ilovači procenat smanjenja je iznosio 21% a u peskuši 29,9%. Statistička analiza podataka je pokazala da je korelacioni odnos između ispitivanih parametara bio pozitivan za oba tipa zemljišta (za ilovaču r 2 =1; za peskušu r 2 =0,81). Ispitivanja su pokazala da je metribuzin imao prolazni uticaj na mikrobiološku populaciju i enzimatsku aktivnost i zavisio je od tipa zemljišta. Ključne reči: Metribuzin; Zemljište; Proteolitički mikroorganizmi; Proteaza 240
Assessment of microbial activity and biomass in different soils exposed to nicosulfuron
Pestic. Phytomed. (Belgrade), 29(3), 2014, 213 219 UDC 632.954:631.427.2 DOI: 10.2298/PIF1403213S Original scientific paper Assessment of microbial activity and biomass in different soils exposed to nicosulfuron
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP
FORSKNINGSKOMMUNIKATION OCH PUBLICERINGS- MÖNSTER INOM UTBILDNINGSVETENSKAP En studie av svensk utbildningsvetenskaplig forskning vid tre lärosäten VETENSKAPSRÅDETS RAPPORTSERIE 10:2010 Forskningskommunikation
TN LR TT mg/l N b) 2,6-Dimethylphenole
TN LR TT 0.5-14 mg/l N b) 2,6-Dimethylphenole 283 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer
Grass to biogas turns arable land to carbon sink LOVISA BJÖRNSSON
Grass to biogas turns arable land to carbon sink LOVISA BJÖRNSSON Project funding and reporting, Thomas Prade & Mikael Lantz (2016) Grass for biogas - Arable land as carbon sink. Report 2016:280. Energiforsk,
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
TN HR TT b) i) 5-140 mg/l N 2,6-Dimethylphenole 284 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the
Information technology Open Document Format for Office Applications (OpenDocument) v1.0 (ISO/IEC 26300:2006, IDT) SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD SS-ISO/IEC 26300:2008 Fastställd/Approved: 2008-06-17 Publicerad/Published: 2008-08-04 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.30 Information technology Open Document
Isolda Purchase - EDI
Isolda Purchase - EDI Document v 1.0 1 Table of Contents Table of Contents... 2 1 Introduction... 3 1.1 What is EDI?... 4 1.2 Sending and receiving documents... 4 1.3 File format... 4 1.3.1 XML (language
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm
Viktig information för transmittrar med option /A1 Gold-Plated Diaphragm Guldplätering kan aldrig helt stoppa genomträngningen av vätgas, men den får processen att gå långsammare. En tjock guldplätering
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 15 August 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
Measuring child participation in immunization registries: two national surveys, 2001
Measuring child participation in immunization registries: two national surveys, 2001 Diana Bartlett Immunization Registry Support Branch National Immunization Program Objectives Describe the progress of
Kundfokus Kunden och kundens behov är centrala i alla våra projekt
D-Miljö AB bidrar till en renare miljö genom projekt där vi hjälper våra kunder att undersöka och sanera förorenad mark och förorenat grundvatten. Vi bistår dig som kund från projektets start till dess
SWESIAQ Swedish Chapter of International Society of Indoor Air Quality and Climate
Swedish Chapter of International Society of Indoor Air Quality and Climate Aneta Wierzbicka Swedish Chapter of International Society of Indoor Air Quality and Climate Independent and non-profit Swedish
Resultat av den utökade första planeringsövningen inför RRC september 2005
Resultat av den utökade första planeringsövningen inför RRC-06 23 september 2005 Resultat av utökad första planeringsövning - Tillägg av ytterligare administrativa deklarationer - Variant (av case 4) med
Questionnaire on Nurses Feeling for Hospital Odors
J. Japan Association on Odor Environment Vol. -1 No. 0,**0 437 *, ** * * Questionnaire on Nurses Feeling for Hospital Odors Tomoyo ITAKURA*, **, Megumi MITSUDA*, Takuzo INAGAKI*,,/. + +-/ 13.+... + +,,
(Aloe vera L.) Downloaded from jcb.sanru.ac.ir at 20: on Thursday October 24th Liliaceae
71... 1390 /7 / / (Aloe vera L.) 2 2 1..... (Aloe vera L.).... MS (2 ). P (1 ) I (0/25 ) -1-2 90/12/21 : 89/6/22 : IAA (0/1 ) (0/5 0/2 ) Kin (1-0/5 ). I (1 ) (1-0/2 ). 10/66 1/36 (2 ) + Kin (0/5 ) + (2
Manhour analys EASA STI #17214
Manhour analys EASA STI #17214 Presentatör Johan Brunnberg, Flygteknisk Inspektör & Del-M Koordinator Sjö- och luftfartsavdelningen Operatörsenheten Sektionen för teknisk operation 1 Innehåll Anmärkningen
Aborter i Sverige 2008 januari juni
HÄLSA OCH SJUKDOMAR 2008:9 Aborter i Sverige 2008 januari juni Preliminär sammanställning SVERIGES OFFICIELLA STATISTIK Statistik Hälsa och Sjukdomar Aborter i Sverige 2008 januari juni Preliminär sammanställning
TAKE A CLOSER LOOK AT COPAXONE (glatiramer acetate)
TAKE A CLOSER LOOK AT COPAXONE (glatiramer acetate) A TREATMENT WITH HIDDEN COMPLEXITY COPAXONE is a complex mixture of several million distinct polypeptides. 2 State-of-the-art analytics cannot distinguish
Klimatpåverkan och de stora osäkerheterna - I Pathways bör CO2-reduktion/mål hanteras inom ett osäkerhetsintervall
Klimatpåverkan och de stora osäkerheterna - I Pathways bör CO2-reduktion/mål hanteras inom ett osäkerhetsintervall Vi måste förstå att: Vårt klimat är ett mycket komplext system Många (av människan påverkade)
Styrteknik: Binära tal, talsystem och koder D3:1
Styrteknik: Binära tal, talsystem och koder D3:1 Digitala kursmoment D1 Boolesk algebra D2 Grundläggande logiska funktioner D3 Binära tal, talsystem och koder Styrteknik :Binära tal, talsystem och koder
Retention of metals and metalloids in Atleverket treatment wetland Sylvia Waara & Tatsiana Bandaruk
Retention of metals and metalloids in Atleverket treatment wetland 2003-2012 Sylvia Waara & Tatsiana Bandaruk Landfill leachate is different from effluents discharged from STPs In methanogenic stage Very
SWETHRO. Gunilla Pihl Karlsson, Per Erik Karlsson, Sofie Hellsten & Cecilia Akselsson* IVL Svenska Miljöinstitutet *Lunds Universitet
SWETHRO The Swedish Throughfall Monitoring Network (SWETHRO) - 25 years of monitoring air pollutant concentrations, deposition and soil water chemistry Gunilla Pihl Karlsson, Per Erik Karlsson, Sofie Hellsten
The present situation on the application of ICT in precision agriculture in Sweden
The present situation on the application of ICT in precision agriculture in Sweden Anna Rydberg & Johanna Olsson JTI Swedish Institute for Agricultural and Environmental Engineering Objective To investigate
Läkemedelsverkets Farmakovigilansdag 19 maj 2015
Läkemedelsverkets Farmakovigilansdag 19 maj 2015 Incidence and outcome of paracetamol poisoning Rolf Gedeborg Associate Professor, Scientific Director of Epidemiology and Pharmacovigilance Unit for Scientific
Dokumentnamn Order and safety regulations for Hässleholms Kretsloppscenter. Godkänd/ansvarig Gunilla Holmberg. Kretsloppscenter
1(5) The speed through the entire area is 30 km/h, unless otherwise indicated. Beware of crossing vehicles! Traffic signs, guardrails and exclusions shall be observed and followed. Smoking is prohibited
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 05 June 2017, 14:00-18:00. English Version
Kurskod: TAMS28 MATEMATISK STATISTIK Provkod: TEN1 5 June 217, 14:-18: Examiner: Zhenxia Liu (Tel: 7 89528). Please answer in ENGLISH if you can. a. You are allowed to use a calculator, the formula and
Adding active and blended learning to an introductory mechanics course
Adding active and blended learning to an introductory mechanics course Ulf Gran Chalmers, Physics Background Mechanics 1 for Engineering Physics and Engineering Mathematics (SP2/3, 7.5 hp) 200+ students
Grafisk teknik IMCDP IMCDP IMCDP. IMCDP(filter) Sasan Gooran (HT 2006) Assumptions:
IMCDP Grafisk teknik The impact of the placed dot is fed back to the original image by a filter Original Image Binary Image Sasan Gooran (HT 2006) The next dot is placed where the modified image has its
Materialplanering och styrning på grundnivå. 7,5 högskolepoäng
Materialplanering och styrning på grundnivå Provmoment: Ladokkod: Tentamen ges för: Skriftlig tentamen TI6612 Af3-Ma, Al3, Log3,IBE3 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles
CUSTOMER READERSHIP HARRODS MAGAZINE CUSTOMER OVERVIEW. 63% of Harrods Magazine readers are mostly interested in reading about beauty
79% of the division trade is generated by Harrods Rewards customers 30% of our Beauty clients are millennials 42% of our trade comes from tax-free customers 73% of the department base is female Source:
Hållbar utveckling i kurser lå 16-17
Hållbar utveckling i kurser lå 16-17 : Jag tillhör akademin / My position is in the School of Jag tillhör akademin / My position is in the School of Humaniora och medier / Humanities and Media Studies
CHANGE WITH THE BRAIN IN MIND. Frukostseminarium 11 oktober 2018
CHANGE WITH THE BRAIN IN MIND Frukostseminarium 11 oktober 2018 EGNA FÖRÄNDRINGAR ü Fundera på ett par förändringar du drivit eller varit del av ü De som gått bra och det som gått dåligt. Vi pratar om
Goals for third cycle studies according to the Higher Education Ordinance of Sweden (Sw. "Högskoleförordningen")
Goals for third cycle studies according to the Higher Education Ordinance of Sweden (Sw. "Högskoleförordningen") 1 1. Mål för doktorsexamen 1. Goals for doctoral exam Kunskap och förståelse visa brett
Labokha AA et al. xlnup214 FG-like-1 xlnup214 FG-like-2 xlnup214 FG FGFG FGFG FGFG FGFG xtnup153 FG FGFG xtnup153 FG xlnup62 FG xlnup54 FG FGFG
xlnup214 FG-like-1 (aa 443-69) TSVSAPAPPASAAPRSAAPPPYPFGLSTASSGAPTPVLNPPASLAPAATPTKTTSQPAAAATSIFQPAGPAAGSLQPPSLPAFSFSSANNAANASAPSSFPFGA AMVSSNTAKVSAPPAMSFQPAMGTRPFSLATPVTVQAATAPGFTPTPSTVKVNLKDKFNASDTPPPATISSAAALSFTPTSKPNATVPVKSQPTVIPSQASVQP
Rastercell. Digital Rastrering. AM & FM Raster. Rastercell. AM & FM Raster. Sasan Gooran (VT 2007) Rastrering. Rastercell. Konventionellt, AM
Rastercell Digital Rastrering Hybridraster, Rastervinkel, Rotation av digitala bilder, AM/FM rastrering Sasan Gooran (VT 2007) Önskat mått * 2* rastertätheten = inläsningsupplösning originalets mått 2
COPENHAGEN Environmentally Committed Accountants
THERE ARE SO MANY REASONS FOR WORKING WITH THE ENVIRONMENT! It s obviously important that all industries do what they can to contribute to environmental efforts. The MER project provides us with a unique
District Application for Partnership
ESC Region Texas Regional Collaboratives in Math and Science District Application for Partnership 2013-2014 Applying for (check all that apply) Math Science District Name: District Contacts Name E-mail
Vad händer med havsnivån i Stockholms län - vad behöver vi planera för? Sten Bergström SMHI
Vad händer med havsnivån i Stockholms län - vad behöver vi planera för? Sten Bergström SMHI http://www.nasa.gov/topics/earth/features/ temp-analysis-2009.html Årsmedeltemperaturen ( C) i Sverige Baserad
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET
Stiftelsen Allmänna Barnhuset KARLSTADS UNIVERSITET National Swedish parental studies using the same methodology have been performed in 1980, 2000, 2006 and 2011 (current study). In 1980 and 2000 the studies
FaR-nätverk VC. 9 oktober
FaR-nätverk VC 9 oktober 13.30-16.00 Dagens träff Information från oss Material Nytt om FaR-mottagningarna Utbildningar hösten Ny forskning Presentation av flödesschema FaR-rutin på VC med fokus på uppföljning
Grafisk teknik IMCDP. Sasan Gooran (HT 2006) Assumptions:
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015
SVENSK STANDARD SS-EN ISO 19108:2005/AC:2015 Fastställd/Approved: 2015-07-23 Publicerad/Published: 2016-05-24 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 35.240.70 Geografisk information Modell
Maria Fransson. Handledare: Daniel Jönsson, Odont. Dr
Klassificering av allvarlig kronisk parodontit: En jämförelse av fem olika klassificeringar utifrån prevalensen av allvarlig kronisk parodontit i en population från Kalmar län Maria Fransson Handledare:
Här kan du sova. Sleep here with a good conscience
Här kan du sova med rent samvete Sleep here with a good conscience MÅNGA FRÅGAR SIG hur man kan göra en miljöinsats. Det är egentligen väldigt enkelt. Du som har checkat in på det här hotellet har gjort
Klassificering av brister från internaudit
Klassificering av brister från internaudit Del-21G seminarium 2015 Jukka Salo Slou Klassificering av brister från internaudit Vid VK har det visat sig att Procedurer för klassificering av brister finns,
8 < x 1 + x 2 x 3 = 1, x 1 +2x 2 + x 4 = 0, x 1 +2x 3 + x 4 = 2. x 1 2x 12 1A är inverterbar, och bestäm i så fall dess invers.
MÄLARDALENS HÖGSKOLA Akademin för utbildning, kultur och kommunikation Avdelningen för tillämpad matematik Examinator: Erik Darpö TENTAMEN I MATEMATIK MAA150 Vektoralgebra TEN1 Datum: 9januari2015 Skrivtid:
Salmonella control in pig production in Sweden. Helene Wahlström, Zoonosiscenter, SVA
Salmonella control in pig production in Sweden Helene Wahlström, Zoonosiscenter, SVA s ZoonosCenter Historik salmonella Imp. Alvesta 9000 90 1:st 1:st salmonellaregulation SWEDISH SALMONELLA CONTROL PROGRAMMES
MAP Modified Atmosphere Packaging CA Controlled Atmosphere + .* +0 +* +1. MA Modified Atmosphere MA MA
271 MA MA + + +, + : 20-., : /1+. - : --./ 33. 2 + a, MAP Modified Atmosphere Packaging CA Controlled Atmosphere + b + c.* +0 +* +1 +,//*,*** t +,.1-,*** t +, - MA Modified Atmosphere -*/ 20.,, + +, Email
Arbetstillfällen 100 000.
2 3 4 Arbetstillfällen 100 000. 5 6 7 Vissa anspråk ställs I de internationella direktiv och konventioner Sverige antingen är ålagt att följa eller frivilligt valt att följa. Här har jag listat några exempel
Protected areas in Sweden - a Barents perspective
Protected areas in Sweden - a Barents perspective Olle Höjer Swedish Environmental Protection Agency Naturvårdsverket Swedish Environmental Protection Agency 2013-04-03 1 The fundamental framework for
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH
Examensarbete Introduk)on - Slutsatser Anne Håkansson annehak@kth.se Studierektor Examensarbeten ICT-skolan, KTH 2016 Anne Håkansson All rights reserved. Svårt Harmonisera -> Introduktion, delar: Fråga/
Kursplan. JP1040 Japanska III: Språkfärdighet. 15 högskolepoäng, Grundnivå 1. Japanese III: Language Proficiency
Kursplan JP1040 Japanska III: Språkfärdighet 15 högskolepoäng, Grundnivå 1 Japanese III: Language Proficiency 15 Higher Education Credits *), First Cycle Level 1 Mål Efter avslutad kurs ska de studerande
KOL med primärvårdsperspektiv ERS 2014. Björn Ställberg Gagnef vårdcentral
KOL med primärvårdsperspektiv ERS 2014 Björn Ställberg Gagnef vårdcentral Nationella programrådet Astma och KOL Identifierade insatsområden Nationella programrådet Astma och KOLinsatsområden för KOL Diagnostik,
What Is Hyper-Threading and How Does It Improve Performance
What Is Hyper-Threading and How Does It Improve Performance Ali Muthanna, Lunds Universitet, IDA2, EDT621 Abstract Hyper-Threading (HT) is Intel s version of simultaneous multi-threading (SMT). Hyper-Threading
A study of the performance
A study of the performance and utilization of the Swedish railway network Anders Lindfeldt Royal Institute of Technology 2011-02-03 Introduction The load on the railway network increases steadily, and
RADIATION TEST REPORT. GAMMA: 30.45k, 59.05k, 118.8k/TM1019 Condition D
RADIATION TEST REPORT PRODUCT: OP47AYQMLL Die Type: 147X FILE: OP47_LDR.xlsx DATE CODE: 95 GAMMA: 3.45k, 59.5k, 118.8k/TM119 Condition D GAMMA SOURCE: Co6 DOSE RATE: 8.6mRad(si)/s FACILITIES: University
Installation Instructions
Installation Instructions (Cat. No. 1794-IE8 Series B) This module mounts on a 1794 terminal base unit. 1. Rotate keyswitch (1) on terminal base unit (2) clockwise to position 3 as required for this type
2 locations Blackwell and Cherokee Treatment Structure
Brian Arnall 2 locations Blackwell and Cherokee Treatment Structure 1 Check, no starter 2 10-34 34-0 @ 5 gal/ac 10-34 34-0 @ 3gal/ac KTS (potassium thiosulfate)@ 2 3 gal/ac 10-34 34-0 @ 3 gal/ac ATS (ammonia
Vad händer med havsnivån i Stockholms län - vad behöver vi planera för? Signild Nerheim SMHI
Vad händer med havsnivån i Stockholms län - vad behöver vi planera för? Signild Nerheim SMHI Vad händer med havet? Global höjning av vattenståndet i havet 1993-2005 uppmätt med sateliter http://earthobservatory.nasa.gov/iotd/view.php?id=6638
En bild säger mer än tusen ord?
Faculteit Letteren en Wijsbegeerte Academiejaar 2009-2010 En bild säger mer än tusen ord? En studie om dialogen mellan illustrationer och text i Tiina Nunnallys engelska översättning av Pippi Långstrump
Isometries of the plane
Isometries of the plane Mikael Forsberg August 23, 2011 Abstract Här följer del av ett dokument om Tesselering som jag skrivit för en annan kurs. Denna del handlar om isometrier och innehåller bevis för
SVENSK STANDARD SS :2010
SVENSK STANDARD SS 8760009:2010 Fastställd/Approved: 2010-03-22 Publicerad/Published: 2010-04-27 Utgåva/Edition: 2 Språk/Language: svenska/swedish ICS: 11.140 Sjukvårdstextil Sortering av undertrikå vid
Grafisk teknik. Sasan Gooran (HT 2006)
Grafisk teknik Sasan Gooran (HT 2006) Iterative Method Controlling Dot Placement (IMCDP) Assumptions: The original continuous-tone image is scaled between 0 and 1 0 and 1 represent white and black respectively
Methods to increase work-related activities within the curricula. S Nyberg and Pr U Edlund KTH SoTL 2017
Methods to increase work-related activities within the curricula S Nyberg and Pr U Edlund KTH SoTL 2017 Aim of the project Increase Work-related Learning Inspire theachers Motivate students Understanding
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols.
Custom-made software solutions for increased transport quality and creation of cargo specific lashing protocols. ExcelLoad simulates the maximum forces that may appear during a transport no matter if the
DVA336 (Parallella system, H15, Västerås, 24053)
DVA336 (Parallella system, H15, Västerås, 24053) Respondents: 28 Answer Count: 9 Answer Frequency: 32,14 % Teaching methods The teaching methods in the course, that is their practical implementation and
Module 6: Integrals and applications
Department of Mathematics SF65 Calculus Year 5/6 Module 6: Integrals and applications Sections 6. and 6.5 and Chapter 7 in Calculus by Adams and Essex. Three lectures, two tutorials and one seminar. Important
Sara Skärhem Martin Jansson Dalarna Science Park
Sara Skärhem Martin Jansson Dalarna Science Park Sara Skärhem Martin Jansson Vad är innovation? På Wikipedia hittar man: En innovation är en ny idé, till exempel i form av en produkt, lösning, affärsidé,
Iron VARIO PP mg/l Fe g) 1,10-Phenanthroline
Iron VARIO PP 0.02-1.5 mg/l Fe g) 1,10-Phenanthroline 221 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption range
The Municipality of Ystad
The Municipality of Ystad Coastal management in a local perspective TLC The Living Coast - Project seminar 26-28 nov Mona Ohlsson Project manager Climate and Environment The Municipality of Ystad Area:
SVENSK STANDARD SS-ISO :2010/Amd 1:2010
SVENSK STANDARD SS-ISO 14839-1:2010/Amd 1:2010 Fastställd/Approved: 2010-11-08 Publicerad/Published: 2010-11-30 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 01.040.17; 17.160 Vibration och stöt
Windlass Control Panel v1.0.1
SIDE-POWER Windlass Systems 86-08950 Windlass Control Panel v1.0.1 EN Installation manual Behåll denna manual ombord! S Installations manual SLEIPNER AB Kilegatan 1 452 33 Strömstad Sverige Tel: +46 525
The test can be performed on the following devices. In addition, the required cuvette and the absorption range of the photometer are indicated.
Formaldehyde M. TT 0.1-5 mg/l HCHO SO 4 / Chromotropic acid 177 Instrument specific information The test can be performed on the following devices. In addition, the required cuvette and the absorption
Alla Tiders Kalmar län, Create the good society in Kalmar county Contributions from the Heritage Sector and the Time Travel method
Alla Tiders Kalmar län, Create the good society in Kalmar county Contributions from the Heritage Sector and the Time Travel method Goal Bring back the experiences from the international work of Kalmar
Implication of the Selfoss declaration for regeneration
Foryngelse i skogreisingsområder Bergen, Norge, 28.-30. september 2009 Implication of the Selfoss declaration for regeneration Hrefna Jóhannesdóttir Icelandic Forest Research Station NordGen Skog conference
Surfaces for sports areas Determination of vertical deformation. Golvmaterial Sportbeläggningar Bestämning av vertikal deformation
SVENSK STANDARD SS-EN 14809:2005/AC:2007 Fastställd/Approved: 2007-11-05 Publicerad/Published: 2007-12-03 Utgåva/Edition: 1 Språk/Language: engelska/english ICS: 97.220.10 Golvmaterial Sportbeläggningar
Preschool Kindergarten
Preschool Kindergarten Objectives CCSS Reading: Foundational Skills RF.K.1.D: Recognize and name all upper- and lowercase letters of the alphabet. RF.K.3.A: Demonstrate basic knowledge of one-toone letter-sound
DR.B.VIDYA ASSISTANT PROFESSOR DEPARTMRNT OF ANIMAL NUTRITION CVSC, KORUTLA
DR.B.VIDYA ASSISTANT PROFESSOR DEPARTMRNT OF ANIMAL NUTRITION CVSC, KORUTLA INTRODUCTION INDIA- Sheep and Goat play a vital role in rural economy Sheep - 75 million ( FAOSTAT,2012) Goat - 160 million In
Kursplan. EN1088 Engelsk språkdidaktik. 7,5 högskolepoäng, Grundnivå 1. English Language Learning and Teaching
Kursplan EN1088 Engelsk språkdidaktik 7,5 högskolepoäng, Grundnivå 1 English Language Learning and Teaching 7.5 Higher Education Credits *), First Cycle Level 1 Mål Efter genomgången kurs ska studenten
Documentation SN 3102
This document has been created by AHDS History and is based on information supplied by the depositor /////////////////////////////////////////////////////////// THE EUROPEAN STATE FINANCE DATABASE (Director:
Collaborative Product Development:
Collaborative Product Development: a Purchasing Strategy for Small Industrialized House-building Companies Opponent: Erik Sandberg, LiU Institutionen för ekonomisk och industriell utveckling Vad är egentligen
Byggdokument Angivning av status. Construction documents Indication of status SWEDISH STANDARDS INSTITUTE
SVENSK STANDARD Fastställd/Approved: 2008-06-23 Publicerad/Published: 2008-08-04 Utgåva/Edition: 2 Språk/Language: svenska/swedish ICS: 01.100.30; 92.100.20 Byggdokument Angivning av status Construction
State Examinations Commission
State Examinations Commission Marking schemes published by the State Examinations Commission are not intended to be standalone documents. They are an essential resource for examiners who receive training
Rättningstiden är i normalfall 15 arbetsdagar, annars är det detta datum som gäller:
Molekylärbiologi Provmoment: Ladokkod: Tentamen ges för: Tentamen TK151C Bt3 7,5 högskolepoäng TentamensKod: Tentamensdatum: 2016-01-12 Tid: 14:00 18:00 Hjälpmedel: Tillåtna hjälpmedel är lexikon. Dock
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00. English Version
Kurskod: TAIU06 MATEMATISK STATISTIK Provkod: TENA 31 May 2016, 8:00-12:00 Examiner: Xiangfeng Yang (Tel: 070 0896661). Please answer in ENGLISH if you can. a. Allowed to use: a calculator, Formelsamling
Swedish adaptation of ISO TC 211 Quality principles. Erik Stenborg
Swedish adaptation of ISO TC 211 Quality principles The subject How to use international standards Linguistic differences Cultural differences Historical differences Conditions ISO 19100 series will become
Module 1: Functions, Limits, Continuity
Department of mathematics SF1625 Calculus 1 Year 2015/2016 Module 1: Functions, Limits, Continuity This module includes Chapter P and 1 from Calculus by Adams and Essex and is taught in three lectures,
Kursplan. FÖ3032 Redovisning och styrning av internationellt verksamma företag. 15 högskolepoäng, Avancerad nivå 1
Kursplan FÖ3032 Redovisning och styrning av internationellt verksamma företag 15 högskolepoäng, Avancerad nivå 1 Accounting and Control in Global Enterprises 15 Higher Education Credits *), Second Cycle
This exam consists of four problems. The maximum sum of points is 20. The marks 3, 4 and 5 require a minimum
Examiner Linus Carlsson 016-01-07 3 hours In English Exam (TEN) Probability theory and statistical inference MAA137 Aids: Collection of Formulas, Concepts and Tables Pocket calculator This exam consists
ASSESSMENT AND REMEDIATION FOR CHILDREN WITH SPECIAL EDUCATIONAL NEEDS:
ASSESSMENT AND REMEDIATION FOR CHILDREN WITH SPECIAL EDUCATIONAL NEEDS: THE ROLE OF WORKING MEMORY, COMPLEX EXECUTIVE FUNCTION AND METACOGNITIVE STRATEGY TRAINING Avdelningen för psykologi Mittuniversitetet
Hur fattar samhället beslut när forskarna är oeniga?
Hur fattar samhället beslut när forskarna är oeniga? Martin Peterson m.peterson@tue.nl www.martinpeterson.org Oenighet om vad? 1.Hårda vetenskapliga fakta? ( X observerades vid tid t ) 1.Den vetenskapliga
Oförstörande provning (NDT) i Del M Subpart F/Del 145-organisationer
Oförstörande provning (NDT) i Del M Subpart F/Del 145-organisationer Ref. Del M Subpart F & Del 145 2012-05-02 1 Seminarium för Teknisk Ledning HKP 3maj, 2012, Arlanda Inledning Allmänt Viktigare krav
ISO STATUS. Prof. dr Vidosav D. MAJSTOROVIĆ 1/14. Mašinski fakultet u Beogradu - PM. Tuesday, December 09,
ISO 9000 - STATUS Prof. dr Vidosav D. MAJSTOROVIĆ 1/14 1 ISO 9000:2000, Quality management systems - Fundamentals and vocabulary Establishes a starting point for understanding the standards and defines
Why WE care? Anders Lundberg Fire Protection Engineer The Unit for Fire Protection & Flammables Swedish Civil Contingencies Agency
Why WE care? Anders Lundberg Fire Protection Engineer The Unit for Fire Protection & Flammables Swedish Civil Contingencies Agency Assignment Assignment from the Ministry of Defence MSB shall, in collaboration
EXTERNAL ASSESSMENT SAMPLE TASKS SWEDISH BREAKTHROUGH LSPSWEB/0Y09
EXTENAL ASSESSENT SAPLE TASKS SWEDISH BEAKTHOUGH LSPSWEB/0Y09 Asset Languages External Assessment Sample Tasks Breakthrough Stage Listening and eading Swedish Contents Page Introduction 2 Listening Sample
Luftfartsavdelningen Sektionen för flygutbildning MANUALER VÄLKOMNA EN KORT SAMMANFATTNING AV INNEHÅLLET I RESPEKTIVE MANUAL
MANUALER VÄLKOMNA EN KORT SAMMANFATTNING AV INNEHÅLLET I RESPEKTIVE MANUAL 1 TRAINING MANUAL TM OPERATIONS MANUAL OM QUALITY MANUAL QM 2 TRAINING MANUAL AMC1 ORA.ATO.230 (a) PART 0 AMINISTRATION PART A
The Algerian Law of Association. Hotel Rivoli Casablanca October 22-23, 2009
The Algerian Law of Association Hotel Rivoli Casablanca October 22-23, 2009 Introduction WHY the Associations? NGO s are indispensable to the very survival of societal progress Local, National or International
PEC: European Science Teacher: Scientific Knowledge, Linguistic Skills and Digital Media
PEC: Fredagen den 22/9 2006, Forum För Ämnesdidaktik The aim of the meeting A presentation of the project PEC for the members of a research group Forum För Ämnesdidaktik at the University of Gävle. The