Storlek: px
Starta visningen från sidan:




2 , g9(56,.7 g9(5 (86 c7*b5'(5 7,// )g/-' $9 +b1'(/6(51$ '(1 6(37(0%(5 Europeiska unionen har sedan de tragiska händelserna den 11 september agerat snabbt och beslutsamt både inom unionen och på det internationella planet. EU har visat sin solidaritet med USA:s regering och folk och har uttryckt sitt stöd för de militära insatser som inletts. Alla 13 kandidatländerna slöt snabbt upp bakom EU:s ställningstaganden. Kommissionen och rådet har helt inriktat sig på att utarbeta omfattande åtgärder på den diplomatiska, ekonomiska, finansiella, politiska respektive säkerhetsmässiga fronten. Man har hållit ministermöten med USA och ett toppmöte med Ryssland. Ordförande Romano Prodi och premiärminister Guy Verhofstat reste till Washington efter Europeiska rådets extra möte den 21 september. EU-trojkan besökte Pakistan, Iran, Saudiarabien, Egypten och Syrien som en del av unionens samlade insatser för att parallellt med de enskilda medlemsstaternas arbete bygga upp den internationella koalitionen mot terrorism. Europaparlamentet har vid två tillfällen diskuterat situationen och har underbyggt den politiska solidariteten med konkreta åtgärder. Europaparlamentet godkände förslaget till förordning om att spärra tillgångar för organisationer och personer som misstänks stödja eller finansiera terroristverksamhet, bara två dagar efter det att den antogs av kommissionen. Den fullständiga omfattningen av de åtgärder som kommer att vidtas beskrivs i det dokument om EU:s åtgärder med anledning av händelserna den 11 september som antagits av rådet (allmänna frågor). Det är ett "levande" dokument som hela tiden uppdateras. Europeiska unionen har hanterat situationen med stor beslutsamhet och handlingskraft. EU har bidragit till att utforma den nya internationella dagordningen genom att man i nära samarbete har utarbetat ett samlat, enhetligt åtgärdspaket som spänner över en rad olika områden. EU bidrar också till återställa förtroendet och minska den ekonomiska instabiliteten genom att vidta åtgärder för att mildra den oro som medborgarna i dagens och morgondagens medlemsstater känner. 9,/.$Ãc7*b5'(5Ã+$5Ã9,'7$*,76Ã$9Ã(8523(,6.$Ã81,21(1" 6WDELOLVHULQJDYILQDQVPDUNQDGHUQD Europeiska centralbanken (ECB) vidtog omedelbart åtgärder för att säkerställa likviditeten på marknaden efter attentaten och sänkte tillsammans med de andra centralbankerna räntorna med 0,5 % den 17 september. Rådet och Europeiska rådet gjorde dagarna efter den 11 september uttalanden som syftade till att stärka marknadens förtroende.

3 *HPHQVDPVWUDWHJLI UWHUURULVWEHNlPSQLQJ En omfattande handlingsplan har redan godkänts av justitie- och inrikesministrarna, och kommissionen har redan lagt fram förslag till lagstiftning om gemensamma rättsliga ramar i fråga om terrorism (till exempel definition och straffsatser) och en europeisk arresteringsorder som skall ersätta de nationella utlämningsförfarandena. Enighet om att snabbt stärka underrättelse- och polissamarbetet (Europol och Eurojust), både inom EU och med länder utanför EU, särskilt USA. Kommissionen har lagt fram förslag för att stärka säkerhetsinslagen när det gäller det gemensamma visumet. Överväga hur befintlig EU-lagstiftning (till exempel bestämmelser som rör asyl och finansmarknader) kan göras "terroristsäkra". )LQDQVLHULQJDYWHUURULVPVDPWHNRQRPLVNEURWWVOLJKHW Man har i linje med de resolutioner som antagits i FN:s säkerhetsråd i hela EU spärrat tillgångar för personer och organisationer som misstänks ha finansierat eller stött terroristattentaten. Man har påskyndat arbetet med att skapa enighet i fråga om ändringarna i direktivet om penningtvätt. Genom dessa ändringar utvidgas direktivet till att omfatta fler transaktioner och fler yrken med rapporteringsplikt. Arbetet påskyndas när det gäller förslaget till direktiv om marknadsmissbruk, vilket syftar till att förhindra att finansmarknaderna utnyttjas av terroristgrupper eller andra kriminella grupper. Kollegial granskning kommer att utföras av medlemsstaternas finansinspektioner och kommissionen för att granska kandidatländernas åtgärder mot penningtvätt. Denna verksamhet kommer att ingå i den reguljära granskningen av kandidatländernas genomförande av bestämmelserna om finansiella tjänster. Kommissionen kommer att ha en ledande roll när det gäller att stärka den internationella arbetsgruppen )LQDQFLDO $FWLRQ 7DVN )RUFH (FATF), särskilt för att uppdatera dess mandat och nuvarande rekommendationer med beaktande av finansiering av terrorism. Man överväger hur tullkontroller kan utföras med avseende på större kontantförflyttningar över EU:s yttre gränser. Detta kan bli nödvändigt för att komma till rätta med luckorna i lagstiftningen om penningtvätt. +XPDQLWlUWELVWnQG EU har mobiliserat över 314 miljoner euro (varav över 100 miljoner euro från kommissionen) för att underlätta det afghanska folkets situation under de kommande månaderna. Kommissionen anslog omedelbart 5,5 miljoner euro i katastrofbistånd. På begäran av kommissionen har Europaparlamentet och rådet fattat beslut om att frigöra ytterligare 40 miljoner euro för humanitärt bistånd och om att stödja kommissionens begäran om ytterligare 10 miljoner euro. Ytterligare medel kan behövas beroende på hur den internationella situationen utvecklas.

4 Kommissionen har genom Kontoret för humanitärt bistånd (Echo) infört samordningsmekanismer för att det europeiska katastrofbiståndet skall få största möjliga effekt. Ytterligare 6 miljoner euro i livsmedelsbistånd har beviljats Världslivsmedelsprogrammet. /XIWIDUWVVlNHUKHW Kommissionen har lagt fram förslag om en förordning som syftar till att införa enhetliga EU-standarder för luftfartssäkerhet. Ytterligare förslag som rör flygbolagens och flygplatsernas säkerhet kommer att läggas fram mot bakgrund av den rapport från expertgruppen på hög nivå som lades fram för transportministrarna den 16 oktober. Kommissionen har också skisserat åtgärder som kan vidtas för att bistå EU:s flygbolag när det gäller de direkta konsekvenserna av terroristattentaten, bland annat negativ inverkan på passagerarnas förtroende (till exempel högre försäkringspremier, sämre täckning, förlorade intäkter under den tid då USA:s luftrum var stängt samt ökade säkerhetskostnader). Kommissionen kommer att intensifiera sina insatser för att utveckla ett gemensamt transatlantiskt luftrum. Som ett första steg i väntan på ett förhandlingsmandat från rådet kommer kommissionen att arbeta för att tillsammans med USA införa en gemensam uppförandekod som syftar till att skapa lika konkurrensvillkor. För att skärpa de internationella säkerhetsbestämmelserna för flygbolag och flygplatser har man utfärdat rekommendationer till den internationella civilflygorganisationen ICAO som på EU:s initiativ nu kommer att driva frågan vidare. Kollegial granskning av flygplatssäkerheten håller på att organiseras av kommissionen på begäran av Europeiska rådet. Medlemsstaterna verkar dock föga villiga att tillhandahålla inspektörer för denna uppgift. En högnivågrupp tillsätts i samarbete med USA för att samordna åtgärderna när det gäller luftfartssäkerhet och stöd till flygbolagen för att undvika en snedvridning av konkurrensen. 6WlUNWDLQWHUQDWLRQHOODUlWWVOLJDUDPDU Europeiska rådet efterlyste den 21 september ett snabbt genomförande av befintliga konventioner om terrorism och stödde det indiska förslaget om en allmän ramkonvention mot internationell terrorism. Man försöker nu påskynda genomförandet av befintliga FNinstrument i EU:s medlemsstater och i länder utanför EU. Dessa särskilda konventioner måste dock stärkas och kompletteras. EU har en aktiv roll i arbetet med det indiska initiativet, som inleddes i New York den 15 oktober. &LYLOVN\GG Kommissionen aktiverade den 11 september civilskyddsenhetens dygnet-runtsystem för snabbt informationsutbyte. Enheten mobiliserade en rad olika stödområden som skulle erbjudas USA, bland annat räddningspersonal, läkarhjälp, identifieringspersonal och psykologiskt stöd. Medlemsstaternas högsta tjänstemän med ansvar för civilskydd sammanträdde den 12 oktober. De bekräftade att de avser att öka samarbetet mellan de olika myndigheterna när det gäller större terroristattentat, inom ramen för gemenskapens mekanism för civilskydd som bör ha införts senast den 1 januari 2002.

5 +RWIUnQELRORJLVNDRFKHOOHUNHPLVNDDJHQV Kommissionen har inlett arbetet med att utveckla ett EU-system för övervakning och bekämpning av överförbara sjukdomar, bland annat ett system för tidig varning och reaktion. Det finns redan idag gemenskapsbestämmelser för bekämpning av överförbara djursjukdomar, inbegripet sjukdomar som kan överföras till människor. 6lNUDYLNWLJLQIUDVWUXNWXURFKYLNWLJDI UUnG Kommissionen undersöker nu behovet av ett ökat samarbete på EU-nivå för att trygga säkerheten när det gäller viktiga förråd och nätverk. Dessa insatser kompletterar det samråd om förra årets grönbok "Mot en europeisk strategi för trygg energiförsörjning" som snart kommer att ha avslutats. I december kommer rådet att överväga åtgärder för att öka kommunikationsnätverkens säkerhet som uppföljning till kommissionens meddelande från i våras. Händelserna den 11 september har omskapat det utrikespolitiska landskapet och inneburit nya utmaningar för Europeiska unionen. Rådet (allmänna frågor) har redan börjat behandla dessa frågor. Omedelbara åtgärder har vidtagits även multilateralt med avseende på krissituationen i Afghanistan och grannländerna. Kommissionen har förberett några punkter för en bred reflektion på ordförandeskapets initiativ om vilka politiska åtgärder som bör vidtas på medellång respektive lång sikt när det gäller yttre förbindelser. Konsekvenserna kommer att bli omfattande när det gäller åtgärder och resurser på EU-nivå. Det gäller till exempel följande: Krisen ger ny stimulans till GLDORJHQ PHG DUDEYlUOGHQ RFK GHQ PXVOLPVND YlUOGHQ. När det gäller IUHGVSURFHVVHQ L 0HOODQ VWHUQ måste EU i nära samarbete med USA insistera på att Mitchellrapporten genomförs och att parterna får ett mer långsiktigt politiskt perspektiv genom att man återupptar förhandlingarna både på den palestinska och syriska fronten. Krisen är ytterligare en anledning att ge ökad kraft till %DUFHORQDSURFHVVHQ, särskilt när det gäller demokratisering, social rättvisa, uppbyggnad av institutioner samt styrelseformer alla frågor som får ökad betydelse med tanke på det aktuella läget. Detta kommer att bidra till att påskynda och fördjupa de reformer som syftar till att förbättra utvecklingsarbetet och främja demokrati. I (8V SROLWLN I U JUDQQOlQGHUQD har man först och främst strävat efter att främja stabilitet genom att ge kandidatländerna möjlighet att ansluta sig till EU. När det gäller det vidare Europa, bortom EU:s framtida gränser, bör man undersöka nya former för förhållandet som YDUNHQ blir ett "löpande band" på vägen mot medlemskap HOOHU en grund för bittra känslor och spänningar i framtiden mellan den privilegierade medlemskretsen och dem som står utanför. Barcelonaprocessen är ett exempel som visar vad man kan åstadkomma i det här avseendet.

6 Mer generellt bör man stärka ramarna för EU:s handel och samarbete med såväl 3DNLVWDQ,QGLHQoch,UDQsom 6DXGLDUDELHQoch *XOIVWDWHUQD. När det gäller Pakistan har EU godkänt ett omfattande åtgärdspaket för handel, som först lades fram i mars i år. Syftet är att öka Pakistans tillgång till EU som exportmarknad. EU måste fortsätta att se över handeln och samarbetet med Pakistan. När det gäller Iran bör förhandlingarna om framtida handel och samarbete inledas på grundval av ett mandat som kommissionen kommer att lägga fram senare i år. När det gäller Gulfstaterna bör EU se till att snabba resultat uppnås i frihandelsförhandlingarna mellan EU och Gulfstaternas samarbetsråd (ett nytt mandat godkändes nyligen för dessa förhandlingar). Detta bör kompletteras med en bredare politisk dialog. &HQWUDODVLHQ kommer att påverkas starkt av händelseutvecklingen under de kommande månaderna, och EU måste noga bevaka utvecklingen och försöka mobilisera stöd, i synnerhet för regionala projekt och samarbetet i rättsliga och inrikes frågor (särskilt när det gäller narkotika och gränskontroller). Händelserna har också lett till ett förnyat intresse för multilaterala insatser av exempelvis FN. Det har också tydliggjort behovet av snabba resultat när det gäller 9lUOGVKDQGHOVRUJDQLVDWLRQHQ:72. Dessa händelser har visat att man genom samordnade internationella insatser kan uppnå resultat som inte är möjliga för enskilda stater som agerar på egen hand. Det förefaller nu vara ett erkänt faktum att åtgärderna mot internationell terrorism måste stödjas av politiska åtgärder som syftar till att komma till rätta med en rad källor till djupt missnöje som dock aldrig kan motivera terroristattentat. Dessa källor hänger samman med ett odemokratiskt uppträdande hos regeringar, en oacceptabel klyfta mellan fattiga och rika, miljöförstöring, brottslighet, korruption samt frågor som rör narkotika och hälsa. EU har möjlighet att främja ett samarbete när det gäller dessa Q\D WYlUJnHQGH IUnJRU Sn GHQ LQWHUQDWLRQHOOD GDJRUGQLQJHQ, som till exempel fattigdom och migration, miljö, brottslighet, narkotika och smittsamma sjukdomar samt säkerhetsfrågor som rör vapenspridning och terrorism. EU:s bilaterala politiska GLDORJPHGOlQGHUXWDQI U(8, som ofta har inriktats på mänskliga rättigheter och demokrati, måste nu kompletteras med ett mer substantiellt utbyte om regional utveckling och säkerhet, inbegripet terrorism och dess orsaker. Kommissionen anser att den senaste tidens händelser har belyst behovet av att förbättra EU:s krishanteringsförfaranden, bland annat genom att i större utsträckning utnyttja PHNDQLVPHQI UDNXWDLQJULSDQGHQ, som bör fungera med samma snabbhet och flexibilitet som Kontoret för humanitärt bistånd gör på sitt område.

7 Detta arbetsdokument fokuserar därför på de potentiella ekonomiska konsekvenserna av den senaste tidens händelser och innehåller politiska rekommendationer för kommande åtgärder. Det är en första rapport om uppföljningen av händelserna den 11 september. Kommissionen kommer att fortsätta att bevaka situationen och utfärda lämpliga rekommendationer.,, 9,/.$.216(.9(16(5)c5+b1'(/6(51$'(16(37(0%(5)g5(86(.2120, 2&+)g563(&,),.$6(.725(5" 'HQJOREDODHNRQRPLVNDVLWXDWLRQHQI UHGHQVHSWHPEHU En ekonomisk avmattning hade redan känts av i alla viktiga regioner i världen redan före de dramatiska händelserna den 11 september. En av orsakerna är de inflationsdrivande oljeprishöjningarna 1999/2000, som fick centralbankerna att höja räntorna. Dessutom sprack "IT-bubblan", vilket ledde till dramatiska kursfall på aktier. En förvärrande faktor blev därför världshandeln förra årets ökning med 13 % i reella termer sjönk till endast 2 % i år. Dessa chockvågor har spridits snabbt på grund av globaliseringen av finansmarknaderna och internationaliseringen av företagen. Trots starka grundvalar har EU därför inte lyckats undgå den ekonomiska nedgången. Det är särskilt de höjda oljepriserna, som får ännu större genomslagskraft på grund av den svaga euron, och den plötsliga höjningen av de europeiska livsmedelspriserna som har lett till en minsking av den reella disponibla inkomsten och hushållens konsumtion i EU. BNP-tillväxten var nästan obefintlig under andra halvåret I vissa medlemsstater hade nedgången redan börjat påverka sysselsättningen under andra halvåret 2000, med olika effekter för skilda näringsgrenar. Arbetslösheten slutade minska under våren 2001 och har sedan dess åter börjat öka, vilket den förväntas göra under hela Sysselsättningsökningen under 2001 och största delen av 2002 förväntas vara noll eller till och med negativ..ruwvlnwljdhiihnwhudyklqghovhuqdghqvhswhpehu Händelserna den 11 september och den politiska utvecklingen sedan dess förstärker den osäkerhet som marknaderna, företagen och konsumenterna redan hade börjat känna av. Attentaten har tack vare ekonomins storlek endast lett till begränsade direkta skador på USA:s infrastruktur. Den enorma förlusten i människoliv och de pågående militära insatserna har dock skapat en känsla av osäkerhet inte bara i USA, utan i hela världen. Riskundvikandet har ökat, samtidigt som förtroendet har minskat. De flesta observatörer förutser att USA:s ekonomi kommer att krympa under två eller tre kvartal, med början under tredje kvartalet i år.

8 Japan, vars ekonomi präglas av deflation och strukturella problem, står sannolikt inför en längre period av stagnation. EU:s ekonomi har inga större externa obalanser, och strukturreformerna underlättar en snabb återhämtning. Tillväxten förväntas dock bli omkring 1,5 % i år, och en tillfällig krympning av BNP kan inte uteslutas. EU:s möjligheter till en snabb ekonomisk återhämtning illustreras av det faktum att företagens och konsumenternas förtroende, trots den drastiska försämringen, fortfarande ligger på en högre nivå än under tidigare recessioner..rqvhnyhqvhui UVSHFLILNDVHNWRUHU På ILQDQVPDUNQDGHUQD ledde händelserna till betydande men tillfälliga störningar, vilket har resulterat i ökat riskundvikande och potentiellt mindre likviditet och ökad spridning. Som en reaktion på händelserna har centralbanker runt om i världen sänkt räntorna. Både amerikanska Federal Reserve och ECB har sänkt räntorna med en halv procent, och i USA sänktes räntorna på nytt den 1 oktober till den lägsta nivån sedan Nya farhågor förs dock fram i fråga om lönerna, och de lägre aktiekurserna kan ha en betydande inverkan på konsumtionsutgifterna. Följderna blir stora för den globala I UVlNULQJV RFK nwhui UVlNULQJVVHNWRUQ. Ersättningsanspråken beräknas uppgå till totalt miljarder dollar. De faktiska ersättningsanspråken till följd av attentaten betraktas generellt inte som något större problem för den berörda sektorns finansiella situation. Desto allvarligare är konsekvenserna av fallande aktiekurser, som hade lett till vissa problem redan före den 11 september (aktier utgör cirka 30 % av försäkringsbolagens investeringar). Inom OXIWIDUWHQ 1 har antalet passagerare i Europa minskat med 10 %, samtidigt som flygplansflottans kapacitet har skurits ned med 5 % sedan den 11 september. Detta har fått stora konsekvenser för de europeiska flygbolagen, som hade ekonomiska svårigheter redan före attentaten i USA. Minskningen av antalet passagerare och flygplansflottans kapacitet kommer sannolikt att påverka andra närliggande sektorer, men hur stora effekterna blir kommer till stor del att bero på hur länge nedgången varar och på den vidare politiska situationen. Både WXULVWLQGXVWULQRFKUHVPnOHQ kommer sannolikt att påverkas, men effekterna kommer att variera. Bland de hårdast drabbade är charterbolag och resebyråer som säljer resor till utomeuropeiska resmål som påverkats av den senaste tidens händelser, biljetter till långdistansflyg eller inkvartering i hotell av bättre standard i huvudstäder. Det är svårt att säga exakt vilka konsekvenserna kommer att bli och i hur stor utsträckning européerna kommer att välja resmål inom EU istället för mer avlägsna resmål under Meddelande om konsekvenserna för trafikflyget av attentaten i USA, KOM (2001) 574 slutlig,

9 ,,, 876,.7(5)g5 'HW ILQQV I UXWVlWWQLQJDU I U HQ nwhuklpwqlqj XQGHU I UXWVDWW DWW GHQ SROLWLVNDVLWXWDWLRQHQLQWHI UVlPUDV\WWHUOLJDUH De sunda ekonomiska grundvalarna, som till stor del beror på de insatser som gjorts inom ramen för den ekonomiska och monetära unionen och införandet av euron, innebär att det finns förutsättningar för en återhämtning under Medlemsstaternas offentliga finanser medger en viss flexibilitet och betalningsbalansen befinner sig nu i jämvikt. Jämfört med USA har hushållen mindre skulder och ett större sparande. Överinvesteringarna i informations- och kommunikationssektorn (IKT) har heller inte varit lika omfattande, vilket innebär att EU (förutom när det gäller de berörda sektorerna) har ett mindre utsatt läge när det gäller omvälvningarna i Internet- och IKT-världen. Efter en justering nedåt torde företagen kunna återställa sina lagerstockar som förberedelse för en framtida ökad efterfrågan. Den makroekonomiska stabiliteten har också gjort det möjligt att snabbt minska inflationen. Från en topp på 3,4 % i maj minskade inflationen i euroområdet till 2,5 % i september. Inflationen förväntas minska ytterligare. Arbetslöshetsökningen torde förbli begränsad under 2002 tack vare möjligheterna till en återhämtning. Hushållens konsumtion torde därför börja öka igen. Till detta bidrar de skattesänkningar som många medlemsstater har genomfört eller meddelat att de kommer att genomföra under det senaste året. Eftersom reservkapaciteten i ekonomin fortfarande är begränsad och räntorna låga, kommer investeringarna sannolikt att återupptas så snart efterfrågan ökar igen. Den årliga tillväxten 2002 kommer därför sannolikt att motsvara nivån för Argumenten för en försiktig optimism hänger nära samman med den politiska händelseutvecklingen och dess konsekvenser för företagens och konsumenternas förtroende. En radikal minskning av hushållens konsumtion i USA skulle påverka prognoserna för EU i starkt negativ riktning, eventuellt med en ännu svagare tillväxt. Vid utarbetandet av politiska åtgärder bör man dock utgå från det mer sannolika scenariot med en återhämtning från och med andra halvåret 2002 och en tillväxttakt för året som ligger på ungefär samma nivå som 2001.,9 32/,7,6.$5(.200(1'$7,21(5 Mot bakgrund av denna kortfattade analys anser kommissionen att EU måste agera för att mildra de ekonomiska och politiska konsekvenserna av attentaten i USA, främst genom att vidta åtgärder inriktade på att återställa förtroendet och genom att aktivt arbeta för de långsiktiga ekonomiska målen för unionen.

10 ,9 (QEDODQVHUDGSROLWLNL(8 Liksom andra centralbanker ökade ECB omedelbart likviditeten för att stabilisera marknaden och sänkte den 17 september de viktiga styrräntorna med 50 baspunkter till 3,75 %. Den penningspolitiska förutsättningarna förefaller lämpliga med tanke på dagens omständigheter. Om inflationen fortsätter att minska och löneutvecklingen blir måttlig (viktiga löneförhandlingar kommer att inledas i början av nästa år), kommer det troligen att finnas ytterligare handlingsutrymme för penningpolitiken. Skattepolitiken bidrar redan nu till att stabilisera ekonomin. Tack vare stabilitets- och tillväxtpakten har tidigare konsolideringsåtgärder skapat ett visst handlingsutrymme i budgetpolitiken, utan att äventyra målet på medellång sikt att de statliga budgetarna skall balanseras eller visa ett överskott. Att bibehålla detta mål är ett nödvändigt inslag i stimulansåtgärderna annars kan de långfristiga räntorna stiga. I flera medlemsstater gjordes betydande skattesänkningar i början av 2001, vilka motsvarade 0,5 % av BNP för EU som helhet. EU:s ekonomi gavs en övergripande skattemässig stimulans på cirka 0,3 %, för första gången sedan Till detta kommer de "automatiska stabiliseringsfaktorerna". En långsammare tillväxt avspeglas i minskade skatteintäkter och ökade utgifter för staten (till exempel arbetslöshetsförmåner). De senaste prognoserna tyder på en statlig budgetbalans för 2001 på -1 % av BNP i euroområdet och -0,5 % av BNP i EU:s 15 medlemsstater, dvs. ungefär -0,4-0,3 % av BNP lägre än det mål som fastställdes i föregående års uppdaterade stabilitets- och konvergensprogram. Man kommer att känna av budgetkonsekvenserna av den ekonomiska avmattningen även under Om tillväxten vacklar under 2002 kommer de automatiska stabiliseringsfaktorerna åter att spela in, med lämplig differentiering mellan länderna. Med tanke på konsolideringen av budgeten är det viktigt att investera i mänskligt och socialt kapital för att öka EU:s tillväxtpotential. Om den ekonomiska nedgången blir mer långdragen, bör skattepolitiken användas för att öka finansieringen av stimulansåtgärder, särskilt åtgärder som syftar till att man snabbare uppnår målen för Lissabonstrategin. En sådan utveckling är bara möjlig med gemensamt beslutade ramar och med fullt beaktande av stabilitets- och tillväxtpakten.,9 6WUXNWXUUHIRUPHURFK/LVVDERQVWUDWHJLQ I Lissabonstrategin betonas en positiv och ömsesidigt stödjande samverkan mellan ekonomisk politik, sysselsättningspolitik och socialpolitik. Med sin inriktning på att skapa en konkurrenskraftig, dynamisk och kunskapsbaserad ekonomi som präglas av sammanhållning är denna strategi fortfarande giltig. Ekonomiska och arbetsmarknadspolitiska reformer och moderniseringen av socialpolitiken bidrar redan idag till att förbättra det sätt på vilket EU:s ekonomi och arbetsmarknad fungerar. Det är ännu viktigare att fortsätta dessa reformer nu när EU befinner sig i en helt annan ekonomisk situation än vad som var fallet när Lissabonstrategin inleddes.

11 6WUXNWXUUHIRUPHU. Under perioder av ekonomisk nedgång betraktas dessa reformer på medellång sikt alltför ofta som en börda, istället för en del av lösningen på problemen. Näringslivet har uttryckt sina tvivel på politikernas vilja att med tanke på den ekonomiska avmattningen i USA och kortsiktiga valtaktiska överväganden fortsätta med viktiga reformer för att fullborda den inre marknaden, bland annat när det gäller energi, transport och finansiella tjänster, samt för att minska byråkratin. Strukturreformerna behövs nu mer än någonsin. Effektiva finansmarknader med stöd av en robust stabilitetstillsyn kommer att bidra till att göra EU till en stabilitetszon och stärka dess möjligheter att vidta åtgärder för att motverka effekterna av externa chocker. EU kommer då att fullt ut kunna utnyttja de fördelar som euron ger. Sunda och stabila rättsliga ramar är också ytterst viktiga för att man skall kunna hantera de risker för stabiliteten som utvidgningen kan medföra. Vissa faktorer har dock lett till ökade tvivel: arbetet med viktiga förslag som lagts fram för rådet och Europaparlamentet har gått långsamt och redan beslutade åtgärder har inte alltid genomförts på bästa sätt. Med tanke på den aktuella situationen måste EU på nytt bekräfta sitt engagemang när det gäller det långsiktiga målet och de reformer som behövs för att uppnå detta mål. Detta skulle stödja skatte- och penningpolitiken och öka handlingsutrymmet på dessa områden. För att omsätta detta i praktiken bör Europeiska rådet bekräfta sitt åtagande när det gäller att genomföra Lissabonstrategin enligt den beslutade tidtabellen. Detta åtagande måste dock stödjas av snabba resultat när det gäller vissa viktiga åtgärder inför Europeiska rådets möte i Barcelona nästa vår. För att ge en reell och trovärdig signal om EU:s förändringsvilja bör Europeiska rådet be rådet SnVN\QGD DUEHWHW Vn DWW HWW VOXWJLOWLJW JRGNlQQDQGH NDQ QnV I UH (XURSHLVND UnGHWV P WH L %DUFHORQD i fråga om åtgärdspaketet för telekommunikationssektorn, gemenskapspatentet samt, när det gäller finansiella tjänster, direktivet om fondföretag, bestämmelserna om betalningar över gränserna och direktivet om marknadsmissbruk. 3ROLWLVNHQLJKHWE URFNVnQnVI UHP WHWL%DUFHORQDnär det gäller åtgärderna för ett gemensamt europeiskt luftrum, direktivet om pensionsfonder, de nya ramarna för transeuropeiska nätverk samt det föreslagna åtgärdspaketet för offentlig upphandling. Medlemsstaterna måste också öka förtroendet genom att IDNWLVNW WLOOlPSD GH EHVOXWDGH(8EHVWlPPHOVHUQD, till exempel bestämmelserna om ökad konkurrens på lokala telekommunikationsmarknader som trädde i kraft i januari i år och de nya bestämmelserna om e-handel som kommer att träda i kraft i januari En konsekvent tillämpning av dessa bestämmelser i alla medlemsstater skulle främja utvecklingen av en kunskapsbaserad ekonomi. Åtgärderna för att fullborda den inre marknaden måste kombineras med insatser för att öka kvaliteten för allmänheten när det gäller tjänster av allmänt ekonomiskt intresse, som ofta får större betydelse under perioder av ekonomisk nedgång.

12 Europeiska investeringsbanken kan också bidra i betydande utsträckning när det gäller att stödja Lissabonstrategin (se punkt IV.4 nedan). 6\VVHOVlWWQLQJ Lissabonstrategin ger grundläggande riktlinjer som medlemsstaterna bör följa för att nå sysselsättningsmålen och motverka avmattningens konsekvenser för sysselsättningen. Man måste aktivt arbeta för genomförandet av de arbetsmarknadsreformer som diskuterades i Lissabon och anges i de politiska uppföljningsrekommendationerna för I reformarbetet bör de politiska åtgärderna syfta till att hantera förändringar och skapa balans mellan flexibilitet och trygghet. Kommissionen kommer också att före årets slut inleda ytterligare ett initiativ som syftar till att öka arbetskraftens anställbarhet och anpassningsförmåga i samband med fusioner och omstrukturering av företag. Man behöver fortfarande reformera skatte- och förmånssystemen, bedriva en aktiv sysselsättningspolitik, främja rörlighet och investera i mänskligt kapital, särskilt genom livslångt lärande. Det krävs en stark betoning på genomförandet av konkreta åtgärder för att se till att den förda politiken får de förväntade resultaten i form av ökat arbetskraftsdeltagande och ökad sysselsättning. Medlemsstaterna bör inte återgå till att använda förtidspensionering som ett sätt att motverka ökad arbetslöshet. EU måste också se till att åtagandet från Lissabon uppfylls, dvs. att motverka social utslagning och se till att alla får tillgång till arbetsmarknaden och samhället. Moderniseringen av det sociala skyddet och pensionssystemen bör fortsätta i syfte att främja social sammanhållning, trots den ekonomiska nedgången. Man måste därvid beakta behovet av finansiell hållbarhet. Ökade investeringar i livslångt lärande och i hälso- och sjukvård samt stödåtgärder för social integration kan också bidra till att skapa nya arbetstillfällen i sektorer där sysselsättningstillväxten har varit särskilt svag i vissa medlemsstater. Om medlemsstaterna och EU följer dessa politiska riktlinjer, särskilt de som anges i sysselsättningsriktlinjerna för 2002, kommer detta att bidra till att stabilisera förväntningarna och begränsa ökningen av arbetslösheten och långtidsarbetslösheten, samtidigt som arbetskraften förbereds på nästa uppsving i ekonomin. Det kommer att bidra till en anpassning av arbetsmarknadspolitiken i EU.,9 6HNWRUHUVRPGUDEEDWVVlUVNLOWKnUW Det är uppenbart att en rad sektorer som redan börjat känna av den ekonomiska avmattningen före den 11 september har drabbats hårt av dessa händelser. Europeiska unionen måste vara öppen för flexibla sätt att hjälpa dessa sektorer, dock med beaktande av bestämmelserna i EG-fördraget.

13 När det gäller flygbolagen har kommissionen meddelat att man kommer att se positivt på det stöd som medlemsstaterna beviljar som kompensation för de förluster som uppkommit under de fyra dagar då USA:s luftrum var stängt och till följd av den direkta inverkan på passagerarnas förtroende. Man kommer också att överväga att fortsätta stödet för att täcka försäkringskostnader utöver den nuvarande gränsen på 30 dagar eller tillhandahålla sådan täckning fram till slutet av året, om förhållandena på försäkringsmarknaden motiverar detta. Dessutom kommer kommissionen att i varje enskilt fall undersöka hur man bör behandla det ökade samarbetet mellan flygbolagen i syfte att upprätthålla en regelbunden trafik på mindre trafikerade rutter eller införa samordnade tidtabeller under lågtrafikperioder. Den senaste tidens händelser får dock inte utnyttjas för att på nationell nivå vidta åtgärder som leder till minskad konkurrenskraft för EU eller dess näringsliv. När det gäller flygindustrin bör man i synnerhet inte ifrågasätta grunderna för beslutet att tillåta en sista omgång statligt stöd till sektorn. Samtidigt kommer den europeiska flygindustrins situation med tanke på det aktuella läget att bevakas noga. I annat fall riskerar man att förhala den nödvändiga konsolideringen inom en rad viktiga branscher. En sådan konsolidering är viktig om företagen, arbetstagarna och konsumenterna fullt ut skall kunna dra nytta av fördelarna med den inre marknaden och de pågående strukturreformerna. När det gäller krisens ekonomiska konsekvenser för specifika sektorer kommer det också att vara viktigt att bevaka vilka åtgärder som vidtas i andra delar av världen. Ettt ramverk måste införas för att samordna åtgärderna, särskilt med USA, så att det inte leder till någon diskriminering av EU:s företag eller snedvridning av den internationella konkurrensen. En uppförandekod kunde vara ett första steg på väg mot ett sådant ramverk.,9 (XURSHLVNDLQYHVWHULQJVEDQNHQVELGUDJ Europeiska investeringsbanken (EIB) är EU:s främsta källa till långsiktig finansiering. Banken kanaliserar sparande till investeringar i viktiga sektorer i ekonomin, bland annat investeringar i små och medelstora företag. Kommissionen upppmanar Europeiska investeringsbankens att intensifiera sitt arbete för att främja EU:s stödåtgärder för ekonomin i Europa. Man bör särskilt inrikta sig på att tillhandahålla finansiering till infrastrukturprojekt, stödja den kunskapsbaserade ekonomin och bidra till att stabilisera de långsiktiga investeringarna i sektorer som drabbats särskilt hårt av nedgången. Europeiska investeringsbanken bör påskynda genomförandet av infrastrukturprojekt och fortsätta att agera aktivt när det gäller utlåning inom sektorer som drabbats särskilt hårt av ogynnsamma omständigheter, bland annat telekommunikationssektorn och luftfarten. Man bör också påskynda mobiliseringen av instrument som syftar till att finansiera verksamhet med högre risk, bland annat att stödja EU:s satsning på en kunskapsbaserad ekonomi. Genom att ta risker parallellt med den privata banksektorn skulle Europeiska investeringsbanken bidra till att upprätthålla förtroendet i finanssektorn.

14 ,9 ) UWURHQGHVNDSDQGHRFKHNRQRPLVNWVDPDUEHWHSnGHWLQWHUQDWLRQHOODSODQHW )RUWVlWWDDUEHWHWPHGXWYLGJQLQJHQ. EU:s utvidgning är ett kraftfullt instrument för att skapa en stabilitetszon och välstånd på den europeiska kontinenten. Kandidatländernas och medlemsstaternas arbete för att skapa en utvidgad union måste fortsätta, både när det gäller förhandlingar och förberedelser inför anslutningen. Kandidatländernas solidaritet med EU efter attentaten mot USA visar att de är redo att delta i den internationella kampen mot terrorism.,qohgd HQ Q\ I UKDQGOLQJVUXQGD RP YlUOGVKDQGHOQ. En framgångsrik ny förhandlingsrunda i november kommer också att vara en viktig faktor för att skapa förtroende inte bara för företagen inom EU, utan även för industrialiserade länder och utvecklingsländer i hela världen. Den nuvarande ekonomiska osäkerheten innebär att en handelsliberalisering kombinerad med en genuin utvecklingsdimension är viktigare än någonsin, både ekonomiskt och politiskt. EU måste bekräfta sitt åtagande att snabbt inleda en ny förhandlingsrunda och arbeta ännu mer aktivt för multilateralism, samtidigt som man försöker ge ny stimulans till regionala insatser, särskilt Barcelonaprocessen med våra grannländer i Medelhavsområdet. 8WYHFNOLQJRFKIDWWLJGRPVEHNlPSQLQJDe politiska och militära åtgärder som vidtas till följd av händelserna den 11 september måste kombineras med insatser för att komma till rätta med deras ekonomiska och sociala konsekvenser. En koalition mot terrorism måste kompletteras med en koalition för utveckling. Denna koppling är redan ett inslag i EU:s politik för fredsbyggande och konfliktförebyggande. Utvecklingssamarbetet bidrar till att minska etniska, sociala och regionala spänningar. Den senaste tidens händelser har fått stora konsekvenser inom EU, men effekterna kan vara ännu större på andra håll särskilt i utvecklingsländerna. Viktiga orosmoln är långsammare tillväxt i världsekonomin, ett minskat internationellt flöde av privata investeringar och risken att resurser styrs bort från utvecklingsbistånd till andra prioriteringar. Denna händelseutveckling visar att det finns ett behov av åtgärder på EU-nivå för att hjälpa dessa länder och se till att globaliseringen bidrar till tillväxt och social rättvisa i hela världen. EU måste vidta följande åtgärder: Granska prioriteringar och tillgängliga medel för EU:s yttre verksamhet. Hålla avgivna löften och stödja genomförandet för att uppnå de sju främsta internationella utvecklingsmålen för 2015 som beslutats av stats- och regeringscheferna.

15 Ta upp frågan om officiellt utvecklingsbistånd vid den kommande FNkonferensen om finansiering för utveckling (mars 2002). Stödja utvecklingsländerna när det gäller att skapa en hållbar utveckling med tanke på Rio +10-konferensen i Johannesburg i september 2002.,QWHUQDWLRQHOOWUlWWVOLJWRFKSROLVLlUWVDPDUEHWH. Den senaste tidens händelser har gett EU:s internationella perspektiv en ny "säkerhetsdimension". EU måste visa vägen genom att arbeta i ett vidare perspektiv och sträva efter att utarbeta instrument som möjliggör ett effektivt polisiärt och rättsligt samarbete på internationell nivå. En sådan utveckling skulle bidra till kampen mot terrorismen både inom EU och i övriga världen. Det skulle också bidra till att integrera alla länder i ett globalt system med säkerhet, välstånd och bättre framtidsutsikter när det gäller investeringar och utveckling. En utvidgad europeisk konferens för EU, kandidatländerna, Efta-länderna och de länder som ingår i stabiliserings- och associeringsprocessen kommer att hållas på utrikesministernivå omedelbart efter Europeiska rådets möte i Gent. Man kommer att diskutera vissa av dessa frågor som rör säkerhet och rättsligt samarbete när det gäller kampen mot terrorismen. Ryssland, Ukraina och Moldova har dessutom bjudits in till den därpå följande arbetslunchen där samma frågor kommer att diskuteras. +XPDQLWlUWELVWnQG När det gäller situationen i Afghanistan har EU mobiliserat över 310 miljoner euro (varav över 100 miljoner euro från kommissionen) med avseende på den humanitära krisen för den afghanska civilbefolkningen. Dessa resurser kommer tillsammans med medel från USA och andra länder att tillhandahålla en adekvat finansiering av de kommande månadernas humanitära insatser som planeras av FN, Röda korset och Röda halvmånen samt icke-statliga organisationer (även i det värsta scenariot med upp till 1,5 miljoner flyktingar från Afghanistan). EU måste se till att åtagandena snabbt omvandlas till bekräftade bidrag, så att de humanitära insatserna kan stödjas i rätt tid. EU:s humanitära bistånd måste även i fortsättningen styras enbart av de grundläggande humanitära principerna om neutralitet, öppenhet och opartiskhet. Det är nödvändigt för såväl biståndspersonalens som den berörda befolkningens tillträde och säkerhet. Beroende på hur situationen utvecklas inte bara i Afghanistan, utan i hela regionen bör Europeiska unionen vara redo att bidra med ytterligare finansiering, särskilt genom att låta kommissionen använda extra medel ur gemenskapsbudgetens katastrofbiståndsreserv. EU måste också vara vaksam på eventuella humanitära konsekvenser av attentaten i USA i andra "känsliga" delar av världen. Det gäller särskilt de länder som redan befinner sig i en svår politisk och humanitär situation eller har problem med civilt våld. Sådana omständigheter är en grogrund för terroristverksamhet och kan bidra till ytterligare destabilisering. I sådana situationer måste EU visa samma beslutsamhet och handlingskraft på den humanitära fronten, som man idag gör i den afghanska krisen.

16 9 6/876$76(5 Europeiska unionen har vidtagit effektiva och snabba åtgärder för att motverka konsekvenserna av händelserna den 11 september. Nu gäller det att bibehålla kraften bakom EU:s insatser och utarbeta en strategi för att möta de politiska och ekonomiska utmaningar som vi står inför på medellång och lång sikt. Det ekonomiska läget är allvarligt, i synnerhet den exempellösa osäkerhet som råder. Det är därför viktigt att följande viktiga budskap blir vägledande för de åtgärder som EU kommer att vidta: EU står inför en allvarlig situation, men de sunda ekonomiska grundvalarna innebär att EU har goda förutsättningar att klara av krisen. Förutsatt att det politiska klimatet inte försämras ytterligare, finns det anledning till försiktig optimism, med en möjlig återhämtning från och med andra halvåret Det är viktigt att bibehålla dessa goda grundvalar genom att föra en lämplig politik. EU måste i högre grad fokusera på de mål på medellång och lång sikt som fastställs i Lissabonstrategin. Beslut om viktiga förslag som lagts fram för rådet och Europaparlamentet behöver därför fattas före Europeiska rådets möte nästa vår. Händelsernas konsekvenser för enskilda sektorer måste bevakas. Åtgärder som skadar de långsiktiga utsikterna i fråga om tillväxt och konkurrenskraft (särskilt generaliserade stödpaket) måste dock undvikas. Särskild uppmärksamhet måste ägnas åtgärder som syftar till att komma till rätta med de sociala och sysselsättningsmässiga konsekvenserna av det försämrade ekonomiska läget. Europeiska investeringsbanken bör bidra i ökad utsträckning genom utlåning, särskilt för att finansiera infrastrukturprojekt, stödja den kunskapsbaserade ekonomin och bidra till att stabilisera de långsiktiga investeringarna även i sektorer som drabbats särskilt hårt av nedgången. Det är också viktigt att skapa förtroende på det internationella planet. Ett viktigt inslag i detta arbete är en framgångsrik ny förhandlingsrunda om världshandeln. Samtidigt måste EU på bästa sätt utnyttja samarbets- och utvecklingspolitiken, särskilt när det gäller de partnerländer på olika håll i världen som är mer sårbara i det aktuella läget. En koalition mot terrorism måste kompletteras med en koalition för utveckling, som bör EU ta initiativet till. Man måste aktivt arbeta för att genomföra de olika åtgärderna för att utöka samarbetet i kampen mot terrorism och för att skapa ökad säkerhet och ett bättre skydd för EU-medborgarna [enligt definitionen i de riktlinjer som utfärdats av rådet (allmänna frågor samt rättsliga och inrikes frågor)]. Man måste också överväga att vidta ytterligare åtgärder för att uppdatera och anpassa de EUbestämmelser som redan hade införts eller föreslagits före händelserna i USA, till exempel de nya bestämmelserna om penningtvätt eller asylbestämmelser.

17 Man bör snabbt stärka EU:s förmåga att hantera incidenter med biologiska eller kemiska agens som hotar människors hälsa. Utgångspunkten bör vara erfarenheterna med det mycket starkare system för hot mot djurhälsan som redan införts. En omfattande reflektion måste inledas om de politiska och utrikespolitiska åtgärder som EU bör vidta på medellång och lång sikt. Syftet skall vara att stärka de globala styrelseformerna i hela världen för att säkerställa en hållbar och rättvis utveckling samt främja en dialog mellan olika civilisationer. Kommissionen kommer även i fortsättningen att följa och rapportera om händelseutvecklingen och utfärda rekommendationer i enlighet med de bedömningar som görs. Den årliga ekonomiska rapporten och de kommande höstprognoserna bör ge ytterligare möjligheter att bedöma den ekonomiska utvecklingen, eftersom fler tillförlitliga uppgifter om hur företag, marknader och människor har reagerat på händelserna den 11 september blir tillgängliga.


FÖRSLAG TILL YTTRANDE EUROPAPARLAMENTET 2009-2014 Utskottet för utveckling 15.7.2013 2013/0024(COD) FÖRSLAG TILL YTTRANDE från utskottet för utveckling till utskottet för medborgerliga fri- och rättigheter samt rättsliga och

Läs mer

Oberoende årlig tillväxtöversikt för 2013 ECLM-IMK-OFCE

Oberoende årlig tillväxtöversikt för 2013 ECLM-IMK-OFCE Oberoende årlig tillväxtöversikt för 2013 ECLM-IMK-OFCE Sammanfattning Fyra år efter den stora recessionens början befinner sig euroområdet fortfarande i kris. BNP och BNP per capita ligger under nivån

Läs mer

Barnens Rättigheter Manifest

Barnens Rättigheter Manifest Barnens Rättigheter Manifest Barn utgör hälften av befolkningen i utvecklingsländerna. Omkring 100 miljoner barn lever i Europeiska Unionen. Livet för barn världen över påverkas dagligen av EU-politik,

Läs mer

En investeringsplan för Europa

En investeringsplan för Europa En investeringsplan för Europa Den goda triangeln INVESTERINGAR STRUKTUR- REFORMER BUDGETANSVAR 1 En investeringsplan för Europa MOBILISERA FINANSIERING FÖR INVESTERINGAR Kraftigt stöd till strategiska

Läs mer

Vad gör Riksbanken? 2. Att se till att landets export är högre än importen.

Vad gör Riksbanken? 2. Att se till att landets export är högre än importen. Arbetsblad 1 Vad gör Riksbanken? Här följer några frågor att besvara när du har sett filmen Vad gör Riksbanken? Arbeta vidare med någon av uppgifterna under rubriken Diskutera, resonera och ta reda på

Läs mer

5933/4/15 REV 4 ADD 1 SN/cs 1 DPG

5933/4/15 REV 4 ADD 1 SN/cs 1 DPG Europeiska unionens råd Bryssel den 28 april 2015 (OR. en) Interinstitutionellt ärende: 2013/0025 (COD) 5933/4/15 REV 4 ADD 1 RÅDETS MOTIVERING Ärende: EF 26 ECOFIN 70 DROIPEN 14 CRIMORG 16 CODEC 142 PARLNAT

Läs mer

RAPPORT FRÅN KOMMISSIONEN TILL EUROPAPARLAMENTET OCH RÅDET. Översyn av direktiv 94/19/EG om system för garanti av insättningar KOM(2010) 368

RAPPORT FRÅN KOMMISSIONEN TILL EUROPAPARLAMENTET OCH RÅDET. Översyn av direktiv 94/19/EG om system för garanti av insättningar KOM(2010) 368 SV SV SV EUROPEISKA KOMMISSIONEN Bryssel den 12.7.2010 KOM(2010)369 slutlig RAPPORT FRÅN KOMMISSIONEN TILL EUROPAPARLAMENTET OCH RÅDET Översyn av direktiv 94/19/EG om system för garanti av insättningar

Läs mer


FÖRSLAG TILL BETÄNKANDE EUROPAPARLAMENTET 2009-2014 Utskottet för sysselsättning och sociala frågor 29.10.2010 2010/2239(INI) FÖRSLAG TILL BETÄNKANDE om grönboken Med sikte på tillräckliga, långsiktigt bärkraftiga och trygga

Läs mer

Europaparlamentets resolution av den 16 januari 2014 om EU:s strategi mot hemlöshet (2013/2994(RSP))

Europaparlamentets resolution av den 16 januari 2014 om EU:s strategi mot hemlöshet (2013/2994(RSP)) P7_TA-PROV(2014)0043 EU:s strategi mot hemlöshet Europaparlamentets resolution av den 16 januari 2014 om EU:s strategi mot hemlöshet (2013/2994(RSP)) Europaparlamentet utfärdar denna resolution med beaktande

Läs mer


ÄNDRINGSFÖRSLAG 1-30 EUROPAPARLAMENTET 2009-2014 Utskottet för ekonomi och valutafrågor 2010/2027(INI) 9.6.2010 ÄNDRINGSFÖRSLAG 1-30 Ashley Fox (PE441.298v02-00) Den demografiska utmaningen och solidariteten mellan generationerna

Läs mer

EUROPAPARLAMENTET ARBETSDOKUMENT. Utskottet för den inre marknaden och konsumentskydd 11.2.2008

EUROPAPARLAMENTET ARBETSDOKUMENT. Utskottet för den inre marknaden och konsumentskydd 11.2.2008 EUROPAPARLAMENTET 2004 2009 Utskottet för den inre marknaden och konsumentskydd 11.2.2008 ARBETSDOKUMENT om förbättrad konsumentutbildning och höjd medvetenhet när det gäller kredit och finans Utskottet

Läs mer

Kommittédirektiv. Nya regler om åtgärder mot penningtvätt och finansiering av terrorism. Dir. 2014:140

Kommittédirektiv. Nya regler om åtgärder mot penningtvätt och finansiering av terrorism. Dir. 2014:140 Kommittédirektiv Nya regler om åtgärder mot penningtvätt och finansiering av terrorism Dir. 2014:140 Beslut vid regeringssammanträde den 30 oktober 2014 Sammanfattning En särskild utredare ska lämna förslag

Läs mer

Arbetsgrupp för skydd av enskilda med avseende på behandlingen av personuppgifter

Arbetsgrupp för skydd av enskilda med avseende på behandlingen av personuppgifter EUROPEISKA KOMMISSIONEN GENERALDIREKTORAT XV Inre marknad och finansiella tjänster Fri rörlighet för informationstjänster. Bolagsrätt och finansiell information. Fri rörlighet för information, datasäkerhet

Läs mer



Läs mer



Läs mer

Kommittédirektiv. Genomförande av det moderniserade yrkeskvalifikationsdirektivet. Dir. 2013:59. Beslut vid regeringssammanträde den 23 maj 2013

Kommittédirektiv. Genomförande av det moderniserade yrkeskvalifikationsdirektivet. Dir. 2013:59. Beslut vid regeringssammanträde den 23 maj 2013 Kommittédirektiv Genomförande av det moderniserade yrkeskvalifikationsdirektivet Dir. 2013:59 Beslut vid regeringssammanträde den 23 maj 2013 Sammanfattning En särskild utredare ska lämna förslag till

Läs mer

Befintliga strategidokument och utredningar

Befintliga strategidokument och utredningar Bilaga 2 Befintliga strategidokument och utredningar 1.1 EU-nivå 1.1.1 Digital agenda för Europa Syftet är att skapa hållbara ekonomiska och sociala fördelar utifrån en digital inre marknad baserad på

Läs mer


EUROPAPARLAMENTET. Utskottet för framställningar MEDDELANDE TILL LEDAMÖTERNA EUROPAPARLAMENTET 2004 Utskottet för framställningar 2009 21.10.2008 MEDDELANDE TILL LEDAMÖTERNA Angående: Framställning 0995/2002 ingiven av Stylianos Zambetakis (grekisk medborgare) för föreningen för

Läs mer


FÖRSLAG TILL YTTRANDE EUROPAPARLAMENTET 2009-2014 Utskottet för regional utveckling 14.10.2009 2009/0072(CNS) FÖRSLAG TILL YTTRANDE från utskottet för regional utveckling till utskottet för kultur och utbildning över förslaget

Läs mer


FASTIGHETSÄGARNA SVERIGE RÄNTEFOKUS APRIL 2015 LÅNG VÄNTAN PÅ PLUS- RÄNTOR FASTIGHETSÄGARNA SVERIGE RÄNTEFOKUS APRIL 2015 LÅNG VÄNTAN PÅ PLUS- RÄNTOR Sammanfattning Eurozonen växte med drygt 1 procent i årstakt under förra årets sista kvartal. Trots att många såg det som positivt,

Läs mer

Euro ja demokratia Bankunionen Ekonom Hanna Westman, Finlands Bank 1.11.2013

Euro ja demokratia Bankunionen Ekonom Hanna Westman, Finlands Bank 1.11.2013 Euro ja demokratia Bankunionen Ekonom Hanna Westman, Finlands Bank 1.11.2013 Finanskrisens händelser dramatiska, men var de aldrig tidigare skådade? We came very, very close to a global financial meltdown

Läs mer

Väktare av EU:s finanser

Väktare av EU:s finanser SV Väktare av EU:s finanser EUROPEISKA REVISIONSRÄTTEN Granskning av EU-medel i hela världen Europeiska revisionsrätten är en EU institution som grundades 1977 och ligger i Luxemburg. Revisionsrätten har

Läs mer

Aktuella utmaningar i EU-samarbetet och kommissionens prioriteringar. Johan Wullt Chef för media och kommunikation EU-kommissionen i Sverige

Aktuella utmaningar i EU-samarbetet och kommissionens prioriteringar. Johan Wullt Chef för media och kommunikation EU-kommissionen i Sverige Aktuella utmaningar i EU-samarbetet och kommissionens prioriteringar Johan Wullt Chef för media och kommunikation EU-kommissionen i Sverige EU:s främsta utmaningar 1. Ekonomiska situationen 2. Konflikter

Läs mer


FÖRSLAG TILL YTTRANDE EUROPAPARLAMENTET 2009-2014 Budgetutskottet 15.2.2012 2011/0455(COD) FÖRSLAG TILL YTTRANDE från budgetutskottet till utskottet för rättsliga frågor över förslaget till Europaparlamentets och rådets förordning

Läs mer

Den svenska ekonomin enligt regeringens bedömning i 2014 års budgetproposition

Den svenska ekonomin enligt regeringens bedömning i 2014 års budgetproposition Sid 1 (5) Den svenska ekonomin enligt regeringens bedömning i 2014 års budgetproposition Regeringens främsta mål för den ekonomiska politiken är tillväxt och full sysselsättning. Av de 24 miljarder som

Läs mer

Krisen i ekonomin. Roger Mörtvik 2012-02-16

Krisen i ekonomin. Roger Mörtvik 2012-02-16 Krisen i ekonomin Roger Mörtvik 2012-02-16 Krisen utlöstes i september 2008 Investmentfirman Lehman Brothers går omkull vilket blir startskottet på en global finanskris Men grunderna till krisen var helt

Läs mer


EUROPAPARLAMENTET. Budgetutskottet EUROPAPARLAMENTET 1999 Budgetutskottet 2004 8 november 2001 PE 306.835/1-18 ÄNDRINGSFÖRSLAG 1-18 FÖRSLAG TILL BETÄNKANDE av Francesco Turchi (PE 306.835) Transeuropeiska nät - årsrapport 1999 enligt artikel

Läs mer

Det ekonomiska läget. 4 juli Finansminister Anders Borg. Finansdepartementet

Det ekonomiska läget. 4 juli Finansminister Anders Borg. Finansdepartementet Det ekonomiska läget 4 juli Finansminister Anders Borg Det ekonomiska läget Stor internationell oro, svensk tillväxt bromsar in Sverige har relativt starka offentliga finanser Begränsat reformutrymme,

Läs mer

Är finanspolitiken expansiv?

Är finanspolitiken expansiv? 9 Offentliga finanser FÖRDJUPNING Är finanspolitiken expansiv? Budgetpropositionen för 27 innehöll flera åtgärder som påverkar den ekonomiska utvecklingen i Sverige på kort och på lång sikt. Åtgärderna

Läs mer

Kort, aktuellt och lätt om EU. Medfinansieras av EU-kommissionen

Kort, aktuellt och lätt om EU. Medfinansieras av EU-kommissionen Kort, aktuellt och lätt om EU Medfinansieras av EU-kommissionen Europa Direkt Smedjebacken Dalarna / norra Västmanland mars, 2015 Europa Direkt I Sverige finns 19 Europa Direktkontor spridda över hela

Läs mer


ÄNDRINGSFÖRSLAG 1-27 EUROPAPARLAMENTET 2009-2014 Utskottet för sysselsättning och sociala frågor 2009/2171(INI) 8.4.2010 ÄNDRINGSFÖRSLAG 1-27 (PE439.256v01-00) Minskning av fattigdomen och skapande av arbetstillfällen i utvecklingsländerna:

Läs mer

Kort om Europeiska investeringsbanken

Kort om Europeiska investeringsbanken Kort om Europeiska investeringsbanken Som EU:s bank erbjuder vi finansiering och expertkunskaper till solida och hållbara investeringsprojekt i och utanför Europa. Banken ägs av EU:s 28 medlemsstater och

Läs mer

Över 5 miljoner människor i jobb år 2020 2014-06-04

Över 5 miljoner människor i jobb år 2020 2014-06-04 Över 5 miljoner människor i jobb år 2020 2014-06-04 Över 5 miljoner människor i jobb år 2020 Sverige byggs starkt genom fler i arbete. När fler arbetar kan vi fortsätta lägga grund för och värna allt det

Läs mer

Det här är Finansinspektionen FI. Vår vision

Det här är Finansinspektionen FI. Vår vision Vårt uppdrag Det här är Finansinspektionen FI FI är en myndighet som övervakar företagen på finansmarknaden. Riksdag och regering har gett oss i uppdrag att bidra till att det finansiella systemet fungerar

Läs mer

EUROPA 2020 DEN EUROPEISKA TERMINEN. Magnus Astberg Europeiska Kommissionen Representationen i Sverige

EUROPA 2020 DEN EUROPEISKA TERMINEN. Magnus Astberg Europeiska Kommissionen Representationen i Sverige EUROPA 2020 DEN EUROPEISKA TERMINEN Magnus Astberg Europeiska Kommissionen Representationen i Sverige Bakgrund till Europa 2020-strategin och den europeiska planeringsterminen Den europeiska terminen,

Läs mer


ÄNDRINGSFÖRSLAG 1-25 GEMENSAMMA PARLAMENTARISKA AVS EU-FÖRSAMLINGEN Utskottet för politiska frågor AP101.544/AA1-25 12.02.2014 ÄNDRINGSFÖRSLAG 1-25 Förslag till betänkande Medföredragande: Moses Kollie (Liberia) och Zita Gurmai

Läs mer


MARKT/2513/02 SV Orig. EN. UTKAST TILL BESLUT OCH SLUTSATSER VID FÖRSÄKRINGSKOMMITTÉNS 30:e SAMMANTRÄDE MARKT/2513/02 SV Orig. EN UTKAST TILL BESLUT OCH SLUTSATSER VID FÖRSÄKRINGSKOMMITTÉNS 30:e SAMMANTRÄDE Bryssel den 16 april 2002 1. Dagordning Dagordningen för sammanträdet antogs. 2. Protokoll för det

Läs mer

Investment Management

Investment Management Investment Management Konjunktur Räntor och valutor Aktier April 2011 Dag Lindskog +46 70 5989580 dag.lindskog@cim.se Optimistens utropstecken! Bara början av en lång expansionsperiod Politikerna prioriterar

Läs mer

Mer men bättre EU Akavas mål inför EU-valet och den nya kommissionen

Mer men bättre EU Akavas mål inför EU-valet och den nya kommissionen Mer men bättre EU Akavas mål inför EU-valet och den nya kommissionen Rautatieläisenkatu 6 puh. 020 7489 400 00520 Helsinki www.akava.fi 1 (3) Mer men bättre EU 1. Akavas mål inför EU-valet och den nya

Läs mer

Finansinspektionen och makrotillsynen

Finansinspektionen och makrotillsynen ANFÖRANDE Datum: 2015-03-18 Talare: Martin Andersson Möte: Affärsvärldens Bank och Finans Outlook Finansinspektionen Box 7821 SE-103 97 Stockholm [Brunnsgatan 3] Tel +46 8 787 80 00 Fax +46 8 24 13 35

Läs mer


FÖRSLAG TILL YTTRANDE EUROPAPARLAMENTET 2014-2019 Utskottet för utveckling 2014/0059(COD) 7.1.2015 FÖRSLAG TILL YTTRANDE från utskottet för utveckling till utskottet för internationell handel över förslaget till Europaparlamentets

Läs mer

Byggbranschen i Stockholm - en specialstudie

Byggbranschen i Stockholm - en specialstudie 2009 : 2 ISSN 1654-1758 Stockholms Handelskammares analys Byggbranschen i Stockholm - en specialstudie Byggindustrin är en konjunkturkänslig bransch som i högkonjunktur ofta drabbas av kapacitetsbegränsningar

Läs mer

Motion nr 17. Angående terrorismen hotar Sverige. Sofia Ridderstad, Nässjö kommun

Motion nr 17. Angående terrorismen hotar Sverige. Sofia Ridderstad, Nässjö kommun Motion nr 17 Angående terrorismen hotar Sverige Sofia Ridderstad, Nässjö kommun Angående: Terrorismen måste tas på allvar och bekämpas Med dagens säkerhetspolitiska läge måste Sverige agera mot den storskaliga

Läs mer

Företagspolitik i en nordisk kontext

Företagspolitik i en nordisk kontext Företagspolitik i en nordisk kontext 2 FÖRETAGSPOLITIK I EN NORDISK KONTEXT FÖRETAGSPOLITIK I EN NORDISK KONTEXT 3 Alla prognoser visar att tjänstesektorn kommer att fortsätta växa under de kommande åren,

Läs mer

Riktlinjer. Internationellt arbete. Mariestad. Antaget av Kommunfullmäktige Mariestad 2002-05-27

Riktlinjer. Internationellt arbete. Mariestad. Antaget av Kommunfullmäktige Mariestad 2002-05-27 Riktlinjer Internationellt arbete Mariestad Antaget av Kommunfullmäktige Mariestad 2002-05-27 Datum: 2012-02-01 Dnr: Sida: 2 (7) Riktlinjer för internationellt arbete Kommunfullmäktiges beslut 62/02 Bakgrund

Läs mer


FÖRSLAG TILL BETÄNKANDE EUROPAPARLAMENTET 2009-2014 Utskottet för miljö, folkhälsa och livsmedelssäkerhet 2013/2061(INI) 5.9.2013 FÖRSLAG TILL BETÄNKANDE om handlingsplanen för e-hälsa 2012 2020 Innovativ hälsovård för det 21:a

Läs mer

en hållbar framtid Det här vill vi i Centerpartiet med vår politik. Vårt idéprogram i korthet och på lättläst svenska.

en hållbar framtid Det här vill vi i Centerpartiet med vår politik. Vårt idéprogram i korthet och på lättläst svenska. en hållbar framtid Det här vill vi i Centerpartiet med vår politik. Vårt idéprogram i korthet och på lättläst svenska. Centerpartiets idéprogram Det här idéprogrammet handlar om vad Centerpartiet tycker

Läs mer

Samråd om ESP:s manifest inför valet till Europaparlamentet 2009, diskussionsunderlag. Rädda vår planet

Samråd om ESP:s manifest inför valet till Europaparlamentet 2009, diskussionsunderlag. Rädda vår planet Samråd om ESP:s manifest inför valet till Europaparlamentet 2009, diskussionsunderlag Rädda vår planet 1. Utmaningen Idag står Europa inför utmaningen att åstadkomma hållbar utveckling: En utveckling som

Läs mer



Läs mer

Provtenta. Makroekonomi NA0133. Maj 2009 Skrivtid 5 timmar. Kårmedlemskap + legitimation uppvisas vid inlämnandet av tentan.

Provtenta. Makroekonomi NA0133. Maj 2009 Skrivtid 5 timmar. Kårmedlemskap + legitimation uppvisas vid inlämnandet av tentan. Institutionen för ekonomi Våren 2009 Rob Hart Provtenta Makroekonomi NA0133 Maj 2009 Skrivtid 5 timmar. Regler Svara på 5 frågor. (Vid svar på fler än 5 frågor räknar jag 5 genomsnittspoäng per fråga.)

Läs mer


RÄNTEFOKUS JUNI 2014 RIKSBANKS- SÄNKNING GYNNAR KORT BORÄNTA RÄNTEFOKUS JUNI 2014 RIKSBANKS- SÄNKNING GYNNAR KORT BORÄNTA SAMMANFATTNING Återhämtningen i vår omvärld går trögt, i synnerhet i eurozonen där centralbanken förväntas fortsätta att lätta på penningpolitiken.

Läs mer

Finlands Banks strategi

Finlands Banks strategi Finlands Banks strategi Bankavdelningen vid Finlands Bank svarar för genomförandet av ECB:s penningmarknadsoperationer i Finland. Finlands Bank främjar prisstabilitet och finansiell stabilitet, effektivitet

Läs mer

Arbetsprogram för fasta kommittén för allmännyttiga verk. Fråga Vad Hur När

Arbetsprogram för fasta kommittén för allmännyttiga verk. Fråga Vad Hur När EPSU:s fasta kommitté för allmännyttiga verk, 7 april, Luxemburg DAGORDNINGSPUNKT 6 EPSU:s styrelse, Arbetsprogram för fasta kommittén för allmännyttiga verk Med utgångspunkt i kongressresolution R.1.

Läs mer

Den inhemska ekonomin är akilleshälen

Den inhemska ekonomin är akilleshälen Swedbank Östersjöanalys Nr 22 21 December Ryssland Den inhemska ekonomin är akilleshälen Den senaste tidens ekonomiska utveckling i Ryssland har varit positiv. Återhämtningen i energipriserna har stabiliserat

Läs mer


E-HANDEL OCH FINANSIELLA TJÄNSTER. MARKT/2094/01 SV Orig. EN E-HANDEL OCH FINANSIELLA TJÄNSTER MARKT/2094/01 SV Orig. EN Syftet med detta dokument I detta dokument beskrivs den nuvarande situationen beträffande e-handel och finansiella tjänster samt den särskilda

Läs mer

Anförande av Regionkommitténs ordförande Mercedes Bresso. Konferens. Anordnad av ReK och Malmö kommun. Malmö, den 4 oktober 2011 Inledningssession

Anförande av Regionkommitténs ordförande Mercedes Bresso. Konferens. Anordnad av ReK och Malmö kommun. Malmö, den 4 oktober 2011 Inledningssession Ordförandens kansli Bryssel den 3 oktober 2011 GSPI Anförande av Regionkommitténs ordförande Mercedes Bresso Konferens "Mot Rio+20 lokala och regionala åtgärder för en grön ekonomi" Anordnad av ReK och

Läs mer

En kort guide om euron

En kort guide om euron En kort guide om euron Ekonomi och finans Om euron Euron såg dagens ljus 1999, men användes först bara på lönebesked, räkningar och fakturor. Den 1 januari 2002 började eurosedlar och euromynt för första

Läs mer


CATELLA FÖRMÖGENHETSFÖRVALTNING Portföljserie LÅNGSIKTIGT CATELLA FÖRMÖGENHETSFÖRVALTNING - Månadsbrev februari 2012 - VÄRLDEN Det nya börsåret inleddes med en rivstart då världsindex steg med nästan 5% under januari månad. Stockholmsbörsen

Läs mer


FÖRSLAG TILL YTTRANDE EUROPAPARLAMENTET 2009-2014 Utskottet för kvinnors rättigheter och jämställdhet mellan kvinnor och män 30.9.2013 2013/0110(COD) FÖRSLAG TILL YTTRANDE från utskottet för kvinnors rättigheter och jämställdhet

Läs mer

Förhållandet mellan direktiv 98/34/EG och förordningen om ömsesidigt erkännande

Förhållandet mellan direktiv 98/34/EG och förordningen om ömsesidigt erkännande EUROPEISKA KOMMISSIONEN GENERALDIREKTORATET FÖR NÄRINGSLIV Vägledning 1 Bryssel den 1 februari 2010 - Förhållandet mellan direktiv 98/34/EG och förordningen om ömsesidigt erkännande 1. INLEDNING Syftet

Läs mer



Läs mer

Säkerställande av skydd Europeiska unionens riktlinjer om människorättsförsvarare

Säkerställande av skydd Europeiska unionens riktlinjer om människorättsförsvarare Säkerställande av skydd Europeiska unionens riktlinjer om människorättsförsvarare I. SYFTE 1. Stöd till människorättsförsvarare är sedan länge ett inslag i de yttre förbindelserna i Europeiska unionens

Läs mer


ÄNDRINGSFÖRSLAG 12-31 EUROPAPARLAMENTET 2009-2014 Utskottet för regional utveckling 29.10.2009 2009/0072(CNS) ÄNDRINGSFÖRSLAG 12-31 Förslag till yttrande Karima Delli (PE430.326v01-00) över förslaget till rådets beslut om Europeiska

Läs mer


FÖRSLAG TILL BETÄNKANDE EUROPAPARLAMENTET 2014-2019 Utskottet för industrifrågor, forskning och energi 18.3.2015 2014/2210(INI) FÖRSLAG TILL BETÄNKANDE om Familjeföretag i Europa (2014/2210(INI)) Utskottet för industrifrågor,

Läs mer


FÖRSLAG TILL BETÄNKANDE EUROPAPARLAMENTET 2004 Budgetkontrollutskottet 2009 PRELIMINÄR VERSION 2006/2074(DEC) 9.2.2007 FÖRSLAG TILL BETÄNKANDE om ansvarsfrihet för genomförandet av Europeiska unionens allmänna budget för budgetåret

Läs mer


EUROPEISKA GEMENSKAPERNAS KOMMISSION. Förslag till RÅDETS BESLUT SV SV SV EUROPEISKA GEMENSKAPERNAS KOMMISSION Bryssel den 29.10.2009 KOM(2009)608 slutlig Förslag till RÅDETS BESLUT om bemyndigande för Republiken Estland och Republiken Slovenien att tillämpa en åtgärd

Läs mer

Några lärdomar av tidigare finansiella kriser

Några lärdomar av tidigare finansiella kriser Några lärdomar av tidigare finansiella kriser KAPITEL 1 FÖRDJUPNING Hittills har den finansiella orons effekter på börskurser och r äntor på företagsobligationer varit mindre än vid tidigare liknande p

Läs mer

Framtidskontraktet. Avsnitt: Ekonomin växer när människor växer. Version: Beslutad version

Framtidskontraktet. Avsnitt: Ekonomin växer när människor växer. Version: Beslutad version Framtidskontraktet Avsnitt: Ekonomin växer när människor växer Version: Beslutad version Ekonomin växer när människor växer Vi socialdemokrater vill ha ett samhälle som ger välfärd och möjligheter åt alla.

Läs mer

Ekonomiska ramar för budget- och planperioden 2015-2017

Ekonomiska ramar för budget- och planperioden 2015-2017 1 av 5 Kommunstyrelseförvaltningen Jan Lorichs Ekonomichef Kommunstyrelsen Ekonomiska ramar för budget- och planperioden 2015-2017 Förslag till beslut 1. Kommunstyrelsen föreslår att fullmäktige fastställer

Läs mer

I denna policy ska termer och beteckningar ha följande betydelse.

I denna policy ska termer och beteckningar ha följande betydelse. ERSÄTTNINGSPOLICY I denna policy ska termer och beteckningar ha följande betydelse. Betydande risktagare: En anställd vars arbetsuppgifter har en väsentlig inverkan på Bolagets riskprofil. Dessa personer

Läs mer

Det ekonomiska läget och inriktningen för budgetpropositionen

Det ekonomiska läget och inriktningen för budgetpropositionen Det ekonomiska läget och inriktningen för budgetpropositionen Finansminister Magdalena Andersson Harpsund 21 augusti 2015 AGENDA Det ekonomiska läget Världen Sverige Inriktningen för politiken Sammanfattning

Läs mer

Samråd om ESP:s manifest inför valet till Europaparlamentet 2009, diskussionsunderlag. Välfärdens Europa

Samråd om ESP:s manifest inför valet till Europaparlamentet 2009, diskussionsunderlag. Välfärdens Europa Samråd om ESP:s manifest inför valet till Europaparlamentet 2009, diskussionsunderlag 1. Utmaningen Välfärdens Europa Europeiska unionen prisas runtom i världen för dess sociala modell: en grupp välfärdsstater

Läs mer

EUROPEISKA UNIONENS RÅD. Bryssel den 10 december 2010 (13.12) (OR. en) 17769/10 DEVGEN 399 COHAFA 111 ACP 327 RELEX 1100 FIN 730

EUROPEISKA UNIONENS RÅD. Bryssel den 10 december 2010 (13.12) (OR. en) 17769/10 DEVGEN 399 COHAFA 111 ACP 327 RELEX 1100 FIN 730 EUROPEISKA UNIONENS RÅD Bryssel den 10 december 2010 (13.12) (OR. en) 17769/10 DEVGEN 399 COHAFA 111 ACP 327 RELEX 1100 FIN 730 NOT från: Generalsekretariatet till: Delegationerna Föreg. dok. nr: 17477/10

Läs mer

Överenskommelse mellan regeringen och svenska civilsamhällesorganisationer inom Sveriges bistånd

Överenskommelse mellan regeringen och svenska civilsamhällesorganisationer inom Sveriges bistånd Överenskommelse mellan regeringen och svenska civilsamhällesorganisationer inom Sveriges bistånd Överenskommelse mellan regeringen och svenska civilsamhällesorganisationer inom Sveriges bistånd Innehåll

Läs mer

Konjunkturutsikterna 2011

Konjunkturutsikterna 2011 1 Konjunkturutsikterna 2011 Det går bra i vår omgivning. Hänger Åland med? Richard Palmer, ÅSUB Fortsatt återhämtning i världsekonomin men med inslag av starka orosmoment Världsekonomin växer men lider

Läs mer


13 JULI, 2 0 1 5: MAKRO & MARKNAD FRÅN GREKLAND TILL ÅTERHÄMTNING 13 JULI, 2 0 1 5: MAKRO & MARKNAD FRÅN GREKLAND TILL ÅTERHÄMTNING Starten på sommaren blev inte så behaglig. Greklandsoron intensifierades då landet i början av juni fick anstånd med en återbetalning till

Läs mer

MEDDELANDE FRÅN KOMMISSIONEN TILL RÅDET OCH EUROPAPARLAMENTET. Teknisk justering av budgetramen för 2016 för att kompensera för BNI-utvecklingen

MEDDELANDE FRÅN KOMMISSIONEN TILL RÅDET OCH EUROPAPARLAMENTET. Teknisk justering av budgetramen för 2016 för att kompensera för BNI-utvecklingen EUROPEISKA KOMMISSIONEN Bryssel den 22.5.2015 COM(2015) 320 final MEDDELANDE FRÅN KOMMISSIONEN TILL RÅDET OCH EUROPAPARLAMENTET Teknisk justering av budgetramen för 2016 för att kompensera för BNI-utvecklingen

Läs mer


EUROPEISKA GEMENSKAPERNAS KOMMISSION. Förslag till RÅDETS BESLUT SV SV SV EUROPEISKA GEMENSKAPERNAS KOMMISSION Bryssel den 19.2.2009 KOM(2009) 72 slutlig Förslag till RÅDETS BESLUT om den ståndpunkt som Europeiska gemenskapen ska inta i AVS EG-ministerrådet beträffande

Läs mer

Vad handlar eurokrisen om?

Vad handlar eurokrisen om? Vad handlar eurokrisen om? U. Michael Bergman Københavns Universitet Presentation på konferens för undervisere 18 september 2018 Vad är problemet i Europa idag? Statsfinansiell kris i Grekland (stor och

Läs mer

Inkomstpolitiskt program

Inkomstpolitiskt program Inkomstpolitiskt program Inkomstpolitiska programmet / 2008-11-23/25 1 Inledning Löneskillnader påverkar inkomstfördelningen och därmed också fördelning av möjligheter till konsumtion. Till detta kommer

Läs mer

Kommittédirektiv. Utvärdering av Sveriges engagemang i Afghanistan. Dir. 2015:79. Beslut vid regeringssammanträde den 9 juli 2015

Kommittédirektiv. Utvärdering av Sveriges engagemang i Afghanistan. Dir. 2015:79. Beslut vid regeringssammanträde den 9 juli 2015 Kommittédirektiv Utvärdering av Sveriges engagemang i Afghanistan Dir. 2015:79 Beslut vid regeringssammanträde den 9 juli 2015 Sammanfattning En särskild utredare ska utvärdera Sveriges samlade engagemang

Läs mer


ALLMÄNNA FÖRSVARSFÖRENINGEN ÖVERGRIPANDE STRATEGI 2013-2015 ALLMÄNNA FÖRSVARSFÖRENINGEN ÖVERGRIPANDE STRATEGI 2013-2015 Antagen av årsstämman 15 maj 2013 ÖVERGRIPANDE STRATEGI 1. INRIKTNING Allmänna försvarsföreningens uppgift är och har alltid varit att lyfta

Läs mer



Läs mer

Kommissionen främjar europeiska riskkapitalmarknader

Kommissionen främjar europeiska riskkapitalmarknader IP/98/305 Bryssel den 31 mars 1998 Kommissionen främjar europeiska riskkapitalmarknader Europeiska kommissionen har nu inlett ett omfattande initiativ för att främja utvecklingen av en stor alleuropeisk

Läs mer


ÄNDRINGSFÖRSLAG 1-14 EUROPAPARLAMENTET 2014-2019 Budgetutskottet 16.2.2015 2015/2017(BUD) ÄNDRINGSFÖRSLAG 1-14 Förslag till betänkande Liadh Ní Riada (PE546.865v02-00) Utnyttjande av Europeiska fonden för justering för globaliseringseffekter

Läs mer

Rekommendation till RÅDETS REKOMMENDATION. om Sveriges nationella reformprogram 2014,

Rekommendation till RÅDETS REKOMMENDATION. om Sveriges nationella reformprogram 2014, EUROPEISKA KOMMISSIONEN Bryssel den 2.6.2014 COM(2014) 428 final Rekommendation till RÅDETS REKOMMENDATION om Sveriges nationella reformprogram 2014, med avgivande av rådets yttrande om Sveriges konvergensprogram

Läs mer

Plattform för entreprenörskap och social ekonomi ett europaperspektiv i Örebro

Plattform för entreprenörskap och social ekonomi ett europaperspektiv i Örebro Plattform för entreprenörskap och social ekonomi ett europaperspektiv i Örebro Gordon Hahn Jobbar för en organisation som heter Serus och har varit med och tagit fram en plattform för hur man kan jobba

Läs mer


KOMMISSIONENS DELEGERADE FÖRORDNING (EU) nr / av den 17.12.2014 EUROPEISKA KOMMISSIONEN Bryssel den 17.12.2014 C(2014) 9656 final KOMMISSIONENS DELEGERADE FÖRORDNING (EU) nr / av den 17.12.2014 om komplettering av Europaparlamentets och rådets direktiv 2004/109/EG

Läs mer

EUROPAPARLAMENTET. Utskottet för sysselsättning och socialfrågor FÖRSLAG TILL BETÄNKANDE. Utskottet för sysselsättning och socialfrågor

EUROPAPARLAMENTET. Utskottet för sysselsättning och socialfrågor FÖRSLAG TILL BETÄNKANDE. Utskottet för sysselsättning och socialfrågor EUROPAPARLAMENTET 1999 2004 Utskottet för sysselsättning och socialfrågor PRELIMINÄR VERSION 2001/2196(INI) 12 december 2001 FÖRSLAG TILL BETÄNKANDE om Europeiska rådets vårmöte 2002: Lissabonprocessen

Läs mer

Utvecklingen fram till 2020

Utvecklingen fram till 2020 Fördjupning i Konjunkturläget mars 1 (Konjunkturinstitutet) Sammanfattning FÖRDJUPNING Utvecklingen fram till Lågkonjunkturens djup medför att svensk ekonomi är långt ifrån konjunkturell balans vid utgången

Läs mer

Svensk finanspolitik 2013

Svensk finanspolitik 2013 Svensk finanspolitik 2013 Finanspolitiska rådets rapport Pressträff 15 maj, 2013 Rådets uppgift Rådets uppgift är att följa upp och bedöma måluppfyllelsen i finanspolitiken och i den ekonomiska politik

Läs mer

EUROPAPARLAMENTET. Budgetkontrollutskottet

EUROPAPARLAMENTET. Budgetkontrollutskottet EUROPAPARLAMENTET 2004 Budgetkontrollutskottet 2009 8.4.2008 ARBETSDOKUMENT 1 nr 2 om budgetöversynen Godtagbar risk för fel Budgetkontrollutskottet Föredragande: Herbert Bösch 1 Ett arbetsdokument är

Läs mer

EU:s budget från parlamentets förhandlingshorisont - Ett verktyg för gemensamma investeringar i smart, hållbar och inkluderande tillväxt

EU:s budget från parlamentets förhandlingshorisont - Ett verktyg för gemensamma investeringar i smart, hållbar och inkluderande tillväxt EU:s budget från parlamentets förhandlingshorisont - Ett verktyg för gemensamma investeringar i smart, hållbar och inkluderande tillväxt Politiskt instrument för att finansiera långsiktiga prioriteringar

Läs mer

Oordnad upplösning av skuldkrisen i euroområdet alltför kostsam

Oordnad upplösning av skuldkrisen i euroområdet alltför kostsam Konjunkturläget december 2011 33 FÖRDJUPNING Oordnad upplösning av skuldkrisen i euroområdet alltför kostsam I denna fördjupning beskrivs det euroländerna redan gjort för att hantera skuldkrisen i euroområdet

Läs mer


SV 1 SV EUROPEISKA KOMMISSIONEN BRYSSEL DEN 18/11/2013 EUROPEISKA KOMMISSIONEN ALLMÄNNA BUDGETEN - BUDGETÅRET 2013 AVSNITT III KOMMISSIONEN AVDELNING 01, 02, 03, 04, 05, 06, 07, 08, 09, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 25, 26, 27, 28, 29,

Läs mer


EUROPEISKA KOMMISSIONEN EUROPEISKA KOMMISSIONEN Bryssel den 13-05-2003 C(2003)1471fin Ärende: Statligt stöd N 591/2002 - Finland CIRR - system för finansiering av fartyg Herr Minister, (1) Efter att ha granskat de upplysningar

Läs mer

Det aktuella läget i ekonomin och på finansmarknaderna

Det aktuella läget i ekonomin och på finansmarknaderna Det aktuella läget i ekonomin och på finansmarknaderna Erkki Liikanen Mariehamn 24.1.2008 SUOMEN PANKKI FINLANDS BANK BANK OF FINLAND 1 Finlands ekonomiska utveckling Mn EUR Mn EUR 45 000 Real BNP Arbetslöshet

Läs mer

Politik, valutor, krig

Politik, valutor, krig Weekly Market Briefing nr. 4-2013 Politik, valutor, krig Japans valutaförsvagning väcker ont blod...... och pressar våra investeringar i Korea Rapportfloden i USA bjuder på ljusglimtar 1 Alla fonder Skarp

Läs mer