Ekonomi- och verksamhetsstyrning i Sala kommun.

Storlek: px
Starta visningen från sidan:

Download "Ekonomi- och verksamhetsstyrning i Sala kommun."

Transkript

1 Ekonomi- och verksamhetsstyrning i Sala kommun. Ekonomi- och verksamhetsstyrningen definieras som en målmedveten styrprocess vars syfte är att utifrån kända styrprinciper och spelregler påverka organisationens beslut och beteende i riktning mot uppställda mål avseende resultat, effektivitet och ekonomisk ställning. Styrningen innebär dels en styrning mot verksamheternas ekonomiska och verksamhetsmässiga resultat dels en finansiell styrning (ekonomisk ställning). Ekonomi- och verksamhetsstyrningen är en övergripande styrprocess som gäller alla nämnder. Styrningen anger den yttre ramen för ansvars- och frihetsgrader vilka måste kompletteras med ett innehåll i form av spelregler för det nämndsspecifika arbetet. Nämnderna ansvarar för att tydliga spelregler finns för det nämndsspecifika arbetet. Styrande spelregler för kommunens ekonomi- och verksamhetsstyrning fastställs också politiskt i samband med behandlingen av anvisningar inför budgetarbetet, budget och årsredovisning. Dessa är sådana till sin karaktär att de med nödvändighet kan variera. I samband med budget, bokslut och uppföljning utgår också särskilda anvisningar från ekonomikontoret. Ekonomi- och verksamhetsstyrningsprinciperna ingår i kommunens styrsystem som ett av flera fastställda policys och riktlinjer. Delar i detta dokument är hämtade från dessa. Nedan följer, skeenden, förutsättningar och riktlinjer för Resursfördelning, planering Uppföljning och utvärdering Finansiell styrning Resursfördelning, planering Budgetprocess Budgetens formella innehåll och process regleras i kommunallagen. Resursfördelning och planering sker i en fastställd budgetprocess. Budgetprocessen är en process för planering av kommande års verksamhet och ekonomi och är en del i informationen om verksamheter och ekonomi tillsammans med löpande uppföljning och årsredovisning. Sala kommuns verksamheter fastställs i en treårig verksamhetsplan där första året är kommunens ettårsbudget. Budgeten omfattar både drift och investeringsbudget. Förutsättningarna för budgetarbetet fastställs i maj månad då kommunfullmäktige beslutar om visioner, mål och ramar och kommunstyrelsen beslutar om anvisningar inför budgetarbetet. Nämnderna lämnar sina budgetförslag i augusti. Därefter vidtar ett centralt politiskt arbete som resulterar i ett kommunstyrelsebeslut om ettårsbudget och verksamhetsplan i oktober. Kommunfullmäktige fastställer ettårsbudget och verksamhetsplan i november. 1

2 Underlag för beräkning av nämndernas ramar är bokslut och föregående års verksamhetsplan. Finansiellt är utgångspunkten en ekonomi i balans. Särskilda finansiella mål fastställs. Ram- och målstyrning Sala kommun tillämpar ram- och målstyrning. Ramstyrningen är en resursorienterad styrning mot det ekonomiska resultatet. Målstyrningen styr mot önskvärd verksamhet. De ekonomiska ramarna är överordnade målen vilket innebär att nämnderna ska upprätta realistiska budgetar inom givna ramar. Fasta ramar tillämpas vilket innebär att tilläggsanslag beviljas endast i undantagsfall. Driftbudget Nämnd har fullt ansvar för sin verksamhet utifrån givna resurser. Anslagsbindningen kopplas till nettoanslag. Den affärsdrivande verksamheten redovisas som resultatenheter. Nämnd äger rätt att under budgetåret omfördela budgetbeloppen inom sitt anslag. Nämnd ska fastställa budgeten på program, verksamhetsområde. Resurserna ska användas där de bäst behövs för att nå måluppfyllelse. Verksamheterna ska styras utifrån en helhetssyn på ekonomi, prestationer och kvalitet (EPK). Decentralisering av ekonomiskt ansvar ska åtföljas av decentralisering av befogenheter för effektiv resultatuppföljning och utkrävande av ansvar för verksamhet och ekonomi. Nämnderna ska i verksamhetsplanen ange förutsättningarna för uppföljning och utvärdering. Nyckeltal ska där det är lämpligt användas som ett sätt att beskriva verksamheten ur ett uppföljnings- och utvärderingsperspektiv. Investeringar Större investeringsbehov ska fastställas av verksamhetsansvarig nämnd utifrån ett verksamhetsperspektiv. Investeringsbehovet gällande fastigheter ska därefter av fastighetsansvarig nämnd ställas i relation till befintliga tillgängliga verksamhetslokaler. Vid dokumenterat investeringsbehov ska investeringen prövas av kommunstyrelsen som beslutar om eventuella projekteringsmedel i budget. Efter genomförd projektering redovisas medelsbehovet till kommunstyrelsen för bedömning i budgetarbetet. Kommunstyrelsen kan välja att föreslå kommunfullmäktige besluta att lägga in investeringen i verksamhetsplanen (ett till tre år), lägga in investeringen utanför planperioden, anvisa medel i tilläggsbudget eller ompröva investeringen. Anslagen binds till nämnd, förvaltning, verksamhetsområde och objekt beroende på art av investering. Kommunstyrelsen har rätt att omdisponera investeringsanslag. Målbegrepp Kommunen använder målbegreppen visioner, övergripande mål/fokuserade mål, och åtaganden. Visioner sträcker sig längre än planperioden och anger vad kommunen strävar mot för långsiktiga mål inom olika områden. Visionerna formuleras av politiker och fastställs av kommunfullmäktige. 2

3 Övergripande mål beskriver den riktning som kommunen vill arbeta mot över en tid som är relaterad till planperioden på tre år. Målen formuleras av politiker och fastställs av kommunfullmäktige. Fokuserade mål anger vilka områden på vilka speciellt fokus ska sättas under det kommande verksamhetsåret. De fokuserade målen formuleras av politiker och fastställs av kommunfullmäktige. Åtaganden beskriver de konkreta resultat som nämnd ska uppnå per verksamhetsområde. Åtagandena framtas av nämnd i dialog med förvaltning. Åtagandena fastställs av kommunfullmäktige. Uppföljning och utvärdering Kommunens uppföljning sker genom löpande uppföljning, delårsrapport och årsredovisning. Löpande uppföljning Nämnderna ansvarar för sin uppföljning av ekonomi och verksamhet under året. Kommunens löpande uppföljning sker månadsvis februari till och med maj. Uppehåll från den månatliga uppföljningen sker under juni och juli De månadsvisa uppföljningarna återupptas från och med augusti och pågår till och med november. December behandlas i den ordinarie bokslutshanteringen. Uppföljningarna behandlas av arbetsutskottet, kommunstyrelsen respektive månad. I juni månad lämnas en uppföljningsrapport om ekonomi och verksamhet till kommunfullmäktige. Uppföljningsrapporterna ska innehålla Ekonomisk kommentar o Avvikelse, tkr o orsak till avvikelse o Mål och åtagandekommentar o Åtgärd inklusive tidplan o Eventuell övrig kommentar Förutom att vara ett instrument för uppföljningen i sig ska uppföljningen verka för att tydliggöra kommunstyrelsens roll som övergripande ansvarig för den kommunala verksamheten tydliggöra nämndernas ansvar för den egna verksamheten stödja dialogen mellan nämnderna och kommunstyrelsen Delårsrapport Delårsrapportens hantering regleras i lagen om kommunal redovisning. Delårsrapport är en enklare variant av årsbokslutet och en prognos för verksamhetens utfall för hela året och ska i princip ha samma utformning som årsredovisningen. Enligt lagen ska minst en delårsrapport lämnas till kommunfullmäktige. Delårsrapporten ska omfatta en period av minst hälften och högst två tredjedelar av räkenskapsåret. Kommunen tar fram en delårsrapport med helårsprognos per den sista juli. Nämnderna lämnar underlag till delårsrapporten i augusti. Kommunstyrelsen fattar beslut om delårsrapporten i september och kommunfullmäktige i oktober. 3

4 Årsredovisning Årsredovisningen regleras i kommunallagen och i lagen om kommunal redovisning. Årsredovisningen skall vara en redogörelse av utfallet av verksamheten, verksamhetens finansiering och den ekonomiska ställningen vid årets slut. För att uppfylla detta ska i årsredovisningen ingå förvaltningsberättelse resultaträkning balansräkning finansieringsanalys sammanställd redovisning som omfattar kommunal verksamhet som bedrivs genom annan juridisk person. Nämnderna lämnar sina bokslut i mitten av februari. Därefter vidtar ett politiskt arbete som resulterar i ett förslag till årsredovisning av kommunstyrelsen i mars, april. Kommunfullmäktige fastställer årsredovisningen i april. I samband med bokslutet regleras över- och underskott i särskilt tilläggsbudgetbeslut för kommande år. Finansiell styrning Grundläggande för den finansiella styrningen är att kommunen ska ha en god ekonomisk hushållning. Begreppet god ekonomisk hushållning regleras i kommunallagen och lagen om kommunal redovisning. Sala kommun ska uppfylla kravet på god ekonomisk hushållning genom att i normalfallet ha ett rimligt överskott både i den budgeterade resultaträkningen som i bokslutet. För verksamheten ska anges mål och riktlinjer som är av betydelse för en god ekonomisk hushållning. För att skapa och bibehålla en ekonomi i balans, god ekonomisk hushållning ska finansiella mål fastställas. De finansiella målen är: Resultatmål, årets resultat i relation till skatteintäkter, statsbidrag och utjämning. Nettokostnadsandel, nettokostnadernas andel av skatteintäkter, statsbidrag och utjämning. Soliditet, relationen eget kapital till de totala tillgångarna. Investeringar, ska huvudsakligen finansieras med egna medel. Policydokument, riktlinjer inom ekonomiområdet Förutom detta dokument finns politiskt beslutade dokument med relativt hög detaljeringsnivå som påverkar kommunens ekonomiska hantering. Delar av dessa dokument finns relaterade i detta dokument. Dokumenten äger fortfarande sin giltighet till de delar som inte berörts i detta dokument. Reglemente för kontroll av ekonomiska transaktioner Policy för penninghantering för Sala kommun 4

5 Riktlinjer kravhantering Riktlinjer borgensåtagande Upphandlingspolicy för Sala kommun Uppföljningsmodell för Sala kommun 5

Styrprinciper för Dals-Eds kommun.

Styrprinciper för Dals-Eds kommun. Styrprinciper för Dals-Eds kommun. Inledning Styrprinciperna reglerar ansvarsfördelningen i Dals-Eds kommun. Utgångspunkt för arbetet utifrån styrprinciperna ska vara decentralisering, helhetssyn och god

Läs mer

Ekonomipolicyn definierar principerna för hanteringen av ekonomistyrning och redovisning i Skövde kommun.

Ekonomipolicyn definierar principerna för hanteringen av ekonomistyrning och redovisning i Skövde kommun. Innehåll Inledning... 3 Syfte med ekonomipolicyn... 3 Ekonomi- och verksamhetsstyrning... 3 Anslagsbindningsnivå... 4 Kommunfullmäktige... 4 Kommunstyrelsen... 4 Nämnden... 5 Resultatenhet... 5 Balansräkningsenhet...

Läs mer

Granskning av delårsrapport 2008

Granskning av delårsrapport 2008 Revisionsrapport Granskning av delårsrapport 2008 Smedjebackens kommun September 2008 Robert Heed Innehållsförteckning 1. Inledning... 2 1.1 Uppdrag och ansvarsfördelning... 2 1.2 Kommunfullmäktiges mål

Läs mer

Revisionsrapport* Granskning av. Delårsrapport Vännäs kommun. September Allan Andersson Therese Runarsdotter. *connectedthinking

Revisionsrapport* Granskning av. Delårsrapport Vännäs kommun. September Allan Andersson Therese Runarsdotter. *connectedthinking Revisionsrapport* Granskning av Delårsrapport 2007 Vännäs kommun September 2007 Allan Andersson Therese Runarsdotter *connectedthinking Innehållsförteckning 1. Sammanfattning och förslag till åtgärder...2

Läs mer

Lednings- och styrdokument FINANS. Styrdokument antaget av kommunfullmäktige den 20 juni 2011

Lednings- och styrdokument FINANS. Styrdokument antaget av kommunfullmäktige den 20 juni 2011 Lednings- och styrdokument FINANS Styrdokument antaget av kommunfullmäktige den 20 juni 2011 2012-2015 sidan 1 av 6 God ekonomisk hushållning... 2 Vara kommuns definition... 2 Verksamhetsperspektiv...

Läs mer

Redovisningsreglemente

Redovisningsreglemente Redovisningsreglemente Dokumentnamn Dokumenttyp Fastställd/upprättad Beslutsinstans Redovisningsreglemente Reglemente 2014-06-16, 94 Kommunfullmäktige Dokumentansvarig/processägare Version Senast reviderad

Läs mer

Delårsrapport 31 augusti 2011

Delårsrapport 31 augusti 2011 Datum 29 september 2011 Till Revisionen Från Susanne Svensson Angående Granskning av delårsrapport 31 augusti 2011 1 Inledning 1.1 Syfte På uppdrag av de förtroendevalda revisorerna har vi översiktligt

Läs mer

Söderhamns kommun. Granskning av delårsrapport per den 31 augusti Revisionsrapport. KPMG 11 oktober 2006 Antal sidor 9

Söderhamns kommun. Granskning av delårsrapport per den 31 augusti Revisionsrapport. KPMG 11 oktober 2006 Antal sidor 9 Granskning av delårsrapport per den 31 augusti 2006 KPMG 11 oktober 2006 Antal sidor 9 Innehåll 1. Sammanfattning 1 2. Bakgrund 1 3. Ansvarsavgränsning 2 4. Granskning 2 5. Revisionsmål 3 6. Granskningens

Läs mer

Reglemente för ekonomistyrning i Härnösands kommun

Reglemente för ekonomistyrning i Härnösands kommun Kommunstyrelseförvaltningen REGLEMENTE Reglemente för ekonomistyrning i Härnösands kommun Dokumentnamn Fastställd/upprättad av Dokumentansvarig/processägare Reglemente för ekonomistyrning i Härnösands

Läs mer

Riktlinjer för god ekonomisk hushållning

Riktlinjer för god ekonomisk hushållning Kommunstyrelsen 2016-11-02 Kommunledningskontoret Ekonomi och kvalitet KSKF/2016:583 Lars-Göran Hellquist 016-710 27 79 1 (2) Kommunstyrelsen Riktlinjer för god ekonomisk hushållning Förslag till beslut

Läs mer

Granskning av delårsrapport 2016

Granskning av delårsrapport 2016 Granskningsrapport Conny Erkheikki Granskning av delårsrapport 2016 Gällivare kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte, revisionsfrågor och avgränsning

Läs mer

Policy för verksamhets- och ekonomistyrning. Policy för verksamhetsoch ekonomistyrning. för Falköpings kommun

Policy för verksamhets- och ekonomistyrning. Policy för verksamhetsoch ekonomistyrning. för Falköpings kommun Policy för verksamhetsoch ekonomistyrning för Falköpings kommun Innehållsförteckning 1. Inledning 3 2. Syfte 3 3. Styrmodellen 4 4. Anslagningsbindningsnivå 4 4.1 Kommunfullmäktige 5 4.2 Kommunstyrelse

Läs mer

Riktlinjer för uppföljning. Motala kommun

Riktlinjer för uppföljning. Motala kommun Riktlinjer för uppföljning Motala kommun Beslutsinstans: Kommunfullmäktige Diarienummer: 11/KS 0157 Datum: 2011-08-22 Paragraf: KF 111 Reviderande instans: Diarienummer: Datum: Paragraf: Gäller från: 2011-09-01

Läs mer

Granskning av delårsrapport 2014

Granskning av delårsrapport 2014 Granskningsrapport Anna Carlénius Revisionskonsult Conny Erkheikki Auktoriserad revisor Granskning av delårsrapport 2014 Övertorneå kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning

Läs mer

Revisionsrapport Granskning av delårsrapport 2012

Revisionsrapport Granskning av delårsrapport 2012 Revisionsrapport Granskning av delårsrapport 2012 Lekebergs kommun Anna Gröndahl, Lars Wigström, certifierad kommunal revisor Innehållsförteckning Sammanfattande bedömning...1 Inledning... 3 Bakgrund...

Läs mer

Granskning av delårsrapport 2015

Granskning av delårsrapport 2015 Granskningsrapport Anna Carlénius Revisionskonsult Conny Erkheikki Auktoriserad revisor Granskning av delårsrapport 2015 Övertorneå kommun Innehållsförteckning 1 Sammanfattande bedömning 1 1.1 Bakgrund

Läs mer

Granskning av delårsrapport. Torsås kommun

Granskning av delårsrapport. Torsås kommun Revisionsrapport Granskning av delårsrapport 2013 Torsås kommun Åsa Bejvall augusti 2013 Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte, revisionsfrågor och avgränsning

Läs mer

Revisionsrapport. Granskning av Delårsrapport januari augusti 2008. Avesta kommun. Oktober 2008. Robert Heed

Revisionsrapport. Granskning av Delårsrapport januari augusti 2008. Avesta kommun. Oktober 2008. Robert Heed Revisionsrapport Granskning av Delårsrapport januari augusti 2008 Avesta kommun Oktober 2008 Robert Heed INNEHÅLLSFÖRTECKNING 1. Inledning...3 1.1 Uppdrag och ansvarsfördelning...3 1.2 Mål av betydelse

Läs mer

Rapport avseende granskning av delårsrapport 2012-08-31.

Rapport avseende granskning av delårsrapport 2012-08-31. Rapport avseende granskning av delårsrapport 2012-08-31. Östersunds kommun Oktober 2012 Marianne Harr, certifierad kommunal revisor Jenny Eklund, godkänd revisor 1 Innehåll Sammanfattning och kommentarer

Läs mer

Revisionsrapport. Revision Samordningsförbundet Pyramis. Per Ståhlberg Cert. kommunal revisor. Robert Bergman Revisionskonsult

Revisionsrapport. Revision Samordningsförbundet Pyramis. Per Ståhlberg Cert. kommunal revisor. Robert Bergman Revisionskonsult Revisionsrapport Revision 2011 Per Ståhlberg Cert. kommunal revisor Samordningsförbundet Pyramis Robert Bergman Revisionskonsult April 2012 Innehållsförteckning 1. Sammanfattning... 1 2. Inledning... 2

Läs mer

Revisionsrapport. Nerikes Brandkår. Granskning av Delårsrapport januari-juli 2013 2013-09-20. Ref Anders Pålhed (1)

Revisionsrapport. Nerikes Brandkår. Granskning av Delårsrapport januari-juli 2013 2013-09-20. Ref Anders Pålhed (1) Revisionsrapport Granskning av Delårsrapport januari-juli 2013 Nerikes Brandkår 2013-09-20 Ref Anders Pålhed (1) Innehållsförteckning Innehållsförteckning... 2 1. Sammanfattning... 3 2. Inledning... 4

Läs mer

RÄTTVISANDE RÄKENSKAPER...2

RÄTTVISANDE RÄKENSKAPER...2 Rapport Åtvidabergs kommun Granskning delårsrapport 2006-08-31 2006-10-17 Genomförd på uppdrag av de förtroendevalda revisorerna i Åtvidabergs kommun Susanne Svensson Lars Rydvall Innehåll 1 SAMMANFATTNING...1

Läs mer

Delårsrapport 2012-08-31

Delårsrapport 2012-08-31 Revisionsrapport Delårsrapport 2012-08-31 Vänersborgs kommun Oktober 2012 Håkan Olsson Henrik Bergh Hanna Robinson Innehållsförteckning 1 Sammanfattning...1 2 Uppdraget...2 2.1 Bakgrund...2 2.2 Syfte,

Läs mer

Policy. God ekonomisk hushållning och resultatutjämningsreserv 1

Policy. God ekonomisk hushållning och resultatutjämningsreserv 1 Policy God ekonomisk hushållning och resultatutjämningsreserv 1 Innehåll Bakgrund 3 God ekonomisk hushållning 3 Mål och måluppfyllelse för god ekonomisk hushållning 3 Finansiella mål och riktlinjer 3 Mål

Läs mer

Riktlinje för ekonomistyrning

Riktlinje för ekonomistyrning Riktlinje 2015-03-30 Riktlinje för ekonomistyrning KS 2015/0144 Beslutad av kommunfullmäktige den 30 mars 2015. Denna riktlinje ersätter, tillsammans med Riktlinje för intern styrning och kontroll, det

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport* Granskning av delårsrapport Tyresö kommun September 2007 Anders Hägg Frida Enocksson Jonas Eriksson *connectedthinking Innehållsförteckning 1 Sammanfattande bedömning...3 2 Inledning...5

Läs mer

Samordningsförbundet Consensus

Samordningsförbundet Consensus www.pwc.se Revisionsrapport Revision 2015 Per Ståhlberg Cert. kommunal revisor Samordningsförbundet Consensus Mars 2016 Innehåll 1. Sammanfattning... 2 2. Inledning... 3 2.1. Bakgrund... 3 2.2. Syfte och

Läs mer

EKONOMIUTBILDNING. Förtroendevalda 2015-01-20. Kenneth Erlandsson, ekonomichef

EKONOMIUTBILDNING. Förtroendevalda 2015-01-20. Kenneth Erlandsson, ekonomichef EKONOMIUTBILDNING Förtroendevalda 2015-01-20 Kenneth Erlandsson, ekonomichef Vad styr oss? Riksdagen Kommunallagen Kommunal redovisningslag Rådet för Kommunal Redovisning God redovisningssed Kommunfullmäktige

Läs mer

Översiktlig granskning av delårsrapport 2014

Översiktlig granskning av delårsrapport 2014 Revisionsrapport Caroline Liljebjörn 29 augusti 2014 Översiktlig granskning av delårsrapport 2014 Torsås kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte,

Läs mer

Riktlinjer för god ekonomisk hushållning inklusive riktlinjer för resultatutjämningsreserv Piteå kommun

Riktlinjer för god ekonomisk hushållning inklusive riktlinjer för resultatutjämningsreserv Piteå kommun Riktlinjer för god ekonomisk hushållning inklusive riktlinjer för resultatutjämningsreserv Piteå kommun Dokumentnamn Dokumenttyp Fastställd/upprättad Beslutsinstans Riktlinjer för god ekonomisk hushållning

Läs mer

Granskning av delårsrapport 2014

Granskning av delårsrapport 2014 Granskningsrapport Anna Carlénius Revisionskonsult Conny Erheikki Auktoriserad revisor Granskning av delårsrapport Pajala kommun Innehållsförteckning 1 Sammanfattande bedömning 1 1. Inledning 2 1.1 Bakgrund

Läs mer

Revisionsrapport. Delårsrapport 2010. Oxelösunds kommun 2010-09-29. Matti Leskelä

Revisionsrapport. Delårsrapport 2010. Oxelösunds kommun 2010-09-29. Matti Leskelä Revisionsrapport Oxelösunds kommun 2010-09-29 Matti Leskelä Innehållsförteckning 1 Sammanfattande bedömning... 1 1.1 Bakgrund... 2 1.2 Syfte, revisionsfrågor och avgränsning... 2 1.3 Revisionskriterier...

Läs mer

Reglemente för ekonomisk förvaltning och intern kontroll avseende Norrköpings kommuns nämnder och förvaltningar

Reglemente för ekonomisk förvaltning och intern kontroll avseende Norrköpings kommuns nämnder och förvaltningar Riktlinje 2011-05-30 Reglemente för ekonomisk förvaltning och intern kontroll avseende Norrköpings kommuns nämnder och förvaltningar KS-584/2010 Detta reglemente gäller från och med den 1 januari 2005.

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport Staffanstorps kommun Carl-Gustaf Folkeson Emelie Lönnblad Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte, revisionsfrågor

Läs mer

BUDGET- OCH RESULTATUPPFÖLJNINGSREGLEMENTE

BUDGET- OCH RESULTATUPPFÖLJNINGSREGLEMENTE TROLLHÄTTANS STAD 2013-10-11 1 (5) TROLLHÄTTANS STAD 2013-10-11 Sid nr 1 (5) Dokumentbeteckning Reglemente för budget- och resultatuppföljning. Antaget av/ansvarig Kommunfullmäktige 2013-11-04 132 Syfte

Läs mer

Rapport avseende granskning av delårsrapport Timrå kommun

Rapport avseende granskning av delårsrapport Timrå kommun Rapport avseende granskning av delårsrapport 2016-08-31. Timrå kommun Oktober 2016 Innehåll 1. INLEDNING... 3 1.1 BAKGRUND... 3 1.2 SYFTE... 3 1.3 REVISIONSMETOD... 4 2. IAKTTAGELSER... 4 2.1 FÖRVALTNINGSBERÄTTELSE...

Läs mer

Revisionsrapport. Nerikes Brandkår. Granskning av Delårsrapport januari-juli Ref Anders Pålhed (1)

Revisionsrapport. Nerikes Brandkår. Granskning av Delårsrapport januari-juli Ref Anders Pålhed (1) Revisionsrapport Granskning av Delårsrapport januari-juli 2016 Nerikes Brandkår 2016-09-07 Ref Anders Pålhed (1) Innehållsförteckning Innehållsförteckning... 2 1. Sammanfattning... 3 2. Inledning... 4

Läs mer

Granskning av delårsrapport 2013

Granskning av delårsrapport 2013 Revisionsrapport Anders Thulin, Auktoriserad revisor, Certifierad kommunal revisor Emelie Lönnblad, Revisionskonsult Granskning av delårsrapport 2013 Båstads kommun Christina Widerstrand, Certifierad kommunal

Läs mer

Kommunal författningssamling för Smedjebackens kommun. Ekonomiska styrprinciper - styrmodell och ekonomistyrningsprinciper

Kommunal författningssamling för Smedjebackens kommun. Ekonomiska styrprinciper - styrmodell och ekonomistyrningsprinciper Kommunal författningssamling för Smedjebackens kommun Fastställd av Kf 80 Den 2016-11-14 80 Dnr 2016/00327 Ekonomiska styrprinciper - styrmodell och ekonomistyrningsprinciper Kommunfullmäktiges beslut

Läs mer

Granskning av delårsrapport 2014

Granskning av delårsrapport 2014 Granskningsrapport Malin Kronmar Caroline Liljebjörn Pär Sturesson Granskning av delårsrapport 2014 Kalmar kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte,

Läs mer

Fagersta kommun. Granskning av delårsrapport per den 31 augusti Revisionsrapport. KPMG 7 oktober 2009 Antal sidor 8

Fagersta kommun. Granskning av delårsrapport per den 31 augusti Revisionsrapport. KPMG 7 oktober 2009 Antal sidor 8 ABCD Fagersta kommun Granskning av delårsrapport per den 31 augusti 2009 Revisionsrapport KPMG 7 oktober 2009 Antal sidor 8 ABCD Fagersta kommun Granskning av delårsrapport 2009-08-31 Revisionsrapport

Läs mer

Granskning av delårsrapport 2014

Granskning av delårsrapport 2014 Granskningsrapport Caroline Liljebjörn Granskning av delårsrapport 2014 Vimmerby kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte, revisionsfrågor och avgränsning

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport 2011 Trelleborgs kommun Anders Thulin Bengt-Åke Hägg Alf Wahlgren Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte,

Läs mer

Revisionsrapport Granskning av delårsrapport. Krokoms Kommun

Revisionsrapport Granskning av delårsrapport. Krokoms Kommun Revisionsrapport Granskning av delårsrapport Krokoms Kommun 25 september 2014 Innehåll Sammanfattning... 1 Inledning... 2 Rutinbeskrivning... 4 Granskningsresultat... 5 Sammanfattning Vår bedömning är

Läs mer

Riktlinjer för god ekonomisk hushållning och resultatutjämningsreserv (RUR)

Riktlinjer för god ekonomisk hushållning och resultatutjämningsreserv (RUR) TJÄNSTESKRIVELSE Handläggare Datum Ärendebeteckning Urban Sparre 2013-11-21 KS 2013/0865 Kommunfullmäktige Riktlinjer för god ekonomisk hushållning och resultatutjämningsreserv (RUR) Förslag till beslut

Läs mer

Samordningsförbundet Activus

Samordningsförbundet Activus www.pwc.se Revisionsrapport Revision 2016 Per Ståhlberg Certifierad kommunal revisor Samordningsförbundet Activus April 2017 Innehåll 1. Sammanfattning...2 2. Inledning...3 2.1. Bakgrund...3 2.2. Syfte

Läs mer

Utbildning Oxelösunds kommun

Utbildning Oxelösunds kommun Utbildning Oxelösunds kommun Utbildning för förtroendevalda/tjänstemän 17 november 2015 Agenda Vad är ett Kommunalt resultat? Vad säger Kommunallagen? Vad är Balanskravet? Vad betyder God ekonomisk hushållning?

Läs mer

Granskning av delårs- rapport 2012

Granskning av delårs- rapport 2012 Revisionsrapport Granskning av delårs- rapport 2012 Karlstads kommun Daniel Brandt Stefan Fredriksson Lars Dahlin Maria Jäger Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund

Läs mer

Granskning av målstyrning enligt god ekonomisk hushållning

Granskning av målstyrning enligt god ekonomisk hushållning www.pwc.se Jörn Wahlroth 21 januari 2014 Granskning av målstyrning enligt god ekonomisk hushållning Torsås kommun Innehållsförteckning 1. Inledning... 1 1.1. Bakgrund... 1 1.2. Revisionsfråga... 1 1.2.1.

Läs mer

Revisionsrapport. Piteå kommun. Granskning av årsredovisning 2011. Per Ståhlberg Certifierad kommunal revisor. Johan Lidström

Revisionsrapport. Piteå kommun. Granskning av årsredovisning 2011. Per Ståhlberg Certifierad kommunal revisor. Johan Lidström Revisionsrapport Granskning av årsredovisning 2011 Piteå kommun Per Ståhlberg Certifierad kommunal revisor Johan Lidström Mars 2012 Innehållsförteckning 1 Sammanfattning 1 2 Inledning 2 2.1 Bakgrund 2

Läs mer

Samordningsförbundet Activus

Samordningsförbundet Activus www.pwc.se Revisionsrapport Revision 2015 Per Ståhlberg Cert. kommunal revisor Samordningsförbundet Activus Mars 2016 Innehåll 1. Sammanfattning... 2 2. Inledning... 3 2.1. Bakgrund... 3 2.2. Syfte och

Läs mer

Riktlinjer för god ekonomisk hushållning, riktlinjer för resultatutjämningsreserv och avsättning/nyttjande av reservfond Piteå kommun

Riktlinjer för god ekonomisk hushållning, riktlinjer för resultatutjämningsreserv och avsättning/nyttjande av reservfond Piteå kommun Riktlinjer för god ekonomisk hushållning, riktlinjer för resultatutjämningsreserv och avsättning/nyttjande av reservfond Piteå kommun Dokumentnamn Dokumenttyp Fastställd/upprättad Beslutsinstans Riktlinjer

Läs mer

Revisionsrapport Budgetprocessen. Ragunda kommun

Revisionsrapport Budgetprocessen. Ragunda kommun Revisionsrapport Budgetprocessen. Ragunda kommun 14 februari 2013 Innehåll Sammanfattning...1 1. Inledning...2 2. Budgetprocessen...3 3. Revisionell bedömning...7 Sammanfattning På uppdrag av kommunens

Läs mer

Granskning av delårsrapport per 31 aug Kommunalförbundet Västmanlandsmusiken

Granskning av delårsrapport per 31 aug Kommunalförbundet Västmanlandsmusiken Revisionsrapport 2016 Genomförd på uppdrag av revisorerna september 2016 Granskning av delårsrapport per 31 aug 2016 Kommunalförbundet Västmanlandsmusiken INNEHÅLLSFÖRTECKNING Granskning av delårsrapport

Läs mer

Ekonomisk process budget, mål och uppföljning

Ekonomisk process budget, mål och uppföljning 1 (6) Typ: Riktlinje Giltighetstid: Tills vidare Version: 2.0 Fastställd: KF 2013-11-13, 147 Uppdateras: 2015 budget, mål och uppföljning Innehållsförteckning 1. Bakgrund 2. Processbeskrivning året före

Läs mer

Granskning av delårsrapport 2015

Granskning av delårsrapport 2015 Granskningsrapport PerÅke Brunström, Certifierad kommunal revisor Granskning av delårsrapport 2015 Haparanda Stqd Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte,

Läs mer

Granskning av delårsbokslut per 30 juni 2009 Ljusdals kommun

Granskning av delårsbokslut per 30 juni 2009 Ljusdals kommun Revisionsrapport Granskning av delårsbokslut per 30 juni 2009 Ljusdals kommun September 2009 Micaela Hedin Certifierad kommunal revisor Lena Sörell Godkänd revisor 2009-09-15 Namnförtydligande Namnförtydligande

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport 2012-04-30 Landstinget Dalarna Emil Forsling Auktoriserad revisor Fredrik Winter Revisor 25 maj 2012 Innehållsförteckning Sammanfattande bedömning 1 1 Inledning

Läs mer

Vetlanda kommun. Granskning av delårsbokslut Genomförd på uppdrag av revisorerna 13 september 2011

Vetlanda kommun. Granskning av delårsbokslut Genomförd på uppdrag av revisorerna 13 september 2011 Vetlanda kommun Granskning av delårsbokslut 2011 Genomförd på uppdrag av revisorerna 13 september 2011 Jonas Leander Ulrika Strånge Susanne Karlsson Helena Patrikson Innehållsförteckning 1. Sammanfattning...

Läs mer

EKONOMISTYRNINGSPOLICY

EKONOMISTYRNINGSPOLICY EKONOMISTYRNINGSPOLICY Reviderad av kommunfullmäktige 2013-12-16 128 Fastställd av kommunfullmäktige 2007-04-23 60 Innehåll 1 Inledning och syfte 3 2 Ansvarsfördelning 3 2.1 Kommunfullmäktiges ansvar 3

Läs mer

Delårsrapportering Övertorneå kommun. Revisionsrapport. November PerÅke Brunström Certifierad kommunal revisor

Delårsrapportering Övertorneå kommun. Revisionsrapport. November PerÅke Brunström Certifierad kommunal revisor Delårsrapportering 2010 Övertorneå kommun Revisionsrapport November 2010 PerÅke Brunström Certifierad kommunal revisor Conny Erkheikki Auktoriserad revisor Innehåll Sammanfattning och bedömning...3 Inledning...

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport 2012 Kalix kommun Conny Erkheikki Auktoriserad revisor Anna Carlénius Revisionskonsult 12 november 2012 Innehållsförteckning 1 Sammanfattande bedömning 1 2.1

Läs mer

Granskning av delårsrapport 2015

Granskning av delårsrapport 2015 Granskningsrapport Conny Erkheikki, auktorisrad revisor Granskning av delårsrapport 2015 Gällivare kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte, revisionsfrågor

Läs mer

Revisionsrapport. Revision Samordningsförbundet Activus Piteå. Per Ståhlberg Cert. kommunal revisor. Robert Bergman Revisionskonsult

Revisionsrapport. Revision Samordningsförbundet Activus Piteå. Per Ståhlberg Cert. kommunal revisor. Robert Bergman Revisionskonsult Revisionsrapport Revision 2011 Per Ståhlberg Cert. kommunal revisor Samordningsförbundet Activus Piteå Robert Bergman Revisionskonsult Innehållsförteckning 1. Sammanfattning... 1 2. Inledning... 2 2.1.

Läs mer

Granskning av delårsrapport 2015

Granskning av delårsrapport 2015 Granskningsrapport Anders Rabb Sandra Feiff Jenny Nyholm Ebba Lind Granskning av delårsrapport 2015 Sollentuna kommun Innehållsförteckning 1. Sammanfattande bedömning 1 2. Inledning 2 a. Bakgrund 2 b.

Läs mer

Granskning av delårsrapport 2008

Granskning av delårsrapport 2008 Revisionsrapport* Granskning av delårsrapport 2008 Laholms kommun 22 september 2008 Inger Andersson *connectedthinking Innehållsförteckning 1 Sammanfattning...3 2 Inledning...4 2.1 Bakgrund...4 2.2 Revisionsfråga...4

Läs mer

Granskning av delårsrapport per

Granskning av delårsrapport per Revisionsrapport Granskning av delårsrapport per 2009-08-31 Motala kommun 2009-10-01 Karin Jäderbrink Matti Leskelä Innehållsförteckning 1 Sammanfattning...1 2 Inledning...2 2.1 Bakgrund...2 2.2 Syfte,

Läs mer

Ekonomiska styrprinciper för mandatperioden

Ekonomiska styrprinciper för mandatperioden Eslövs kommun Ekonomiska styrprinciper för mandatperioden 2011-2014 Inledning De ekonomiska styrprinciperna för Eslövs kommun syftar till att öka förutsättningarna för ett önskat kvalitativt och ekonomiskt

Läs mer

Granskning av delårsrapport, redovisning och intern kontroll 2013

Granskning av delårsrapport, redovisning och intern kontroll 2013 Revisionsrapport Cecilia Axelsson Granskning av delårsrapport, redovisning och intern kontroll 2013 Gästrike Räddningstjänst Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Delårsrapport

Läs mer

Revisionsrapport. Delårsrapport Hallsbergs kommun. Oktober Lars Wigström. Certifierad kommunal revisor

Revisionsrapport. Delårsrapport Hallsbergs kommun. Oktober Lars Wigström. Certifierad kommunal revisor Revisionsrapport Delårsrapport 2009 Hallsbergs kommun Oktober 2009 Lars Wigström Certifierad kommunal revisor 200X-XX-XX Namnförtydligande Namnförtydligande Innehållsförteckning 1 Sammanfattning...1 2

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport 2008-06-30 Krokoms kommun 3 september 2008 Anneth Nyqvist 2008-09-08 Anneth Nyqvist Maj-Britt Åkerström Innehållsförteckning 1 Sammanfattande bedömning och

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport 2012 Övertorneå kommun Anneth Nyqvist Revisonskonsult Anna Carlénius Revisonskonsult Innehållsförteckning Sammanfattning 1 1. Inledning 2 1.1 Bakgrund 2 1.2

Läs mer

Ekonomistyrningsregler för Finspångs kommun

Ekonomistyrningsregler för Finspångs kommun 2014-02-17 1(5) Ekonomistyrningsregler för Finspångs kommun Fastställdes av kommunfullmäktige 2013-12-18 313 Fastställda av kommunfullmäktige den 27 april 2000 103 att gälla från och med 1 maj 2000, med

Läs mer

Reglemente för planering, styrning och uppföljning av verksamhet och ekonomi i Norrtälje kommun

Reglemente för planering, styrning och uppföljning av verksamhet och ekonomi i Norrtälje kommun 2015-11-02 Reglemente för planering, styrning och uppföljning av verksamhet och ekonomi i Norrtälje kommun Antagen av kommunfullmäktige 2015-xx-xx. Ersätter reglemente för planering, styrning och uppföljning

Läs mer

PM - Granskning av årsredovisning 2006*

PM - Granskning av årsredovisning 2006* Öhrlinas PM - Granskning av årsredovisning 2006* Strömstads kommun april 2007 Håkan Olsson Henrik Bergh *connectedthin king I STROMSTADS KOMMUN I I Kommunstyrelsen KC/ZDD? - 0lsi 1 Dnr:........... I Innehållsförteckning

Läs mer

Granskning av delårsrapport 2014

Granskning av delårsrapport 2014 Granskningsrapport Caroline Liljebjörn 8 september 2014 Granskning av delårsrapport 2014 Borgholms kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte, revisionsfrågor

Läs mer

Granskning av delårsrapport 2014

Granskning av delårsrapport 2014 Granskningsrapport Anna Gröndahl Kim Gustafsson Granskning av delårsrapport 2014 Hallsbergs kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte, revisionsfrågor

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport 2012 Vimmerby kommun Caroline Liljebjörn 11 oktober 2012 Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Syfte, revisionsfrågor

Läs mer

Delårsrapport

Delårsrapport Revisionsrapport Delårsrapport 2010-06-30 Torsås kommun 15 september 2010 Åsa Bejvall Innehållsförteckning 1 Sammanfattning... 1 2 Inledning... 2 2.1 Bakgrund... 2 2.2 Syfte, revisionsfråga och avgränsning...

Läs mer

Granskning av delårsrapport 2016

Granskning av delårsrapport 2016 Granskningsrapport Richard Vahul Jenny Nyholm Granskning av delårsrapport 2016 Nynäshamns kommun Granskning av delårsrapport 2016 Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund

Läs mer

Styrdokument för Hammarö kommun

Styrdokument för Hammarö kommun Styrdokument för Hammarö kommun Huvudprinciper för styrning, uppföljning och utvärdering av den kommunala verksamheten i Hammarö kommun. Antaget 2012, reviderat 2015-05-18 2 1. Inledning 1.1 Vem vänder

Läs mer

Revisionsrapport. Götene kommun. Granskning av årsredovisning 2012. Hans Axelsson Carl Sandén

Revisionsrapport. Götene kommun. Granskning av årsredovisning 2012. Hans Axelsson Carl Sandén Revisionsrapport Granskning av årsredovisning 2012 Götene kommun Hans Axelsson Carl Sandén mars 2013 Innehållsförteckning 1 Sammanfattning 1 2 Inledning 2 2.1 Bakgrund 2 2.2 Revisionsfråga och metod 2

Läs mer

Revisionsrapport 2012 Genomförd på uppdrag av revisorerna. Strängnäs kommun. Granskning av delårsrapport per 31 augusti 2012

Revisionsrapport 2012 Genomförd på uppdrag av revisorerna. Strängnäs kommun. Granskning av delårsrapport per 31 augusti 2012 Revisionsrapport 2012 Genomförd på uppdrag av revisorerna Strängnäs kommun Granskning av delårsrapport per 31 augusti 2012 Innehållsförteckning 1 SAMMANFATTNING... 3 2 INLEDNING... 5 2.1 Bakgrund... 5

Läs mer

I policyn fastställs ansvaret för den interna kontrollen samt på vilket sätt uppföljningen av den interna kontrollen ska ske.

I policyn fastställs ansvaret för den interna kontrollen samt på vilket sätt uppföljningen av den interna kontrollen ska ske. KOMMUNKONTORET 2004-01-20 1 Sundbybergs stads policy för intern kontroll Inledning Denna policy avser inte att reglera vad som är god intern kontroll. Varje nämnd ska utforma och utföra den egna kontrollen

Läs mer

Revisionsrapport Samordningsförbundet Consensus Älvsbyn

Revisionsrapport Samordningsförbundet Consensus Älvsbyn Revisionsrapport Revision 2010 Per Ståhlberg, certifierad kommunal revisor Samordningsförbundet Consensus Älvsbyn Bo Rehnberg, certifierad kommunal revisor 2011-05-03 Per Ståhlberg, projektledare Samordningsförbundet

Läs mer

Revisionsrapport. Granskning av. Delårsrapport per augusti Norrbottens läns landsting. September Anders Färnstrand, auktoriserad revisor

Revisionsrapport. Granskning av. Delårsrapport per augusti Norrbottens läns landsting. September Anders Färnstrand, auktoriserad revisor Revisionsrapport Granskning av Delårsrapport per augusti 2006 Norrbottens läns landsting September 2006 Anders Färnstrand, auktoriserad revisor INNEHÅLLSFÖRTECKNING 1. Sammanfattning...1 2. Uppdrag, syfte

Läs mer

Revisionsrapport Revision 2012 Samordningsförbundet Activus Linda Marklund Per Ståhlberg

Revisionsrapport Revision 2012 Samordningsförbundet Activus Linda Marklund Per Ståhlberg www.pwc.se Revisionsrapport Linda Marklund Per Ståhlberg Revision 2012 Samordningsförbundet Activus Innehållsförteckning 1. Sammanfattning och revisionell bedömning... 1 2. Inledning... 2 2.1. Bakgrund...

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport 2012-08-31 Smedjebackens kommun Malin Liljeblad Godkänd revisor Fredrik Winter Revisor Oktober 2012 Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning

Läs mer

Styrning av kommunal verksamhet...utifrån ekonomiperspektivet. Rolf Gustavsson Ekonomidirektör

Styrning av kommunal verksamhet...utifrån ekonomiperspektivet. Rolf Gustavsson Ekonomidirektör Styrning av kommunal verksamhet..utifrån ekonomiperspektivet Rolf Gustavsson Ekonomidirektör Kommunen styrs och styr på olika sätt? Statlig styrning; lagar, förordningar, statsbidragssystem, politiska

Läs mer

Granskning av delårsrapport 2014

Granskning av delårsrapport 2014 Granskningsrapport Carl-Gustaf Folkeson Bengt-Åke Hägg Lotten Lasson Granskning av delårsrapport 2014 Staffanstorps kommun Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning 2 2.1 Bakgrund 2

Läs mer

Delårsrapport 2007-08-31

Delårsrapport 2007-08-31 Revisionsrapport* Delårsrapport 2007-08-31 Vänersborgs kommun 2007-10-18 Marianne Wolmebrandt Certifierad kommunal revisor Henrik Bergh *connectedthinking Innehållsförteckning 1 Sammanfattning...3 2 Inledning...3

Läs mer

Riktlinjer för god ekonomisk hushållning och hantering av resultatutjämningsreserv KS-2013/421

Riktlinjer för god ekonomisk hushållning och hantering av resultatutjämningsreserv KS-2013/421 Göran Nilsson Ordförandens förslag Diarienummer Kommunstyrelsens ordförande Datum KS-2013/421 2013-05-27 Kommunstyrelsen Riktlinjer för god ekonomisk hushållning och hantering av resultatutjämningsreserv

Läs mer

Revisionsrapport. Nerikes Brandkår. Granskning av årsredovisning 2013 2014-03-06. Anders Pålhed (1)

Revisionsrapport. Nerikes Brandkår. Granskning av årsredovisning 2013 2014-03-06. Anders Pålhed (1) Revisionsrapport Granskning av årsredovisning 2013 Nerikes Brandkår 2014-03-06 Anders Pålhed (1) 1. Sammanfattning... 3 2. Inledning... 5 3. Syfte... 5 3.1 Metod... 6 4. Granskning av årsredovisningen...

Läs mer

Ekonomikontoret Datum: Lars Hustoft D.nr: Beslut KF , 55

Ekonomikontoret Datum: Lars Hustoft D.nr: Beslut KF , 55 Riktlinjer för god ekonomisk hushållning och hantering av resultatutjämningsreserv Bakgrund Från och med den 1 januari 2013 finns det i kommunallagen en möjlighet att under vissa villkor reservera delar

Läs mer

Granskning av delårsrapport

Granskning av delårsrapport Revisionsrapport Granskning av delårsrapport 2013 Övertorneå kommun Anna Carlénius Revisionskonsult Per Ståhlberg Certifierad kommunal revisor Innehållsförteckning 1 Sammanfattande bedömning 1 2 Inledning

Läs mer

Granskning av årsredovisning 2012

Granskning av årsredovisning 2012 Landstinget i Jönköpings län Landstingets revisorer Landstingsstyrelsen Granskning av årsredovisning 2012 Landstingets revisorer, har med hjälp av sakkunnigt biträde, granskat landstingets årsredovisning

Läs mer

Förslag till mer flexibla budgetperioder

Förslag till mer flexibla budgetperioder Kommunledningskontoret 2014-12-03 Dnr Ks 2014-1069 Stig Metodiusson Kommunstyrelsen Förslag till mer flexibla budgetperioder FÖRSLAG TILL KOMMUNSTYRELSENS BESLUT 1. Kommunfullmäktige förelås besluta ändra

Läs mer

Granskning av delårsbokslut per 31 augusti 2008 Söderhamns kommun

Granskning av delårsbokslut per 31 augusti 2008 Söderhamns kommun Revisionsrapport* Granskning av delårsbokslut per 31 augusti 2008 Söderhamns kommun Oktober 2008 Micaela Hedin Certifierad kommunal revisor Pär Månsson Certifierad kommunal revisor Auktoriserad revisor

Läs mer

RIKTLINJE Sandvikens kommuns Budget- och planeringsprocess - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Styrdokumentets data Beslutad av: Kommunfullmäktige Beslutsdatum och paragraf: 2014-12-15,

Läs mer

Delårsrapport för Österåkers kommun

Delårsrapport för Österåkers kommun Ordförandeförslag 00 Till Kommunfullmäktig Datum 2014-10-14 Dnr KS 2014/0282 Delårsrapport för 2014-01 -01-2014-08-31 Beslutsförslag Kommunfullmäktiges ordförande föreslår Kommunfullmäktige besluta 1.

Läs mer