FINANSINSPEKTIONENS ÅTGÄRDSAVGIFTER

Save this PDF as:
 WORD  PNG  TXT  JPG

Storlek: px
Starta visningen från sidan:

Download "FINANSINSPEKTIONENS ÅTGÄRDSAVGIFTER"

Transkript

1 ÅTGÄRDSTARIFF (15) FINANSINSPEKTIONENS ÅTGÄRDSAVGIFTER Värdepappersmarknadslag (VPML) Prospekt enligt EU-kommissionens prospektförordning (EG) nr 809/2004 Godkännande av prospekt för aktier eller aktierelaterade värdepapper (VPML1:2.1, 1 punkten) 2: Godkännande av prospekt för icke-aktierelaterade värdepapper 2: Godkännande av grundprospekt (inklusive senare beslut om tillägg till prospekt) 2: Ändrad Godkännande av prospekt för börsintroduktion (IPO) 2: Godkännande av registreringsdokument för aktier eller aktierelaterade värdepapper (VPML 1:2.1, 1 punkten) Godkännande av värdepappersnot och sammanfattning för aktier eller aktierelaterade värdepapper (VPML 1:2.1, 1 punkten) när ett tidigare godkänt registreringsdokument fortfarande är giltigt Godkännande av registreringsdokument för icke-aktierelaterade värdepapper Godkännande av värdepappersnot och sammanfattning för ickeaktierelaterade värdepapper när ett tidigare godkänt registreringsdokument fortfarande är giltigt Anmälan till den behöriga myndigheten i en annan medlemsstat om att ett prospekt eller tillägg till prospekt har godkänts (avgift per anmälan) 2:4 a : :4 a :4 2:4 f Ändrad S.k. nationella prospekt enligt finansministeriets förordning (538/2005) Godkännande av prospekt för aktier eller aktierelaterade värdepapper (VPML1:2.1, 1 punkten) 2:4 (FMF 538/2005) Godkännande av prospekt för icke-aktierelaterade värdepapper 2:4 (FMF 538/2005) Övriga åtgärdsavgifter Beslut om rättelse av väsentliga fel eller brister i prospekt 2:3 b, 2:4 Dispens från informationsskyldighet (avgift per ärende) 2: Förlängd dispens från informationsskyldighet 2: Tillstånd för bolag utanför Europeiska ekonomiska 2:11, samarbetsområdet (EES) att offentliggöra delårsrapporter, FMF 153/ och ledningens delårsredogörelser, bokslut och verksamhetsberättelser, FMF154/ bokslutskommunikéer och flaggningsanmälningar enligt bestämmelserna i hemstaten Ny Tillstånd för moderbolag till fondbolag eller fondhandlare med verksamhetstillstånd i en stat utanför EES att tillämpa undantag från flaggningsskyldigheten 2:11 och FMF 154/ Ny Tillstånd för emittent att offentliggöra ledningens delårsredogörelse FMF 153/ Ny Dispens från vissa krav på bolag som ansökt om att bli upptagna på börslistan 3:10 (FMb 906/1994)

2 ÅTGÄRDSTARIFF (15) Värdepappersmarknadslag (VPML) Beslut om avnotering av ett värdepapper på begäran av emittenten 3: /timme Godkännande av villkoren i avtal om återköp och utlåning av värdepapper 4:5 a Dispens från begränsningen av en clearingorganisations innehav 4 a: Dispens från förbudet mot återbetalning eller vinstutdelning 4 a: Godkännande av mottagare av fondhandlares transaktionsrapporter 4:7 Godkännande av erbjudandehandling 6: Beslut om rättelse av fel eller brister i erbjudandehandling 6:4 Föreläggande om förlängning av ett uppköpserbjudandes 6: giltighetstid Beslut om budplikt 6: Dispens från budplikt, erbjudet vederlag, höjningsskyldighet eller gottgörelseskyldighet (VPML 6:10 13 ) 6: Dispens från annan skyldighet enligt 6 kap. i VPML 6: Lag om placeringsfonder (PlacFL) Tillstånd att verka som fondbolag 5 a Betydande ändring av ett fondbolags verksamhetstillstånd på ansökan (kapitalförvaltning) Smärre ändring av ett fondbolags verksamhetstillstånd på ansökan (andra tjänster än kapitalförvaltning) 5 d 1 mom. (5 2 mom. 1 punkten) d 1 mom Fastställande av fasta kostnader vid täckning av verksamhetsrisk 6 4 mom mom. Se avgifter för Dispens enligt bestämmelserna i 5 och 6 kap. i kreditinstitutslagen KIL nedan Tillstånd att verka som förvaringsinstitut 9 1 mom Ny Ändring av ett förvaringsinstituts verksamhetstillstånd på ansökan 9 c 1 mom Dispens från tidsfristen inom vilken placeringsfondens minimikapital och minimiantalet fondandelsägare skall ha uppnåtts 27 2 mom Dispens beträffande sammanlagd kapitalbas vid fusion 30 c 1 mom. Dispens beträffande vinstutdelning trots otillräcklig kapitalbas 30 c 3 mom Dispens från bokslutsbestämmelserna i 39 4 mom Fastställande av stadgar för placeringsfond och specialplaceringsfond (kräver väsentliga nya tolkningar) Fastställande av stadgar för placeringsfond och specialplaceringsfond (kräver inga väsentliga nya tolkningar) Ändring av stadgar för placeringsfond och specialplaceringsfond (kräver väsentliga nya tolkningar) Ändring av stadgar för placeringsfond och specialplaceringsfond (kräver inga väsentliga nya tolkningar)

3 ÅTGÄRDSTARIFF (15) Lag om placeringsfonder (PlacFL) Fastställande av överensstämmande ändringar i stadgarna för flera placeringsfonder och specialplaceringsfonder (kräver inga tolkningar) 43 2 och för följande fonder Tillstånd att tillfälligt avbryta emissionen av fondandelar Tillstånd att överskrida tidsgränsen för försäljning av värdepapper i samband med inlösen av fondandelar Tillstånd för fondbolag att ta upp lån för en placeringsfonds räkning Tillstånd att offentliggöra fondandelsvärdet och antalet utelöpande fondandelar endast en gång i månaden Tillstånd för anmälningsskyldig att förvärva/överlåta värdepapper eller derivatinstrument från/till en placeringsfond, om detta inte sker enligt 102 Tillstånd att verkställa överlåtelsen av förvaltningen av en placeringsfond Tillstånd att byta förvaringsinstitut (inkl. namnbyte i stadgarna) 106 Tillstånd att verkställa fusion av en placeringsfond med annan fond 109 Tillstånd att verkställa delning av placeringsfond 114 Återkallande av ett fondbolags verksamhetstillstånd på ansökan Återkallande av ett förvaringsinstituts verksamhetstillstånd på ansökan Handläggning av anmälan om etablering av filial i en annan EESstat a Tillstånd för fondbolag att inrätta filial i en stat utanför EES 126 b Underrättelseförfarande 126 d Intyg om att kraven i fondföretagsdirektivet uppfylls mom Intyg om att en placeringsfond eller en specialplaceringsfond står under Finansinspektionens tillsyn Handläggning av en anmälan om att ett fondföretag med verksamhetstillstånd inom EES har för avsikt att inleda marknadsföring av fondandelar Tillstånd att i Finland marknadsföra annat fondföretag än sådant som avses i fondföretagsdirektivet Om tillstånd söks för marknadsföring av en paraplyfond tas en handläggningsavgift på ut för den första underfonden och för varje följande underfond mom mom ( per underfond) Ändrad Lag om utländska fondbolags verksamhet i Finland (UtlFBL) Handläggning av anmälan om att ett fondbolag med verksamhetstillstånd inom EES har för avsikt att inrätta filial och meddelande om villkoren Tillstånd för fondbolag med verksamhetstillstånd i en stat utanför EES att inrätta filial i Finland 4 (UtlVPFL 4, UtlKIL 5 ) 7 (UtlVPFL 7, UtlKIL 9 )

4 ÅTGÄRDSTARIFF (15) Lag om utländska fondbolags verksamhet i Finland (UtlFBL) Handläggning av anmälan om öppnande av representationskontor 9 (UtlVPFL 10, Tillstånd för fondbolag med verksamhetstillstånd i en stat utanför EES att bedriva verksamhet i Finland UtlKIL 11 ) 11 (UtlVPFL 12 ) Lag om handel med standardiserade optioner och terminer (OptionsHL) Dispens beträffande placeringar i masskuldebrevslån 2:4 Dispens beträffande vinstutdelning trots otillräcklig kapitalbas 2:5 (KIL 81 ) Beslut om överklagande av ett optionsföretags beslut att avslå ansökan om eller återkalla förmedlar-/marknadsgarantsrättigheter 2: /timme Lag om värdepappersföretag (VPFL) Tillstånd att verka som värdepappersföretag (minimikapital eller eller flera typer av tillståndspliktiga investeringstjänster) Tillstånd att verka som värdepappersföretag (minimikapital eller en typ av tillståndspliktig investeringstjänst) Beslut om betydande ändring av ett värdepappersföretags verksamhetstillstånd på ansökan Beslut om smärre ändring av ett värdepappersföretags verksamhetstillstånd på ansökan Återkallande av ett värdepappersföretags verksamhetstillstånd på ansökan mom mom Dispens från kravet på separat ledning 12 a Handläggning av anmälan om etablering av filial inom EES Tillstånd för värdepappersföretag att inrätta filial i en stat utanför EES 18 1 mom Underrättelseförfarande Dispens beträffande tidsfristen för upprättande av bokslut, förvaring av bokföringsmaterial utomlands och räkenskapsperioden för inhemska dotterföretag som konsolideras i koncernbokslut 21 (KIL mom.) Dispens beträffande delårs- eller årsrapport Ny (KIL mom.) 31 Se avgifter för Ny Dispens enligt bestämmelserna i 5 och 6 kap. i kreditinstitutslagen KIL nedan Lag om utländska värdepappersföretags rätt att tillhandahålla investeringstjänster i Finland (UtlVPFL) Handläggning av anmälan om att ett värdepappersföretag med verksamhetstillstånd inom EES har för avsikt att inrätta filial och meddelande om villkoren 4 (UtlKIL 5 ) Tillstånd för värdepappersföretag med verksamhetstillstånd i en stat utanför EES att inrätta filial i Finland Handläggning av anmälan om öppnande av representationskontor 10 (UtlKIL 11 )

5 ÅTGÄRDSTARIFF (15) Lag om utländska värdepappersföretags rätt att tillhandahålla investeringstjänster i Finland (UtlVPFL) Tillstånd för värdepappersföretag med verksamhetstillstånd i en stat utanför EES att tillhandahålla gränsöverskridande tjänster i Finland (underrättelseförfarande) Kreditinstitutslag (KIL) Beslut om begränsad kreditinstitutsverksamhet 18 2 mom Koncession för kreditinstitut 22 1 mom Ändrad Ändring av koncessionsvillkoren på ansökan 23 2 mom Koncession för pabolag Ändrad Återkallande av koncession på ansökan 28 1 mom Undantag från begränsningsreglerna om fastighetsinnehav 33 3 mom Dispens från kravet på separat ledning 41 2 mom. Godkännande av villkor för kapitallån som räknas till primärt kapital 45 1 mom. 4 punkten Tillstånd att inräkna en post i primärt kapital Tillstånd till förtida återbetalning av skuldinstrument som räknas till supplementärt kapital Tillstånd till förtida inlösen av debenturer eller jämförbara instrument 45 1 mom. 9 punkten Ny punkten Ny Tillstånd att inte göra ett avdrag från kapitalbasen Tillstånd att tillämpa en högre gräns för anmälan om interna transaktioner 51 2 mom. Godkännande av skuldinstrument som investeringsobjekt för uppfyllande av betalningsförmedlingsföretags likviditetskrav 53 1 mom. 3 punkten Ny Beslut om tidsfrist för betalningsförmedlingsföretag för uppfyllande av likviditetskrav Godkännande av tillgångspost som täckning för betalningsförmedlingsföretags skulder 53 4 mom. Ändrad 53 4 mom Undantag från kapitalkrav för dotterföretag till kreditinstitut Ny Godkännande av kreditvärderingsföretag vid tillämpningen av schablonmetoden för kreditrisk Tillstånd att använda en internmetod för beräkning av kapitalkrav för kreditrisk Godkännande av riktvärde som anges i verksamhetsplanen för betalningsförmedlingsföretag 58 3 mom. Se bilaga 1 Ny 59 Se bilaga 2 Ny 66 1 mom Ny Undantag från begränsningsreglerna om exponeringar mot kunder och konsoliderade exponeringar mot kunder 69 4 mom. och 79 1 mom. Beslut om att dotter-, sam- eller ägarintresseföretag inte skall omfattas av den gruppbaserade tillsynen 73 5 mom Ny

6 ÅTGÄRDSTARIFF (15) Kreditinstitutslag (KIL) Undantag från kravet på intern kapitalutvärdering för kreditinstitut i en finansiell företagsgrupp 78 3 mom Ny Undantag från kraven gällande konsoliderade fastighetsinnehav 81 4 mom Undantag från kraven på att offentliggöra information om kapitaltäckningen Beslut om tidsfrist för ökning av kapitalbasen enligt begränsningsreglerna om exponeringar mot kunder 83 3 mom Ny 87 Ny Beslut om tidsfrist för ökning av kapitalbasen 87 Ny Undantag från begränsningsreglerna om användning av vinstmedel 88 1 mom Tillstånd att beräkna och rapportera kapitalkrav enligt utländsk lagstiftning Tillstånd att fördela garantiavgiften mellan inlåningsbankerna i sammanslutningen av andelsbanker på ett annat sätt än i lagen Dispens beträffande tidsfristen för upprättande av bokslut, förvaring av bokföringsmaterial utomlands och räkenskapsperioden för inhemska dotterföretag som konsolideras i koncernbokslut 94 2 mom Ny 99 2 mom Ny mom Dispens beträffande delårs- eller årsrapport mom Handläggning av anmälan om etablering av filial i en annan EESstat Tillstånd för kreditinstitut att inrätta filial i en stat utanför EES mom Underrättelseförfarande Intyg till finansinstitut inom en finansiell företagsgrupp med kreditinstitut om att villkoren för filialetablering eller tillhandahållande av tjänster i en EES-stat är uppfyllda mom Lag om andelsbanker och andra kreditinstitut i andelslagsform (AnBL) Beslut om tidsfrist för sammanslutningen av andelsbanker rörande exponeringar mot kunder Beslut om tidsfrist för sammanslutningen av andelsbanker rörande kapitalbasen Dispens från kravet att tillämpa lagen om tillsyn över finans- och försäkringskonglomerat (699/2004) på ett konglomerat 6 Ny 8 Ny 9 a Ny Lag om utländska kreditinstituts och finansiella instituts verksamhet i Finland (UtlKIL) Handläggning av anmälan om att ett kreditinstitut eller finansinstitut med verksamhetstillstånd inom EES har för avsikt att inrätta filial och meddelande om villkoren 5 (UtlVPFL 4 ) Tillstånd för kreditinstitut med verksamhetstillstånd i en stat utanför EES att inrätta filial i Finland 9 1 mom Handläggning av anmälan om öppnande av representationskontor 11 (UtlVPFL 10 )

7 ÅTGÄRDSTARIFF (15) Lag om tillsyn över finans- och försäkringskonglomerat (FikoL) Beslut om att ett tillsynsobjekt omfattas av FikoL 5 Beslut om att ett tillsynsobjekt endast delvis eller inte alls omfattas av FikoL 6 Dispens beträffande formen för anmälan om interna transaktioner 14 Dispens beträffande omfattningen av en finansiell företagsgrupp 17 Dispens beträffande beräkningen av kapitaltäckningen 19 Dispens från bestämmelserna i 3 kap. i FikoL (bokslut) Dispens beträffande formen för upprättande av bokslut 29 1 mom. Lag om hypoteksbanker Dispens beträffande överlåtelse eller pantsättning av fastighetskrediter och krediter till offentliga samfund 9 Dispens beträffande det maximala beloppet av fyllnadssäkerheter 13 Lag om pantlåneinrättningar (PLIL) Tillstånd att bedriva pantlånerörelse 4 1 mom Återkallande av en pantlåneinrättnings verksamhetstillstånd på ansökan 5 b Lag om fastighetsfonder (FastighFL) Fastställande av nya stadgar för fastighetsplaceringsverksamhet /timme Fastställande av ändringar i stadgarna för fastighetsplaceringsverksamhet 14 Godkännande av fastighetsfondsprospekt Dispens från informationsskyldighet Andra åtgärdsavgifter Beslut om återbetalning av kapitallån som räknas till primärt kapital Tillstånd att överskrida gränsen för exponeringar i handelslagret Tillstånd att använda en internmetod för beräkning av kapitalkrav för positioner utan rating i ABCP-program Standard RA4.1 avsnitt Standard 4.3h avsnitt Ny Dispens från kapitalkrav för likviditetsfaciliteter utan rating Standard 4.3h avsnitt 9.5 Ny Tillstånd att använda en formelbaserad metod för beräkning av kapitalkrav för positioner i värdepapperisering Standard 4.3h avsnitt Ny

8 ÅTGÄRDSTARIFF (15) Andra åtgärdsavgifter Tillstånd att använda en durationsgrundad metod för beräkning av generell risk i räntekontrakt Tillstånd att använda känslighetsmodellen för beräkning av kapitalkrav för generell risk i räntekontrakt Tillstånd att beräkna kapitalkrav för valuta- och guldrisk utan strukturella positioner Tillstånd att använda nuvärdesmetoden för beräkning av valutapositioner Standard 4.3g avsnitt 6.1.3, stycke 33 Standard 4.3g avsnitt stycke 42 Standard 4.3g avsnitt 8.2 Standard 4.3g avsnitt 8.3 stycke 14 Ny Ny Ny Ny Tillstånd att inte bilda grupp av kunder med inbördes anknytning Standard RA Ny avsnitt 4.2 stycke 8 Skriftliga expertutlåtanden till andra än myndigheter på begäran /timme Annat beslut på ansökan vars efterfrågan grundar sig på lag, förordning eller standard utfärdad av Finansinspektionen och som Finansinspektionen har faktisk ensamrätt att fatta (offentligrättslig prestation) /timme Ny Bilaga 1 till åtgärdstariffen redogör för åtgärdsavgifterna för handläggning av ansökningar om godkännande av kreditvärderingsföretag enligt 58 3 mom. i kreditinstitutslagen. Bilaga 2 redovisar åtgärdsavgifterna för handläggning av ansökningar om tillstånd för användning av internmetod (IRB) enligt 59 i kreditinstitutslagen. ÅTGÄRDSAVGIFTSKLASSER Tidsåtgång i timmar Genomsnittlig tidsåtgång Pris per timme, Åtgärdsavgift, i timmar 1 under över Fastställs för varje åtgärd timdebitering Åtgärdstariffen gäller från den 22 februari 2007 och ersätter den tariff som trädde i kraft den 1 juli Den nya tariffen tillämpas på beslut som fattas efter att tariffen trätt i kraft. Finansinspektionens direktion har fastställt principerna för åtgärdsavgifterna den 19 november Avgifterna baserar sig på lagen om grunderna för avgifter till staten och de är inte momspliktiga. I den händelse att flera parallella fall de facto avgörs under en och samma ärendebehandling, kan avgifterna jämkas.

9 ÅTGÄRDSTARIFF (15) BILAGA 1 ÅTGÄRDSAVGIFTER FÖR HANDLÄGGNING AV ANSÖKNINGAR OM GODKÄNNANDE AV KREDITVÄRDERINGSFÖRETAG ENLIGT 58 I KREDITINSTITUTSLAGEN Den åtgärdsavgift för godkännande av kreditvärderingsföretag enligt 58 i kreditinstitutslagen som Finansinspektionen tar ut beror på den tid det tar att utvärdera kreditbetygen. Finansinspektionen kan välja att 1) själv göra utvärderingen, 2) tillsammans med en annan tillsynsmyndighet utvärdera sökanden och sedan tillämpa utvärderingen i sin egen godkännandeprocess eller 3) anta en utvärdering gjord i en annan medlemsstat som underlag för sitt beslut. Åtgärdsavgifterna har därför grupperats i tre avgiftsklasser. Finansinspektionen kan godkänna kreditvärderingsföretag för olika marknadssegment. Dessa är offentlig sektor och näringsliv (inklusive finansiella företag) samt strukturerad finansiering. I punkterna 1 3 nedan redovisas åtgärdsavgifterna för prövning av kreditvärderingsföretag i det fall att godkännande för båda marknadssegmenten söks med en och samma ansökan. Punkt 4 belyser hur åtgärdsavgiften bestäms i situationer där godkännande söks endast för ett av segmenten. 1) Finansinspektionen prövar ärendet själv Åtgärdsavgiften är ) Finansinspektionen medverkar i en gemensam prövning Åtgärdsavgiften är ) Finansinspektionen godkänner en kreditbetygsprövning från ett annat land Åtgärdsavgiften är ) Godkännande av ett segment Om godkännande söks endast för ett marknadssegment antingen för offentlig sektor och näringsliv eller för strukturerad finansiering blir åtgärdsavgiften hälften (½) av de respektive åtgärdsavgifterna i punkterna 1 3 ovan, dvs , eller För exportkreditorgan gäller inte samma godkännanderutiner som för andra kreditvärderingsföretag, och därför tar Finansinspektionen inte ut någon åtgärdsavgift för godkännande i dessa fall. Åtgärdsavgiften skall betalas av det kreditvärderingsföretag som har sökt godkännande för sina kreditvärderingar eller av det tillsynsobjekt som har sökt godkännande för ett kreditvärderingsföretags räkning.

10 ÅTGÄRDSTARIFF (15) BILAGA 2 ÅTGÄRDSAVGIFTER FÖR HANDLÄGGNING AV ANSÖKNINGAR OM TILLSTÅND FÖR ANVÄNDNING AV INTERNMETOD ENLIGT 59 I KREDITINSTITUTSLAGEN Åtgärdsavgifterna för tillstånd att använda internmetoder (IRB) enligt 59 i kreditinstitutslagen (121/2007) fastställs enligt följande principer. I avsnitt 2 behandlas avgiftsgrunderna i de fall där Finansinspektionen handlägger ansökan själv och i avsnitt 3 fall där beslut om tillstånd fattas i samråd med någon utländsk tillsynsmyndighet. 1. BERÄKNING AV KOSTNADSUNDERLAGET FÖR ÅTGÄRDSAVGIFTEN För handläggning av ansökningar om tillstånd att använda IRB tar Finansinspektionen ut en åtgärdsavgift endast för den del av handläggningskostnaden som överstiger kostnaderna för normal tillsynsverksamhet. Utgångspunkten för avgiftssättningen är likabehandling av företagen under tillsyn (nedan institut). Enligt de nya kapitaltäckningsreglerna bör alla ha möjlighet att använda antingen schablonmetoden eller en IRB-metod för beräkning av kapitalkrav för kreditrisk. Även om inget tillstånd behövs för schablonmetoden måste Finansinspektionen granska kapitaltäckningsberäkningen i institut som använder den nya schablonmetoden. Det arbetet täcks dock av tillsynsavgifterna. För likvärdig behandling av de alternativa metoderna för beräkning av kapitalkrav för kreditrisk måste en viss del av granskningskostnaderna för IRB-tillstånd täckas med tillsynsavgiften. För IRB-tillstånd tas därför ut endast en avgift som motsvarar särkostnaderna för tillståndet. De kostnader som gäller både schablonmetoden och IRB-metoden beräknas motsvara ungefär hälften av handläggningskostnaderna för en IRB-ansökan. Den andra delen av handläggningskostnaderna tas ut i form av en åtgärdsavgift. 2. ÅTGÄRDSAVGIFT NÄR FINANSINSPEKTIONEN HANDLÄGGER ANSÖKAN ENSAM Faktorer som påverkar åtgärdsavgiften Faktorer som påverkar åtgärdsavgiften för handläggning av IRB-ansökan är följande: I. Storleken på den finansiella företagsgruppen under tillsyn II. Typ av IRB-tillstånd III. Ytterligare kostnadsfaktorer I. Storleken på den finansiella företagsgruppen under tillsyn Åtgärdsavgiften är beroende av kreditinstitutets storlek. Kreditinstitut med stor låneportfölj bör använda flera olika klassificeringsmetoder. Hur väl metoderna, estimeringen av riskparametrar och valideringen uppfyller minimikraven granskas metod för metod. Ett stort kreditinstitut tillämpar i regel flera exponeringsklasser (t.ex. instituts-, företags- och hushållsexponeringar) och olika klassificeringsmetoder kan användas för beräkning av varje klass. På motsvarande sätt kan små kreditinstitut ha ett fåtal exponeringsklasser och bara någon enstaka klassificeringsmetod. Företagsgruppens storlek spelar in vid tillståndsprövningen av IRB-metoden och tillsynen av dess användning. Ju större företagsgrupp, desto fler olika interna klassificeringsmetoder kan den sökande ha, och Finansinspektionen måste ta ställning till dem alla.

11 ÅTGÄRDSTARIFF (15) Instituten delas in i tre grupper: 1. K1 stora institut: summa exponeringar 10 miljarder eller mer 2. K2 medelstora institut: summa exponeringar 1 10 miljarder 3. K3 små institut: summa exponeringar under 1 miljard II. Typ av IRB-tillstånd För fastställande av avgift har IRB-tillstånden delats in i följande tillståndstyper: 1. Avancerad internmetod (AIRB) 2. Grundläggande internmetod (FIRB) 3. Tilläggstillstånd för AIRB när FIRB-tillstånd redan beviljats 4. Specialtillstånd i samband med IRB för användning av interna modeller för aktieexponeringar 5. Återkallande av IRB-tillstånd (institutet börjar använda schablonmetoden) 6. Återkallande av AIRB-tillstånd (institutet börjar använda FIRB för stats-, kreditinstituts- och företagsexponeringar) III. Tilläggsfaktorer Dessutom påverkar följande faktorer väsentligt handläggningskostnaderna för IRB-tillstånd: A. Företagsgrupperna omfattar utländska dotterbolag (filialer). Prövningen sker i dessa fall i samråd med de utländska tillsynsmyndigheterna och kräver mer resurser och insatser från Finansinspektionens sida även för samordningen av samarbetet mellan tillsynsmyndigheterna. B. Företagsgruppen kan införa IRB stegvis, enligt Finansinspektionens standard under en övergångsperiod på högst tre år. Under tre år måste Finansinspektionen således fortsätta granska de enheter och exponeringsklasser som inte omfattas av IRB-tillståndet. Finansinspektionen blir tvungen att reservera extra granskningsresurser för denna tid och tillståndsprövningen blir inte lika effektiv som vid en samtidig prövning av företagsgruppens alla metoder. Åtgärdsavgifter för IRB-tillstånd Åtgärdsavgifter för stora institut (K1) I tabellen nedan listas åtgärdsavgifterna för IRB-tillstånd till stora institut (K1). Avgiftens storlek beror på typen av IRB-tillstånd och tilläggsfaktorerna A (utländska dotterbolag) och B (stegvist införande). Handläggningskostnaderna för en FIRB-ansökan bildar basen i åtgärdsavgifterna för IRB-tillstånd. Utifrån denna basdel (basavgift) härleds avgifterna för övriga IRB-tillstånd. Basavgiften tas ut för sådana IRB-tillstånd som inte påverkas av tilläggsfaktorerna A och B. Prövningen av ansökan om FIRB-tillstånd för en stor företagsgrupp har beräknats ge upphov till särkostnader på Kostnaderna för de respektive tillståndstyperna har beräknats enligt principerna ovan. Kostnaderna ökar för varje tilläggsfaktor.

12 ÅTGÄRDSTARIFF (15) Stora institut (K1) Tilläggsfaktorer Typ av IRB-tillstånd Basavgift, Utländska dotterbolag (A) Stegvist införande (B) 1. Avancerad internmetod AIRB Grundläggande internmetod FIRB Tilläggstillstånd för AIRB Specialtillstånd (interna modeller) Återkallande av tillstånd Återkallande av AIRB-tillstånd Avgiften för FIRB-tillstånd för en företagsgrupp med utländska dotterbolag vid stegvist införande blir = Åtgärdsavgiften för AIRB-tillstånd för en sådan företagsgrupp som redan har FIRB-tillstånd blir = om gruppen inför AIRB stegvis. Den totala kostnaden för införande av AIRB via FIRB blir Denna kostnad är något högre ( ) än om AIRB-tillståndet hade beviljats direkt ( ). Detta beror på att prövningsprocessen inte är lika effektiv när Finansinspektionen blir tvungen att handlägga två separata ansökningar och planera två olika granskningar. Åtgärdsavgifter för medelstora och små institut (K2 och K3) Prövningen av tillstånd för medelstora institut kostar Finansinspektionen i genomsnitt hälften av prövningen av tillstånden för stora institut. Detta beror på att en medelstor aktör i regel inte idkar alla de former av verksamhet som är tillåtna enligt lag. På deras metoder och modeller ställs därför inte heller samma krav som på de stora institutens. Prövningen av en ansökan från ett medelstort institut har beräknats kräva 1,6 personers arbetsinsats under 6,5 månader. Också behandlingen av ärenden i Finansinspektionens ledning tar bara hälften av den tid som stora instituts ansökningar beräknas ta i anspråk. I små institut behöver endast ett fåtal exponeringsklasser och klassificeringsmetoder granskas. Detta förutsätter av Finansinspektionen uppskattningsvis 0,8 personers arbetsinsats under 6,5 månader. Tabellen ovan gäller enbart stora institut (K1). Åtgärdsavgifterna för FIRB-tillstånd för medelstora och små institut är följande: K2 medelstora institut: FIRB-tillstånd K3 små institut: FIRB-tillstånd På motsvarande sätt tas lägre kostnader ut för tilläggsfaktorerna så att tilläggsavgiften för medelstora institut blir hälften (½) och för små institut en fjärdedel (¼) av tilläggsavgiften för stora institut. I tabellen nedan visas åtgärdsavgifterna för medelstora och små institut.

13 ÅTGÄRDSTARIFF (15) Medelstora institut (K2) Tilläggsfaktorer Typ av IRB-tillstånd Basavgift, Utländska dotterbolag (A) Stegvist införande (B) 1. Avancerad internmetod AIRB Grundläggande internmetod FIRB Tilläggstillstånd för AIRB Specialtillstånd (interna modeller) Återkallande av tillstånd Återkallande av AIRB-tillstånd Små institut (K3) Tilläggsfaktorer Typ av IRB-tillstånd Basavgift, Utländska dotterbolag (A) Stegvist införande (B) 1. Avancerad internmetod AIRB Grundläggande internmetod FIRB Tilläggstillstånd för AIRB Specialtillstånd (interna modeller) Återkallande av tillstånd Återkallande av AIRB-tillstånd ÅTGÄRDSAVGIFTER NÄR FINANSINSPEKTIONEN DELTAR I PRÖVNINGEN AV IRB-ANSÖKAN TILLSAMMANS MED ANDRA TILLSYNSMYNDIGHETER I den nya kreditinstitutslagen förutsätts att besluten om IRB-tillstånd för gränsöverskridande företagsgrupper skall fattas i samråd med tillsynsmyndigheterna i de olika länderna. Samarbetet samordnas av tillsynsmyndigheten i kreditinstitutets hemstat. Finansinspektionen följer principerna nedan vid beslut om IRB-tillstånd för institut med utländska moderbolag. Finansinspektionen tar ut en åtgärdsavgift vars storlek beror på prövningskostnaderna. De beror på om Finansinspektionen deltar i den gemensamma IRB-prövningen eller om inspektionen endast tar del av material som den fått av hemlandsmyndigheten. Beslutet att bevilja tillstånd eller avslå ansökan fattas i samråd med de andra tillsynsmyndigheterna, men tillståndet för företagsgruppen beviljar hemlandsmyndigheten. Värdlandsmyndigheten för sin del bekräftar med sitt tillstånd rätten för enskilda dotterbolag att använda IRB-metoden. Finansinspektionen har deltagit i de gemensamma prövningsprocesserna för sådana dotterbolag/filialer till utländska kreditinstitut som till sin storlek är betydande för den finska marknaden. Detta följer av Finansinspektionens lagstadgade uppgift att svara för stabiliteten på och förtroendet för finansmarknaden i Finland.

14 Faktorer som påverkar åtgärdsavgiften ÅTGÄRDSTARIFF (15) Faktorer som påverkar åtgärdsavgiften för handläggning av IRB-ansökan är följande: I. Graden av medverkan från Finansinspektionen II. Typ av IRB-tillstånd III. Stegvist införande I. Graden av medverkan från Finansinspektionen Finansinspektionen deltar som medlem av granskningsgruppen i prövningen av tillstånd samordnad av den utländska hemlandsmyndigheten, när det dotterbolag/den filial som står under inspektionens tillsyn är betydande för den finska marknaden. I prövningen av tillstånd för små dotterbolag deltar Finansinspektionen inte men får av hemlandsmyndigheten information om prövningen. Efter att ha tagit del av informationen bekräftar Finansinspektionen tillståndet för dotterbolaget att använda IRB i enlighet med de villkor som har ställts i tillståndet till moderbolaget. II. Typ av IRB-tillstånd För fastställande av avgiften har IRB-tillstånden delats in i följande tillståndstyper: 1. Avancerad internmetod (AIRB) 2. Grundläggande internmetod (FIRB) 3. Tilläggstillstånd för AIRB när FIRB-tillstånd redan beviljats 4. Specialtillstånd vid IRB för användning av interna modeller för aktieexponeringar III. Stegvist införande Finansinspektionen ser stegvist införande som en kostnadshöjande faktor, eftersom inspektionen efter det att IRB-tillstånd redan beviljats blir tvungen att delta i granskningen av de enheter och exponeringsklasser som inte omfattas av IRB-tillståndet. Processen kan inte slutföras lika effektivt som vid en samtidig prövning av företagsgruppens alla metoder. Åtgärdsavgifter för IRB-tillstånd I tabellen nedan listas avgifterna för IRB-tillstånd till sådana kreditinstitut under Finansinspektionens tillsyn vars moderbolag är utländska och vars ansökan om IRB-tillstånd prövas under samordning av hemlandsmyndigheten. Finansinspektionen tar däremot inte ut någon särskild åtgärdsavgift om det utländska kreditinstitutet driver verksamhet i Finland genom filial. I de fall då Finansinspektionen deltar i prövningsprocessen baseras avgifterna på en kostnadskalkyl över särkostnaderna för deltagandet. Basdelen i avgiften för IRB-tillstånd är FIRB-avgiften, som är och motsvarar den genomsnittliga kostnaden för handläggning av en ansökan. Basavgiften tas ut för sådana IRB-tillstånd som inte omfattar stegvist införande. Avgiften för varje tillståndstyp är kostnadsbaserad i likhet med FIRB-avgiften. När prövningen gäller stegvist införande blir kostnaderna högre. I de fall när Finansinspektionen inte deltar i prövningsarbetet utan endast tar del av materialet från hemlansmyndigheten och bekräftar tillståndet enligt hemlandsmyndighetens beslut, tar inspektionen ut

15 ÅTGÄRDSTARIFF (15) en åtgärdsavgift enligt avgiftsklassen för tidsåtgången. en står inom parentes i tabellen nedan. Finansinspektionen deltar i prövningen Finansinspektionen deltar inte i prövningen Basavgift, Tilläggsavgift, Åtgärdsavgift AIRB (avgiftsklass 5) FIRB (avgiftsklass 4) Tilläggstillstånd för AIRB (avgiftsklass 2) Specialtillstånd Avgiften för FIRB-tillstånd för en företagsgrupp som inför metoden stegvis blir då = Åtgärdsavgiften för AIRB-tillstånd för en dylik företagsgrupp som redan har FIRB-tillstånd blir = om gruppen inför AIRB stegvis. Den samlade kostnaden för införande av AIRB via FIRB blir Denna kostnad är något högre (5 000 ) än om AIRB-tillståndet hade beviljats direkt ( ). Detta beror på att prövningsprocessen inte är lika effektiv när Finansinspektionen blir tvungen att handlägga två separata ansökningar och planera två olika granskningar.

Finansinspektionens åtgärdsavgifter fr.o.m. 31.12.2011

Finansinspektionens åtgärdsavgifter fr.o.m. 31.12.2011 1 (32) Finansinspektionens åtgärdsavgifter fr.o.m. 31.12.2011 Värdepappersmarknadslag (VPML 495/1989) Prospekt enligt EU-kommissionens prospektförordning (EG) nr 809/2004 Godkännande av prospekt för aktier

Läs mer

6 och 21 (KIL 39 och 5) (KIL 26 och 26 a ) Tillstånd för ett värdepappersföretag att inrätta en filial i en stat utanför EES

6 och 21 (KIL 39 och 5) (KIL 26 och 26 a ) Tillstånd för ett värdepappersföretag att inrätta en filial i en stat utanför EES FINANSINSPEKTIONEN ÅTGÄRDSTARIFF 1.10.2003 1 (5) FINANSINSPEKTIONENS ÅTGÄRDSAVGIFTER Lag om värdepappersföretag (VPFL) Dispens beträffande omfattningen av ett koncernbokslut eller en konsolideringsgrupp

Läs mer

Finansinspektionens åtgärdsgifter fr.o.m

Finansinspektionens åtgärdsgifter fr.o.m 1 (27) Finansinspektionens åtgärdsgifter fr.o.m. 1.5.2010 Värdepappersmarknadslag (VPML 495/1989) Prospekt enligt EU-kommissionens prospektförordning (EG) nr 809/2004 Godkännande av prospekt för aktier

Läs mer

Finansinspektionens åtgärdsavgifter fr.o.m

Finansinspektionens åtgärdsavgifter fr.o.m 1 (31) Finansinspektionens åtgärdsavgifter fr.o.m. 24.1.2011 Värdepappersmarknadslag (VPML 495/1989) Prospekt enligt EU-kommissionens prospektförordning (EG) nr 809/2004 Godkännande av prospekt för aktier

Läs mer

FINANSINSPEKTIONENS ÅTGÄRDSAVGIFTER FR.O.M

FINANSINSPEKTIONENS ÅTGÄRDSAVGIFTER FR.O.M FINANSINSPEKTIONEN 1 (23) FINANSINSPEKTIONENS ÅTGÄRDSAVGIFTER FR.O.M. 9.1.2009 Värdepappersmarknadslag (VPML 495/1989) Prospekt enligt EU-kommissionens prospektförordning (EG) nr 809/2004 Godkännande av

Läs mer

Finansinspektionens åtgärdsavgifter fr.o.m

Finansinspektionens åtgärdsavgifter fr.o.m 26.4.2013 FIVA 2/00.04.01/2013 1 (33) Finansinspektionens åtgärdsavgifter fr.o.m. 26.4.2013 Värdepappersmarknadslag (VPML 495/1989) Prospekt enligt EU-kommissionens prospektförordning (EG) nr 809/2004

Läs mer

Finansinspektionens åtgärdsavgifter fr.o.m

Finansinspektionens åtgärdsavgifter fr.o.m 1 (37) Finansinspektionens åtgärdsavgifter fr.o.m. 1.5.2015 Finansinspektionens åtgärdstariff av den 1 maj 2015 har uppdaterats enligt ändringarna i försäkringsbolagslagen med anledning av Solvens II (se

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING Utgiven i Helsingfors den 14 december 2011 1244/2011 Lag om ändring av kreditinstitutslagen Utfärdad i Helsingfors den 9 december 2011 I enlighet med riksdagens beslut ändras

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövning av ärenden hos Finansinspektionen; SFS 2013:1109 Utkom från trycket den 20 december 2013 utfärdad den

Läs mer

FÖRESKRIFT OM KONCERNBOKSLUT I KREDITINSTITUT

FÖRESKRIFT OM KONCERNBOKSLUT I KREDITINSTITUT tills vidare 1 (7) Till kreditinstituten Till kreditinstitutens holdingsammanslutningar FÖRESKRIFT OM KONCERNBOKSLUT I KREDITINSTITUT Finansinspektionen meddelar med stöd av 4 2 punkten lagen om finansinspektionen

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i lagen (2004:297) om bank- och finansieringsrörelse; SFS 2013:455 Utkom från trycket den 12 juni 2013 utfärdad den 30 maj 2013. Enligt riksdagens beslut 1 föreskrivs

Läs mer

FÖRESKRIFT OM RAPPORTERING AV STORA EXPONERINGAR OCH KONSOLIDERADE STORA EXPONERINGAR

FÖRESKRIFT OM RAPPORTERING AV STORA EXPONERINGAR OCH KONSOLIDERADE STORA EXPONERINGAR tills vidare 1 (17) Till kreditinstituten Till holdingsammanslutningarna FÖRESKRIFT OM RAPPORTERING AV STORA EXPONERINGAR OCH KONSOLIDERADE STORA EXPONERINGAR Finansinspektionen meddelar med stöd av 4

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING 2007 Utgiven i Helsingfors den 14 februari 2007 Nr 121 151 INNEHÅLL Nr Sidan 121 Kreditinstitutslag... 378 122 Lag om ändring av lagen om affärsbanker och andra kreditinstitut

Läs mer

FÖRESKRIFT OM KONCERNBOKSLUT I VÄRDEPAPPERSFÖRETAG

FÖRESKRIFT OM KONCERNBOKSLUT I VÄRDEPAPPERSFÖRETAG tills vidare 1 (7) Till värdepappersföretagen Till värdepappersföretagens holdingsammanslutningar FÖRESKRIFT OM KONCERNBOKSLUT I VÄRDEPAPPERSFÖRETAG Finansinspektionen meddelar med stöd av 4 2 punkten

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i lagen (2004:297) om bank- och finansieringsrörelse; SFS 2006:1387 Utkom från trycket den 15 december 2006 utfärdad den 7 december 2006. Enligt riksdagens beslut

Läs mer

Lag. RIKSDAGENS SVAR 186/2004 rd

Lag. RIKSDAGENS SVAR 186/2004 rd RIKSDAGENS SVAR 186/2004 rd Regeringens proposition med förslag till lag om tillsynsavgift till Finansinspektionen och till lag om ändring av lagen om Finansinspektionen Ärende Regeringen har till riksdagen

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om värdepappersfonder; utfärdad den 19 juni 2013. SFS 2013:588 Utkom från trycket den 28 juni 2013 Regeringen föreskriver följande. Tillämpningsområde 1 Denna förordning

Läs mer

FÖRESKRIFT OM KONSOLIDERAT BOKSLUT FÖR SAMMANSLUTNINGEN AV ANDELSBANKER

FÖRESKRIFT OM KONSOLIDERAT BOKSLUT FÖR SAMMANSLUTNINGEN AV ANDELSBANKER tills vidare 1 (8) Till det centralinstitut som avses i andelsbankslagen FÖRESKRIFT OM KONSOLIDERAT BOKSLUT FÖR SAMMANSLUTNINGEN AV ANDELSBANKER Finansinspektionen meddelar med stöd av 7 m 2 mom. andelsbankslagen

Läs mer

ANVISNING OM DELÅRSRAPPORTERING I KREDIT- INSTITUT SOM ÄR FÖREMÅL FÖR OFFENTLIG HANDEL

ANVISNING OM DELÅRSRAPPORTERING I KREDIT- INSTITUT SOM ÄR FÖREMÅL FÖR OFFENTLIG HANDEL tills vidare 1(6) Till kreditinstituten Till kreditinstitutens holdingsammanslutningar ANVISNING OM DELÅRSRAPPORTERING I KREDIT- INSTITUT SOM ÄR FÖREMÅL FÖR OFFENTLIG HANDEL Finansinspektionen meddelar

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i lagen (2006:1371) om kapitaltäckning och stora exponeringar; SFS 2007:570 Utkom från trycket den 27 juni 2007 utfärdad den 14 juni 2007. Enligt riksdagens beslut

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING Utgiven i Helsingfors den 14 augusti 2014 610/2014 Kreditinstitutslag Utfärdad i Helsingfors den 8 augusti 2014 I enlighet med riksdagens beslut föreskrivs: AVDELNING I RÄTT

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i lagen (1994:2004) om kapitaltäckning och stora exponeringar för kreditinstitut och värdepappersbolag; SFS 2006:536 Utkom från trycket den 14 juni 2006 utfärdad

Läs mer

Standard 4.3c. Kapitalkrav för kreditrisker enligt schablonmetoden. Föreskrifter och allmänna råd

Standard 4.3c. Kapitalkrav för kreditrisker enligt schablonmetoden. Föreskrifter och allmänna råd Standard 4.3c Kapitalkrav för kreditrisker enligt schablonmetoden Föreskrifter och allmänna råd FINANSINSPEKTIONEN 4 Kapitaltäckning och riskhantering tills vidare enligt schablonmetoden dnr 12/120/2006

Läs mer

Standard RA1.6. Anmälan om utläggning av verksamhet. Föreskrifter och allmänna råd

Standard RA1.6. Anmälan om utläggning av verksamhet. Föreskrifter och allmänna råd Standard RA1.6 Anmälan om utläggning av verksamhet Föreskrifter och allmänna råd Så här läser du standarderna Standarderna är en samling föreskrifter och allmänna råd som är bindande eller riktgivande

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING Utgiven i Helsingfors den 30 december 2011 1494/2011 Lag om ändring av lagen om Finansinspektionens tillsynsavgift Utfärdad i Helsingfors den 29 december 2011 I enlighet med

Läs mer

0 procent. 0 procent

0 procent. 0 procent Nr 1373 4573 Bilaga TILLÄMPLIGA RISKVIKTER I Vid tillämpning av den schablonmetod som avses i lagens 58 skall tillgångarna och åtagandena utanför balansräkningen viktas som följer: Fordringar på stater

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i lagen (2013:561) om förvaltare av alternativa investeringsfonder; SFS 2015:397 Utkom från trycket den 26 juni 2015 utfärdad den 17 juni 2015. Enligt riksdagens

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövning av ärenden hos Finansinspektionen; SFS 2004:1235 Utkom från trycket den 17 december 2004 utfärdad den

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING Utgiven i Helsingfors den 28 juli 2011 903/2011 Lag om ändring av lagen om Finansinspektionens tillsynsavgift Utfärdad i Nådendal den 22 juli 2011 I enlighet med riksdagens

Läs mer

Föreskrifter och anvisningar 14/2013

Föreskrifter och anvisningar 14/2013 Föreskrifter och anvisningar 14/2013 Handelsparter från tredjeland Dnr FIVA 15/01.00/2013 Utfärdade 10.6.2013 Gäller från 1.7.2013 FINANSINSPEKTIONEN telefon 010 831 51 fax 010 831 5328 fornamn.efternamn@finanssivalvonta.fi

Läs mer

Standard RA6.1. Verksamhet som bedrivs av betalningsinstitut och personer som utan auktorisation tillhandahåller betaltjänster

Standard RA6.1. Verksamhet som bedrivs av betalningsinstitut och personer som utan auktorisation tillhandahåller betaltjänster Standard RA6.1 Verksamhet som bedrivs av betalningsinstitut och personer som utan auktorisation tillhandahåller betaltjänster Föreskrifter och allmänna råd Så här läser du standarderna Standarden är en

Läs mer

Föreskrifter och anvisningar: Beräkning av kapitaltäckning och stora exponeringar

Föreskrifter och anvisningar: Beräkning av kapitaltäckning och stora exponeringar Föreskrifter och anvisningar: Beräkning av kapitaltäckning och stora exponeringar Bilaga 1 Anvisningar för IRB-ansökan Dnr FIVA/18/01.00/2013 Utfärdade 9.12.2013 Gäller från 1.1.2014 FINANSINSPEKTIONEN

Läs mer

Föreskrift om rapportering av avslut i värdepapper

Föreskrift om rapportering av avslut i värdepapper skuggning 1 (5) Till fondbörserna, värdepappersföretagen och kreditinstituten, till utländska kreditinstitut och värdepappersföretag samt övriga marknadsplatser för offentlig handel Föreskrift om rapportering

Läs mer

Svensk författningssamling

Svensk författningssamling 0994.fm Page 1 Tuesday, uly 1, 2014 1:52 PM Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövningen av ärenden hos Finansinspektionen; Utkom från trycket den

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING Utgiven i Helsingfors den 27 mars 2015 305/2015 Lag om ändring av lagen om utländska försäkringsbolag Utfärdad i Helsingfors den 20 mars 2015 I enlighet med riksdagens beslut

Läs mer

Föreskrift om rapportering av avslut i räntebärande värdepapper

Föreskrift om rapportering av avslut i räntebärande värdepapper genom skuggning 1 (5) Till värdepappersföretagen, fondbörserna och kreditinstituten, till utländska kreditinstitut och värdepappersföretag samt övriga marknadsplatser för offentlig handel Föreskrift om

Läs mer

SV BILAGA XIII. RAPPORTERING OM LIKVIDITET (DEL 5 av 5: STABIL FINANSIERING)

SV BILAGA XIII. RAPPORTERING OM LIKVIDITET (DEL 5 av 5: STABIL FINANSIERING) BILAGA XIII RAPPORTERING OM LIKVIDITET (DEL 5 av 5: STABIL FINANSIERING) 1. Poster som ger stabil finansiering 1.1. Allmänna kommentarer 1. Detta är en sammanfattande mall som innehåller information om

Läs mer

Standard 4.3h. Kapitalkrav för värdepapperisering. Föreskrifter och allmänna råd

Standard 4.3h. Kapitalkrav för värdepapperisering. Föreskrifter och allmänna råd Standard 4.3h Kapitalkrav för värdepapperisering Föreskrifter och allmänna råd FINANSINSPEKTIONEN 4 Kapitaltäckning och riskhantering tills vidare dnr 4/120/2007 2 (2) INNEHÅLL 1 Tillämpning 5 Övergångsbestämmelser

Läs mer

Lag. om ändring av lagen om Finansinspektionens tillsynsavgift

Lag. om ändring av lagen om Finansinspektionens tillsynsavgift Lag om ändring av lagen om Finansinspektionens tillsynsavgift I enlighet med riksdagens beslut ändras i lagen om Finansinspektionens tillsynsavgift (879/2008) 1 1 mom. 9 punkten, 4 1 mom., 5 1 mom. och

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövning av ärenden hos Finansinspektionen; SFS 2003:514 Utkom från trycket den 15 juli 2003 utfärdad den 26 juni

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om statliga garantier till banker m.fl.; SFS 2008:819 Utkom från trycket den 30 oktober 2008 utfärdad den 29 oktober 2008. Regeringen föreskriver följande. Inledande

Läs mer

Finansinspektionen rekommenderar att anmälan lämnas in i god tid innan beslutet om utnämning fattas eller det nya uppdraget tas emot.

Finansinspektionen rekommenderar att anmälan lämnas in i god tid innan beslutet om utnämning fattas eller det nya uppdraget tas emot. Ankomstdatum FIT & PROPER-blankett S3 DNR Lämplighetsprövning Denna blankett används av de anmälningsskyldiga i värdepappersföretag och deras utländska filialer holdingföretag för värdepappersföretag fondbörser

Läs mer

Standard 4.3c. Kapitalkrav för krediter enligt schablonmetoden. Föreskrifter och allmänna råd

Standard 4.3c. Kapitalkrav för krediter enligt schablonmetoden. Föreskrifter och allmänna råd Standard 4.3c Kapitalkrav för krediter enligt Föreskrifter och allmänna råd Så här läser du standarderna Standarderna är en samling föreskrifter och allmänna råd som är bindande eller riktgivande för företagen

Läs mer

Europeiska unionens officiella tidning

Europeiska unionens officiella tidning 5.7.2014 L 198/7 EUROPEISKA CENTRALBANKENS BESLUT av den 31 januari 2014 om nära samarbete med nationella behöriga myndigheter i deltagande medlemsstater som inte har euron som valuta (ECB/2014/5) (2014/434/EU)

Läs mer

Finansinspektionens författningssamling

Finansinspektionens författningssamling Remissexemplar 2013-10-14 Finansinspektionens författningssamling Utgivare: Finansinspektionen, Sverige, www.fi.se ISSN 1102-7460 Finansinspektionens föreskrifter om tillsynskrav för kreditinstitut och

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om statliga garantier till banker m.fl.; SFS Utkom från trycket den utfärdad den X oktober 2008 Regeringen föreskriver följande. Inledande bestämmelse 1 I denna förordning

Läs mer

Standard RA1.2. Förvärv av bestämmande inflytande i företag utanför Europeiska ekonomiska samarbetsområdet. Föreskrifter och allmänna råd

Standard RA1.2. Förvärv av bestämmande inflytande i företag utanför Europeiska ekonomiska samarbetsområdet. Föreskrifter och allmänna råd Standard RA1.2 Förvärv av bestämmande inflytande i Föreskrifter och allmänna råd FINANSINSPEKTIONEN tills vidare dnr 5/120/2006 2 (2) INNEHÅLL 1 Tillämpning 3 2 Syfte 4 3 Rättsgrund och internationella

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i lagen (2013:561) om förvaltare av alternativa investeringsfonder; SFS 2014:798 Utkom från trycket den 27 juni 2014 utfärdad den 19 juni 2014. Enligt riksdagens

Läs mer

Statsrådets förordning

Statsrådets förordning Statsrådets förordning om beräkning av ett finans- och försäkringskonglomerats kapitaltäckning I enlighet med statsrådets beslut föreskrivs med stöd av 20 5 mom. i lagen om tillsyn över finans- och försäkringskonglomerat

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i lagen (2004:297) om bank- och finansieringsrörelse; SFS 2015:184 Utkom från trycket den 9 april 2015 utfärdad den 26 mars 2015. Enligt riksdagens beslut 1 föreskrivs

Läs mer

Granskning av metoder för att mäta kreditrisk och operativ risk (prop. 2004/05: 153)

Granskning av metoder för att mäta kreditrisk och operativ risk (prop. 2004/05: 153) Finansutskottets betänkande 2004/05:FiU33 Granskning av metoder för att mäta kreditrisk och operativ risk (prop. 2004/05: 153) Sammanfattning År 2007 förväntas nya kapitaltäckningsregler (EG-direktiv)

Läs mer

Nya kapitaltäckningsregler. Del 2

Nya kapitaltäckningsregler. Del 2 Regeringens proposition 2006/07:5 Prop. 2006/07:5 Nya kapitaltäckningsregler Del 2 Innehållsförteckning Prop. 2006/07:5 Bilaga 1 Bilaga 2 Bilaga 3 Bilaga 4 Bilaga 5 Bilaga 6 Bilaga 7 Lagförslagen i promemorian

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövning av ärenden hos Finansinspektionen; SFS 2004:95 Utkom från trycket den 9 mars 2004 utfärdad den 26 februari

Läs mer

Finansinspektionens författningssamling

Finansinspektionens författningssamling Remissexemplar 2016-12-20 Finansinspektionens författningssamling Utgivare: Finansinspektionen, Sverige, www.fi.se ISSN 1102-7460 Finansinspektionens allmänna råd om tillstånd för kreditinstitut utanför

Läs mer

Föreskrifter och anvisningar 12/2013

Föreskrifter och anvisningar 12/2013 Föreskrifter och anvisningar 12/2013 Transaktionsrapportering Dnr FIVA 13/01.00/2013 Utfärdade 10.6.2013 Gäller från 1.7.2013 FINANSINSPEKTIONEN telefon 010 831 51 fax 010 831 5328 fornamn.efternamn@finanssivalvonta.fi

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING 2007 Utgiven i Helsingfors den 31 oktober 2007 Nr 922 941 INNEHÅLL Nr Sidan 922 Lag om värdepappersföretag... 4011 923 Lag om ändring av värdepappersmarknadslagen... 4039 924

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om förvaltare av alternativa investeringsfonder; utfärdad den 19 juni 2013. SFS 2013:561 Utkom från trycket den 28 juni 2013 Enligt riksdagens beslut 1 föreskrivs 2 följande.

Läs mer

STADGAR [1] Placeringsfond. Aktuella stadgar för fonden har fastställts Stadgarna gäller från och med

STADGAR [1] Placeringsfond. Aktuella stadgar för fonden har fastställts Stadgarna gäller från och med STADGAR [1] Placeringsfond Aktuella stadgar för fonden har fastställts 2016.01.12. Stadgarna gäller från och med 2016.03.01. -placeringsfond, stadgar Fondens stadgar består av dessa fondspecifika stadgar

Läs mer

STADGAR [1] Placeringsfond. Aktuella stadgar för fonden har fastställts Stadgarna gäller från och med

STADGAR [1] Placeringsfond. Aktuella stadgar för fonden har fastställts Stadgarna gäller från och med STADGAR [1] Placeringsfond Aktuella stadgar för fonden har fastställts 2016.01.12. Stadgarna gäller från och med 2016.03.01. -placeringsfond, stadgar Fondens stadgar består av dessa fondspecifika stadgar

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövning av ärenden hos Finansinspektionen; SFS 2002:150 Utkom från trycket den 16 april 2002 utfärdad den 4 april

Läs mer

pelare 3 Årlig information om risk och kapitalhantering FOREX BANK AB XXXXXXXXXXXXXX 1

pelare 3 Årlig information om risk och kapitalhantering FOREX BANK AB XXXXXXXXXXXXXX 1 pelare 3 FOREX BANK AB 2009 Årlig information om risk och kapitalhantering FOREX BANK AB XXXXXXXXXXXXXX 1 Inledning FOREX Bank AB, 516406-0104, är moderbolag i FOREX-koncernen (FOREX). Detta dokument utgör

Läs mer

Lag. om ändring av värdepappersmarknadslagen

Lag. om ändring av värdepappersmarknadslagen Lag om ändring av värdepappersmarknadslagen I enlighet med riksdagens beslut upphävs i värdepappersmarknadslagen (746/2012) 1 kap. 1 mom. 8 punkten, 13 och 14 kap., 15 kap. 2 mom. och 16 kap. 3, av dem

Läs mer

Pohjola Corporate Finance Ab

Pohjola Corporate Finance Ab Pohjola Corporate Finance Ab 1 (2) UPPFÖRANDEREGLER ANGÅENDE KUNDKATEGORISERING, INFORMATIONSSKYLDIGHET OCH UTREDNINGSPLIKT VID TILLHANDAHÅLLANDE AV INVESTERINGSTJÄNSTER 1. ALLMÄNT OM KATEGORISERINGEN

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING Utgiven i Helsingfors den 17 december 2012 765/2012 Lag om ändring av lagen om placeringsfonder Utfärdad i Helsingfors den 14 december 2012 I enlighet med riksdagens beslut

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövning av ärenden hos Finansinspektionen; SFS 2015:309 Utkom från trycket den 5 juni 2015 utfärdad den 28 maj

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2002:1042) om årliga avgifter för finansiering av Finansinspektionens verksamhet; SFS 2007:739 Utkom från trycket den 16 oktober 2007 utfärdad

Läs mer

ANVISNING OM DELÅRSRAPPORTERING I VÄRDEPAPPERS- FÖRETAG SOM ÄR FÖREMÅL FÖR OFFENTLIG HANDEL

ANVISNING OM DELÅRSRAPPORTERING I VÄRDEPAPPERS- FÖRETAG SOM ÄR FÖREMÅL FÖR OFFENTLIG HANDEL tills vidare 1(6) Till värdepappersföretagen Till värdepappersföretagens holdingsammanslutningar ANVISNING OM DELÅRSRAPPORTERING I VÄRDEPAPPERS- FÖRETAG SOM ÄR FÖREMÅL FÖR OFFENTLIG HANDEL Finansinspektionen

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövning av ärenden hos Finansinspektionen; SFS 2005:1131 Utkom från trycket den 20 december 2005 utfärdad den

Läs mer

STADGAR [1] Placeringsfond. Aktuella stadgar för fonden har fastställts Stadgarna gäller från och med

STADGAR [1] Placeringsfond. Aktuella stadgar för fonden har fastställts Stadgarna gäller från och med STADGAR [1] Placeringsfond Aktuella stadgar för fonden har fastställts 2016.01.12. Stadgarna gäller från och med 2016.03.01. -placeringsfond, stadgar Fondens stadgar består av dessa fondspecifika stadgar

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING Utgiven i Helsingfors den 17 december 2012 746/2012 Värdepappersmarknadslag Utfärdad i Helsingfors den 14 december 2012 I enlighet med riksdagens beslut föreskrivs: I AVDELNINGEN

Läs mer

Utdrag ur protokoll vid sammanträde 2011-03-10. Ändrade kapitaltäckningsregler

Utdrag ur protokoll vid sammanträde 2011-03-10. Ändrade kapitaltäckningsregler LAGRÅDET Utdrag ur protokoll vid sammanträde 2011-03-10 Närvarande: F.d. justitierådet Bo Svensson, f.d. regeringsrådet Leif Lindstam och justitierådet Ann-Christine Lindeblad. Ändrade kapitaltäckningsregler

Läs mer

FONDBESTÄMMELSER FÖR AP7 RÄNTEFOND. 1 Fondens rättsliga ställning

FONDBESTÄMMELSER FÖR AP7 RÄNTEFOND. 1 Fondens rättsliga ställning FONDBESTÄMMELSER FÖR AP7 RÄNTEFOND Godkända av Finansinspektionen den 31 mars 2017 1 Fondens rättsliga ställning AP7 Räntefond (Fonden) är en s.k. syntetisk värdepappersfond (prop. 1997/98:151 s. 421,

Läs mer

KRITERIER FÖR KATEGORISERING AV KUNDER Giltigt från 1.1.2013

KRITERIER FÖR KATEGORISERING AV KUNDER Giltigt från 1.1.2013 A. Icke-professionell kund Andra kunder än sådana som är professionella kunder eller godtagbara motparter. B. Professionell kund 1. Företag/sammanslutningar Företag som med stöd av koncession bedriver

Läs mer

Lag om europaandelslag

Lag om europaandelslag Liite 4 Lagförslag Lag om europaandelslag I enlighet med riksdagens beslut föreskrivs: 1 Tillämpliga bestämmelser och tillämpningsområde På ett europaandelslag tillämpas rådets förordning (EG) nr 1435/2003

Läs mer

Standard RA4.10. Rapportering av exponeringar mot närstående. Föreskrifter och allmänna råd

Standard RA4.10. Rapportering av exponeringar mot närstående. Föreskrifter och allmänna råd Standard RA4.10 Rapportering av exponeringar mot närstående Föreskrifter och allmänna råd FINANSINSPEKTIONEN tills vidare närstående dnr 14/120/2006 2 (2) INNEHÅLL 1 Tillämpning 3 2 Syfte 4 3 Internationella

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i försäkringsrörelseförordningen (1982:790); SFS 1999:690 Utkom från trycket den 6 juli 1999 utfärdad den 10 juni 1999. Regeringen föreskriver i fråga om

Läs mer

Finansinspektionens författningssamling

Finansinspektionens författningssamling Finansinspektionens författningssamling Utgivare: Finansinspektionen, Sverige, www.fi.se ISSN 1102-7460 Finansinspektionens föreskrifter om tillsynskrav och kapitalbuffertar; FFFS 2014:12 Utkom från trycket

Läs mer

Kapitaltäckning och likviditet 2014-09

Kapitaltäckning och likviditet 2014-09 Kapitaltäckning och likviditet 2014-09 Periodisk information per 30 september 2014 - Kapitaltäckning och likviditet Denna information om kapitaltäckning och likviditet för Ikano Bank AB (Publ), organisationsnummer

Läs mer

TILLÄGGSUPPGIFTER OM KUNDKATEGORISERING OCH DESS INVERKAN:

TILLÄGGSUPPGIFTER OM KUNDKATEGORISERING OCH DESS INVERKAN: TILLÄGGSUPPGIFTER OM KUNDKATEGORISERING OCH DESS INVERKAN: 1. ALLMÄNT OM KATEGORISERINGEN AV KUNDER Enligt lagen om investeringstjänster ska tillhandahållare av investeringstjänster, t.ex. en bankeller

Läs mer

Finansinspektionens författningssamling

Finansinspektionens författningssamling Finansinspektionens författningssamling Utgivare: Finansinspektionen, Sverige, www.fi.se ISSN 1102-7460 Finansinspektionens föreskrifter och allmänna råd om särskild tillsyn över finansiella konglomerat;

Läs mer

Stockholm den 25 september 2013

Stockholm den 25 september 2013 Stockholm den 25 september 2013 Ändring av fondbestämmelser HealthInvest Value Fund HealthInvest Partners har erhållit Finansinspektionens godkännande att genomföra ändringar i fondbestämmelserna för HealthInvest

Läs mer

Föreskrift om kreditinstitutens utländska filialer och tillhandahållande av tjänster i utlandet

Föreskrift om kreditinstitutens utländska filialer och tillhandahållande av tjänster i utlandet tills vidare 1 (6) Till kreditinstituten Föreskrift om kreditinstitutens utländska filialer och tillhandahållande av tjänster i utlandet Finansinspektionen meddelar med stöd av 4 2 punkten och 11 2 mom.

Läs mer

Föreskrifter och anvisningar 6/2016

Föreskrifter och anvisningar 6/2016 Föreskrifter och anvisningar 6/2016 Föreskrifter och anvisningar om informationsskyldighet Dnr FIVA 6/01.00/2016 Utfärdade 7.6.2016 Gäller från 3.7.2016 FINANSINSPEKTIONEN telefon 010 831 51 fax 010 831

Läs mer

Lag. om ändring av 1 och 6 i lagen om Finansinspektionens tillsynsavgift

Lag. om ändring av 1 och 6 i lagen om Finansinspektionens tillsynsavgift Lag om ändring av 1 och 6 i lagen om Finansinspektionens tillsynsavgift I enlighet med riksdagens beslut ändras i lagen om Finansinspektionens tillsynsavgift (879/2008) 1 1 mom. 20 punkten och 6 1 mom.,

Läs mer

Lag. RIKSDAGENS SVAR 40/2007 rd. Regeringens proposition med förslag till ändring av vissa bestämmelser om beskattningen av värdepapper.

Lag. RIKSDAGENS SVAR 40/2007 rd. Regeringens proposition med förslag till ändring av vissa bestämmelser om beskattningen av värdepapper. RIKSDAGENS SVAR 40/2007 rd Regeringens proposition med förslag till ändring av vissa bestämmelser om beskattningen av värdepapper Ärende Regeringen har till riksdagen överlämnat sin proposition med förslag

Läs mer

Finansiella företagsgruppen Solidar

Finansiella företagsgruppen Solidar Finansiella företagsgruppen Solidar Information om kapitaltäckning enligt Finansinspektionens föreskrifter och allmänna råd (FFFS 2007:5) om offentliggörande av information om kapitaltäckning och riskhantering.

Läs mer

Nya regler för finansiella konglomerat och grupper. Eva-Lena Norgren (Finansdepartementet) Lagrådsremissens huvudsakliga innehåll

Nya regler för finansiella konglomerat och grupper. Eva-Lena Norgren (Finansdepartementet) Lagrådsremissens huvudsakliga innehåll Lagrådsremiss Nya regler för finansiella konglomerat och grupper Regeringen överlämnar denna remiss till Lagrådet. Stockholm den 11 april 2013 Peter Norman Eva-Lena Norgren (Finansdepartementet) Lagrådsremissens

Läs mer

Kapitaltäckning och likviditet Konsoliderad situation för Solidar

Kapitaltäckning och likviditet Konsoliderad situation för Solidar Kapitaltäckning och likviditet Konsoliderad situation för Solidar Information om kapitaltäckning enligt Finansinspektionens föreskrifter (FFFS 2014:12) om tillsynskrav och kapitalbuffertar. 1 Bakgrund

Läs mer

Följande utsikter har offentliggjorts den 12 februari 2014 i Aktia Bank Abp:s bokslutskommuniké :

Följande utsikter har offentliggjorts den 12 februari 2014 i Aktia Bank Abp:s bokslutskommuniké : TILLÄGG 5/13.2.2014 TILL AKTIA BANK ABP:S GRUNDPROSPEKT/BÖRSPROSPEKT 26.4.2013 FÖR EMISSIONSPROGRAM FÖR MASSKULDEBREVSLÅN 500 000 000 EURO SAMT TILL SAMMANFATTNINGEN SOM FOGATS TILL DE LÅNESPECIFIKA VILLKOREN

Läs mer

Föreskrifter och anvisningar 25/2013

Föreskrifter och anvisningar 25/2013 Föreskrifter och anvisningar 25/2013 Beräkning av kapitaltäckning och stora exponeringar Dnr FIVA 18/01.00/2013 Utfärdade 9.12.2013 Gäller från 1.1.2014 FINANSINSPEKTIONEN Telefon 010 831 51 fax 010 831

Läs mer

FÖRESKRIFT Nr 306.2 Dnr 44/420/98 1 (5)

FÖRESKRIFT Nr 306.2 Dnr 44/420/98 1 (5) 1 (5) NOTER TILL BOKSLUTET I noter till bokslutet skall redovisas följande: Noter angående upprättandet av bokslutet I noterna skall ingå en beskrivning av redovisningsprinciperna för upprättande av sammanslutningens

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Förordning om ändring i förordningen (2001:911) om avgifter för prövning av ärenden hos Finansinspektionen; SFS 2014:1392 Utkom från trycket den 5 december 2014 utfärdad den

Läs mer

SV BILAGA XIII RAPPORTERING OM LIKVIDITET (DEL 1 av 5: LIKVIDA TILLGÅNGAR)

SV BILAGA XIII RAPPORTERING OM LIKVIDITET (DEL 1 av 5: LIKVIDA TILLGÅNGAR) BILAGA XIII RAPPORTERING OM LIKVIDITET (DEL 1 av 5: LIKVIDA TILLGÅNGAR) 1. Likvida tillgångar 1.1. Allmänna kommentarer 1. Detta är en sammanfattande mall som innehåller information om tillgångar för övervakning

Läs mer

Tillstånd enligt lagen om värdepappersmarknaden (Kreditinstitut)

Tillstånd enligt lagen om värdepappersmarknaden (Kreditinstitut) 2007-08-27 Finansinspektionen P.O. Box 7821 SE-103 97 Stockholm [Brunnsgatan 3] Tel +46 8 787 80 00 Fax +46 8 24 13 35 finansinspektionen@fi.se www.fi.se Tillstånd enligt lagen om värdepappersmarknaden

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i försäkringsrörelselagen (2010:2043); utfärdad den 30 maj 2013. SFS 2013:456 Utkom från trycket den 12 juni 2013 Enligt riksdagens beslut 1 föreskrivs i fråga

Läs mer

FÖRESKRIFT OM DELÅRSRAPPORT I DEPOSITIONSBANKER

FÖRESKRIFT OM DELÅRSRAPPORT I DEPOSITIONSBANKER tills vidare 1 (7) Till depositionsbankerna Till depositionsbankernas holdingsammanslutningar Till centralinstitut som avses i andelsbankslagen FÖRESKRIFT OM DELÅRSRAPPORT I DEPOSITIONSBANKER Finansinspektionen

Läs mer

STADGAR [1] Placeringsfond. Aktuella stadgar för fonden har fastställts Stadgarna gäller från och med

STADGAR [1] Placeringsfond. Aktuella stadgar för fonden har fastställts Stadgarna gäller från och med STADGAR [1] Placeringsfond Aktuella stadgar för fonden har fastställts 2016.01.12. Stadgarna gäller från och med 2016.03.01. -placeringsfond,stadgar Fondens stadgar består av dessa fondspecifika stadgar

Läs mer

KAPITALTÄCKNING OCH LIKVIDITET

KAPITALTÄCKNING OCH LIKVIDITET KAPITALTÄCKNING OCH LIKVIDITET PELARE 3 Q1 2015 INLEDNING Denna rapport omfattar Carnegie-koncernen som består av Carnegie Holding AB, (organisationsnummer 556780-4983), Carnegie Fonder AB (organisationsnummer

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om ändring i lagen (1991:980) om handel med finansiella instrument; SFS 2006:454 Utkom från trycket den 7 juni 2006 utfärdad den 24 maj 2006. Enligt riksdagens beslut 1 föreskrivs

Läs mer

Svensk författningssamling

Svensk författningssamling Svensk författningssamling Lag om utgivning av elektroniska pengar; SFS 2002:149 Utkom från trycket den 16 april 2002 utfärdad den 4 april 2002. Enligt riksdagens beslut 1 föreskrivs 2 följande. 1 kap.

Läs mer