Kvantitativ utvärdering av marknadsmisslyckanden och hinder

Storlek: px
Starta visningen från sidan:

Download "Kvantitativ utvärdering av marknadsmisslyckanden och hinder"

Transkript

1 Insights. Delivered. Kvantitativ utvärdering av marknadsmisslyckanden och 19 december 2014 Proj no:

2 19 december

3 Sammanfattning Ett effektivt utnyttjande av resurser, inklusive energi, utgör grunden för ekonomisk tillväxt och en hållbar utveckling. Om externaliteter inte prissätts, kommer dessa hindra en optimal resursfördelning på en fri marknad och därmed leda till marknadsmisslyckande. Genom att tilldela äganderätter eller prissätta externaliteter genom införandet av skatter, avgifter, regleringar eller subventioner kan effekter bli internaliserade av marknaden och incitament till en mer effektiv resursfördelning därmed skapas. Generella ekonomiska styrmedel (såsom skatter) som syftar till att internalisera negativa externa effekter behöver kompletteras med andra typer av styrmedel om prissignalen inte slår igenom fullt ut eller är otillräcklig för att skapa en samhällsekonomiskt effektiv energianvändning. Hinder som finns i de olika sektorerna kan göra att prissignalen inte når fram. Om målgruppen har låg total energianvändning eller är mycket prisokänslig kan detta också påverka. 1 Ett antal energieffektiviseringsåtgärder som kan förefalla privatekonomiskt eller företagsekonomiskt lönsamma genomförs inte idag. Gapet mellan dagens energieffektivitet och det som förefaller lönsamt brukar kallas energieffektiviseringsgapet och relaterar till ingenjörspotentialen - de åtgärder som med en relativt enkel investeringbesparingsberäkning visar lönsamhet. Att alla dessa åtgärder inte realiseras kan dels bero på marknadsmisslyckanden och dels på andra. Hindren kan vara av olika karaktär och många gånger medför de faktiska kostnader att överbrygga. Dessa kostnader kan ibland innebära att energieffektiviseringsåtgärden inte längre är lönsam. En del aspekter av kan åtgärdas av staten på ett effektivt sätt, exempelvis genom statens skalfördelar, andra inte. De som beaktats i denna studie är Asymmetrisk information, Kunskap och osäkerhet om ny teknik, Transaktionskostnader, Begränsad rationalitet, Organisatoriska, Finansiella samt Policyinstabilitet. En litteraturgenomgång har genomförts där Sweco kunnat konstatera att få tidigare ansatser har gjorts att kvantifiera för energieffektivisering. I syfte att kunna kvantifiera hindren har intervjuer och expertpaneler genomförts med aktörer inom de olika sektorerna bebyggelse, industri och transport. Dessa är indelade i undergrupper, totalt sju stycken sektorer. Tillsammans motsvarar dessa sju sektorer cirka 88 procent av Sveriges totala energianvändning. Deltagarna i intervjuer och expertpaneler har individuellt kvantifierat respektive och beskrivit på vilka sätt hindren tar sig uttryck i dennes sektor. Hindren är olika betydelsefulla för de olika sektorerna; ett kan ha allt ifrån marginell till stor betydelse i jämförelse mellan sektorerna. 1 Se kapitel 7.4 Samverkan med externa effekter för vidare förklaring. 19 december

4 Ingenjörspotentialens storlek Ingenjörspotentialen definieras i denna studie som summan av alla tekniskt möjliga energieffektiviseringsåtgärder med ett positivt ekonomiskt nuvärde med en given kalkylränta. Både rena investeringar och förbättrad förvaltning, till exempel effektiv drift av fastigheter, logistikplanering för godstransporter etcetera ingår. I figuren nedanvisas den uppskattade ingenjörspotentialen för energieffektivisering per sektor. Den sektor som använder störst mängd energi i Sverige är den energiintensiva industrin. I den sektorn finns också den största energieffektiviseringspotentialen sett i absoluta tal. Även inom transportsektorn finns stora potentialer, särskilt inom persontransporter. Kontorslokaler Godstransporter (väg, spår) Övrig tillverkande industri Flerbostadshus Småhus (inkl fritidshus) Persontransporter (väg, spår) Energiintensiv industri TWh/år Bedömd energianvändning år 2030 Varav potential år 2030 Källa: Sweco, 2014 Bedömd energieffektiviseringspotential (ingenjörspotential) år 2030, samt förväntad spontant realiserad energieffektivisering till år 2030 visas nedan. Kontorslokaler Godstransporter (väg, spår) Övrig tillverkande industri Flerbostadshus Småhus (inkl fritidshus) Persontransporter (väg, spår) Energiintensiv industri TWh/år Total potential år 2030 Varav spontant realiserad potential år 2030 Källa: Sweco, december

5 Energiintensiv industri, har även den högsta förväntade spontant realiserade energieffektiviseringen. I och med att sektorn är just energiintensiv finns en tydlig koppling till konkurrenskraft vid effektivisering av sektorns energianvändning. Gällande fastighetssektorn ses stora skillnader mellan dess delsektorer. Detta beror främst på variation i ägarstruktur. En större andel av potentialen inom persontransporter än inom godstransporter förväntas realiseras spontant. De potentialer som finns genom överflytt från väg till cykel eller kollektivt åkande, är särskilt slagkraftiga eftersom skillnaden i energianvändning per nytta är mycket stor mellan väg och spår. Storlek på identifierade Till de sju kategorier som har kvantifierats i studien tillkommer den energieffektivisering som hindras av externa kostnaders otillräckliga internaliseringsgrad. Dessa ingår inte i det pris som kunden idag möter, och såldes inte i den potential som förefaller företagsekonomiskt lönsamt. Om externa kostnader för produktion och användning av energi inte är internaliserade är detta något som sänder fel prissignal vad gäller önskvärd nivå av energieffektivisering i samhället, och såldes något som hindrar energieffektivisering. Externa kostnader för elanvändning, värmeproduktion och transporter har beaktats. Studien finner att externa kostnader för elanvändning idag är internaliserade i sin helhet. För de flesta elanvändare kan de negativa externa effekterna sägas vara överinternaliserade. För elanvändare med stora skattelättnader, såsom energiintensiv industri, indikerar resultaten att dessa inte bär sina externa kostnader för elanvändning. Studiens resultat indikerar vidare att värmeproduktions negativa externa effekter har en sammanvägd internaliseringsgrad på cirka 65 procent. Vad gäller persontransporter är de negativa externa effekterna ifrån flyg internaliserade, men inte för övriga fordon (37-92 procent). För godstransporter är internaliseringsgraden procent beroende på fordonstyp. Några sticker ut i respektive sektor som mer betydelsefulla än andra, dock kan sägas att hindren samspelar i princip i alla sektorer. Asymmetrisk information, Kunskap och osäkerheter om ny teknik, Transaktionskostnader samt Organisatoriska faller alla ut som det mest betydande hindret i åtminstone en sektorkategori. Figuren nedan visar den bedömda storleken per för sektorerna. 19 december

6 Policyinstabilitet Finansiella Organisatoriska Begränsad rationalitet Transaktionskostnader Kunskap, osäkerhet om ny teknik Asymmetrisk information Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor TWh Källa: Sweco, 2014 Hinder som bedöms angelägna att åtgärda Det är inte enbart hindrens storlek som avgör huruvida det är angeläget för staten att dem åtgärda eller inte. Även statens rådighet över hindret, risken att snedvrida konkurrens (mellan branscher eller inom branscher), Sveriges konkurrenskraft, möjlighet till att åtgärda hindret kostnadseffektivt och möjlig energibesparing bör beaktas. Bedömning av angeläenheten att åtgärda respektive har gjorts för varje sektor. De som bedöms mest angelägna att åtgärda är Kunskap och osäkerhet om ny teknik samt Policyinstabilitet. Även negativa externa effekter bedöms angeläget att åtgärda, givet att detta inte får andra betydande negativa effekter. Dennas angelägenhetsgrad har dock inte kvantifierats. I figurerna nedan är hindren Kunskap och osäkerhet om ny teknik samt Policyinstabilitet plottade mot storleken på hindren i TWh för respektive sektor. 19 december

7 Storlek på Storlek på TWh Kvantitativ utvärdering av marknadsmisslyckanden och 6 Kunskap & osäkerhet om ny teknik Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Angeläget att åtgärda 5 Policyinstabilitet Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa: Sweco, Angeläget att åtgärda Utveckling av dagens styrmedelsportfölj Den nuvarande styrmedelsportföljen bedöms inte adressera hindren i tillräckligt stor utsträckning. Det finns idag få styrmedel som riktar sig mot energiintensiv industri och godstransporter, medan flera adresserar bebyggelsen. Speciellt sektorn energiintensiv industri har en stor energieffektiviseringspotential som borde kunna realiseras i högre utsträckning än idag, om styrmedel gentemot denna sektor utformas på rätt sätt. De flesta av styrmedlen har inte heller gett tillräckliga påvisbara effekter. För ett antal av dessa styrmedel handlar det om att det inte har gått tillräckligt lång tid sedan styrmedlet implementerades för att kunna mäta effekter. 19 december

8 Att de intervjupersoner och medverkande i expertpaneler som deltagit i Swecos studie bedömt att för energieffektivisering förligger, och att Sweco genom befintlig litteratur kunnat påvisa att icke-realiserad potential finns för lönsamma energieffektiviseringar, talar även detta för att det finns behov att förändra och vidareutveckla styrmedelskatalogen. Detta förutsatt att hindren går att överbrygga på ett kostnadseffektivt sätt. Analysen påvisar även att den samhällsekonomiska potentialen vida överstiger nuvarande energieffektiviseringsåtgärder. Kostnaden för styrmedel bedöms även den vara liten i jämförelse med den samhällsekonomiska potentialen. Därmed finns både utrymme och behov av att komplettera nuvarande styrmedelsportfölj. Några aspekter som Sweco vill lyfta som viktiga att ta i beaktning generellt är att: Icke-internaliserade externa effekter bör i högre grad internaliseras. Dock behövs hänsyn tas till internaliseringsgrader i andra konkurrerande länder. Detta i syfte att inte snedvrida marknader och riskera carbon leakage. Risk för snedvridning av konkurrens bör beaktas vid all form av styrmedelsutformning. Detta gäller konkurrens inom branscher, mellan branscher och för Sveriges konkurrenskraft gentemot övriga världen. Bedömningar bör göras huruvida en prissignal inte påverkar målgruppen eftersom prissignaler inte når fram (exempelvis på grund av Asymmetrisk information) eller ifall detta beror på att målgruppen inte är priskänslig (exempelvis eftersom energikostnaderna ändå är en liten del av totala kostnader). Om det sistnämnda är fallet bör andra former av insatser än prissignaler användas, om det bedöms finnas samhällsekonomiskt värde i att dessa målgrupper energieffektiviserar. Fokus för styrmedelsutformning inom respektive målgrupp bör ligga på att lägga krut på de som anses angelägna att åtgärda, vilket även kopplar till hindrens storlek. Hindren samspelar med varandra, således behövs olika typer av styrmedel således behövs för att nå resultat. En flexibilitet i utformningen av styrmedlen bör finnas, där styrmedlen kan utvärderas och förbättras kontinuerligt. Detta måste dock göras på ett sätt som inte ger upphov till ytterligare upplevd Policyinstabilitet hos aktörerna. Policyinstabilitet åtgärdas genom att de styrmedelsutformningar som görs och hur de kommuniceras har en medvetenhet om att Policyinstabilitet bör undvikas. Aktörernas ägandeform varierar, och ofta behövs olika kommunikationssätt för att styrmedel ska få avsedd verkan för de olika aktörerna inom en målgrupp. Det finns vidare ett antal aspekter som bör tas i beaktning vid utformning av styrmedel inom bebyggelse, industri respektive transporter. Bebyggelse Det finns idag ett flertal etablerade styrmedel inom bebyggelse. Det framtida arbetet med styrmedelsutformning gentemot bebyggelsen bör ta sin utgångspunkt i dessa. För småhusägare och bostadsrättsföreningar behövs informationsinsatser för att minska Transaktionskostnader och Kunskap och osäkerhet om ny teknik. Dock finns en svårighet att nå ut till dessa, främst givet målgruppens stora spridning och 19 december

9 Industri antal. En prioritering kan behöva göras av vilka som kan nås på ett kostnadseffektivt sätt. Informationsinsatser och en mer välutvecklad energitjänstemarknad kan reducera Asymmetrisk information i kontorslokaler. Eftersom de installationer som görs i fastigheter har lång livslängd är det naturligt att aktörer är riskaverta. Hindret Kunskap och osäkerhet om ny teknik kan delvis minskas genom demonstrationer av teknik. Förbättrad uppföljning och tillsyn av befintliga lagkrav som BBR och Miljöbalken är ett sätt att säkerställa likabehandling genom en effektiv och rättssäker myndighetsutövning som skapar mer lika förutsättningar för aktörer. För övrig tillverkande industri bedöms att en vidareutveckling av dagens styrmedel kan nå resultat i målgruppen, medan energiintensiv industri bedöms behöva ytterligare styrmedel. Kunskap och osäkerhet om ny teknik är ett för energieffektiviseringar, speciellt i den energiintensiva industrin som upplever en stor risk med att göra ändringar processen eftersom detta kan äventyra produktionen. Ett sätt att sänka företagens upplevda risk kan vara genom demonstrationsprojekt av ny teknik, som leder till ökad kunskap om tekniken. Ett annat sätt skulle kunna vara att skapa incitament för företagen, vilket leder till att fler tycker att det är värt att ta risken. Övrig tillverkande industri har högre Transaktionskostnader än energiintensiv industri för att komma till stånd med energieffektiviseringar. En välfungerande energitjänstemarknad kan då vara det verktyg som sänker Transaktionskostnader och behovet av att avsätta mer resurser internt. Swecos utvärdering visar att Organisatoriska och Begränsad rationalitet är betydande. Dessa är dock svåra för staten att ha rådighet över. Detta är både av praktiska skäl (hur kan staten delta i ett företags beslutsfattandeprocess) och av principiella skäl (risk för snedvridning av marknaden om staten hjälper några mer än andra). Dessa kan delvis nås indirekt det kan det vara aktuellt med styrmedel av mer incitamentskaraktär för att sätta bollen i rullning i företagen. Det tidigare styrmedelet PFE medförde i sin utformning en överbryggning av vissa organisatoriska som ledningens engagemang, och även att resurser anställdes för att arbeta med energieffektiviseringar. Mer kunskap behövs om beteenderelaterade organisatoriska då dess potential bedöms vara stor. Transporter Transportsektorn energieffektivisering sker genom minskat transportbehov, överflytt mellan transportslag eller energieffektivare fordon. Studien påvisar att det som hindrar privatpersoner att köpa energieffektivare personbilar 2 ofta är en kombination av osäkerhet om teknik (Kunskap och 2 Incitament försöker vanligtvis skapas för att främja försäljningen av miljövänliga bilar. Detta kan vara förknippat med energieffektivare bilar (exempelvis elbilar), men inte alltid. Då denna studie fokuserar på energieffektivitet används detta begrepp genomgående i studien. 19 december

10 osäkerhet om ny teknik) respektive den politiska utvecklingen (Policyinstabilitet). Den tekniska osäkerheten bedöms till stor grad hanteras av marknaden själv (tillverkare och återförsäljare av bilar). Därför bedöms att staten istället bör utforma styrmedel som skapar incitament för privatpersoner (och företag som köper företagsbilar) att köpa energieffektivare personbilar trots de associerade riskerna. Övergång från väg till andra färdslag kan främjas genom medveten stadsplanering. Det finns idag en begränsad transparens mellan transportköpare och den aktör som i slutändan utför transporten. Offentliga aktörer skulle kunna vara föregångare i att efterfråga mer energieffektiva transporter, givet att detta bedöms ha ett samhällsekonomiskt värde på sikt. Att reglerna kring fjärrtransporter (delvis kopplat till den utbredda cabotageverksamheten) brister i kontroll av efterlevnad försämrar ytterligare incitamenten för aktörer (i detta fall främst åkerier) att vara energieffektiva. Översikt av styrmedelsrekommendationer Ett antal specifika styrmedelsförslag har även tagits fram av Sweco. Dessa visas i tabellen nedan och utgör en översikt av de styrmedel rapporten rekommenderar. Typ av styrmedel Sektor Administrativa Informativa Ekonomiska FoU Flerbostadshus Uppföljning BBR Förbättrad infospridning resultat EM:s nätverk Främja energitjänstemarknaden EKR stärks samt uppsöker BRF:er Etablera kompetenscentrum Uppföljning BBR Förbättrad infospridning resultat Lokaler Utnyttja LOU och befintliga nätverk EM:s nätverk för att främja avtal som minskar Främja energitjänstemarknaden asymmetrisk information Uppföljning BBR EKR stärks Småhus Öka kännedom om EM:s hemsida, testresultat etcetera. Vidareutveckla energimärkning hus Utveckla tillsynsarbetet Kompetenshöjning via branschorganisationer, Energiintensiv industri ledningskurser Nätverksarbete flera ledningsnivåer, internationellt arbete, riskhantering Övrig Morot & Piska Främja energitjänstemarknaden Nätverksarbete stödprocesser, tillverkande beteende och riskhantering industri Persontransporter Godstransporter Källa: Sweco, 2013 Trafikverket ansvarig myndighet för cykelinfrastruktur Förbättrad kontroll av fjärrtrafik Använd LOU till att främja energieffektiva transporter Mer medveten fysisk planering Ta bort EKR transporter Mer medveten fysisk planering Bonus-malus-system Incitament för early-adopters Momsreduktion bilpooler Skatteväxling dieselbilar 19 december

11 Innehåll 1 Introduktion och bakgrund Uppdragets syfte och mål 14 2 Metod Teoretiskt ramverk Beteendeekonomi Analysmodell Avgränsningar och metodutmaningar Genomförande Analys 31 3 Kvantifiering av i litteraturen De negativa externaliteterna Val av metod Kraftproduktion Värmeproduktion Transportsektorn 52 5 Beskrivning av sektorerna och deras potential Energieffektivisering definitioner och antaganden i denna rapport Flerbostadshus Kontorslokaler Småhus Energiintensiv industri Övrig tillverkande industri Persontransporter Godstransporter 88 6 Hinder i respektive sektor Flerbostadshus Kontorslokaler Småhus Energiintensiv industri Övrig tillverkande industri Persontransporter Godstransporter Storlek på respektive Externa effekter Hindrens storlek december

12 Hindrens karaktär 155 Samverkan med externa effekter Vilka kan anses viktiga att åtgärda? Bedömning av angelägenhetsgrad Insatser och åtgärder Hinder och marknadsmisslyckanden som nuvarande styrmedelsportfölj adresserar Verkan och samverkan i nuvarande styrmedelsportfölj 171 Finns behov att förändra styrmedelskatalogen? Slutsatser Storleken på identifierade 194 Behov att korrigera hindren med hjälp av styrmedel Den samhällsekonomiska potentialen för energieffektivisering i olika sektorer Behov att förändra dagens styrmedelsportfölj 203 Förändring av dagens styrmedelsportfölj 204 Bilagor BILAGA 1: Definitioner 208 BILAGA 2.1: Viktigaste källor för Ecofys kvantifieringen av externa kostnader för eloch värmeproduktion 211 BILAGA 2.2: Analysmetod tillämpad i Ecofys 212 BILAGA 2.3: Sammanfattning av externa kostnader och internalisering för transporter 213 BILAGA 3: Intervjuer - deltagare 214 BILAGA 4 Expertpaneler - deltagare 215 Källförteckning december

13 1 Introduktion och bakgrund Ett effektivt utnyttjande av resurser, inklusive energi, utgör grunden för ekonomisk tillväxt och en hållbar utveckling. I 2009 års energiproposition anges att en framgångsrik politik för energieffektivisering kännetecknas av att miljontals beslutsfattare dagligen, integrerat med andra beslut, även beaktar energieffektivisering (prop. 2008/09:163, sid. 83). Den svenska politiken för energieffektivisering baseras på principerna att styrmedel bör vara generella och inte bundna till specifika tekniker, priserna ska ge rätt (eller önskad) information, sökkostnader reduceras genom att information tas fram och sprids, samt barriärer kan undanröjas, till exempel genom att det befintliga regelverket justeras. Dagens styrmedelsportfölj för energieffektivisering är följaktligen mycket bred och omfattar generella ekonomiska styrmedel, såsom energi- och koldioxidskatter samt utsläppshandel, såväl som mer riktade administrativa styrmedel som reglerar till exempel krav på tillstånd för att bedriva miljöfarlig verksamhet av och krav på energiprestanda och energimärkning för energirelaterade produkter och byggnader. Därtill finns diverse insatser som på olika sätt avser åtgärda informationsbrister på marknaden samt öka medvetenheten och kunskapen om samt legitimiteten hos olika (teknik- och/eller beteenderelaterade) åtgärder för energieffektivisering och energibesparing. Som exempel kan nämnas statligt stöd till kommunal energi- och klimatrådgivning, energikartläggningscheckar till mindre företag, regionala klimat- och energistrategier, nätverksaktiviteter och teknikupphandling samt andra åtgärder för tidig marknadsintroduktion. Generella ekonomiska styrmedel, som till exempel energiskatter, behöver kompletteras med andra typer av styrmedel om prissignalen inte fullt ut slår igenom eller är tillräcklig för att skapa en samhällsekonomiskt effektiv energianvändning. En anledning till att så skulle vara fallet är bristfällig information om energianvändande produkter. En kombination av ekonomiska styrmedel och väl avvägda informationsinsatser förväntas ha goda förutsättningar för att göra energianvändningen samhällsekonomiskt effektivare. I budgetpropositionen för 2013 avsatte Regeringen medel för år 2013 och 2014 för att genomföra en bred extern utvärdering av befintliga styrmedel för energieffektivisering. Hösten 2013 genomförde Sweco en utvärdering, i vilken en omfattande genomgång och utvärdering av de flesta befintliga styrmedel för energieffektivisering genomfördes. De främsta av styrmedlen som innefattades var av informativ karaktär. Skatter innefattades inte. I utvärderingen identifierades respektive styrmedels bakomliggande och marknadsmisslyckanden. Därtill utvärderades om styrmedlen är ändamålsenliga och kostnadseffektiva, hur de förvaltas samt vilka resultat och effekter de leder till. Till skillnad från den mer kvalitativt inriktade utvärderingen 2013 är detta uppdrag 2014 kvantitativt inriktat och med fokus på att värdera identifierade marknadsmisslyckanden och marknads för energieffektivisering i olika sektorer samt bedöma hur allvarliga de kan anses vara. 19 december

14 Kontaktpersoner vid Näringsdepartementet har varit Daniel Waluszewski, Fredrik von Malmborg och Martina Högberg. Uppdraget har utförts av Rose-Marie Ågren, Annelie Helmersdotter Eriksson, Niclas Damsgaard, Sofia Klugman, Erica Edfeldt, Robin Jakobsson, Mikael Winai och Saara Hollmén under sommaren och hösten Uppdragets syfte och mål Uppdraget syftar ytterst till att bedöma vilka av de nuvarande nationella styrmedlen för energieffektivisering som är mest ändamålsenliga och betydelsefulla för att åtgärda marknadsmisslyckanden och marknads, samt ger störst bidrag till energieffektivisering. Om befintliga styrmedel inte bedöms ändamålsenliga ska konkreta förslag ges för antingen alternativa styrmedel eller förbättringar av existerande styrmedel. De utvärderingsfrågor som analysen har ambition att besvara är: Hur stora/allvarliga är respektive marknadsmisslyckande/ som har identifieras? Finns behov av att korrigera respektive marknadsmisslyckande/ med hjälp av styrmedel? Hur stor är den samhällsekonomiska potentialen för energieffektivisering i olika sektorer? Hur förhåller sig dagens styrmedelskatalog till befintliga och marknadsmisslyckanden? Hur förhåller sig styrmedlens kostnader till storleken på de /marknadsmisslyckanden som är tänkta att adressera? Finns behov att förändra styrmedelskatalogen? Hur ska dagens styrmedelskatalog förändras för att bättre möta de och marknadsmisslyckanden som bedöms tillräckligt allvarliga för att ett behov att korrigera dem föreligger? I detta uppdrag ingår att kvantitativt och kvalitativt värdera identifierade marknadsmisslyckanden och marknads för energieffektivisering i olika sektorer samt bedöma hur allvarliga de kan anses vara. En bedömning görs av den samhällsekonomiska potentialen för energieffektivisering i olika sektorer. Mot denna bakgrund bedöms behovet att åtgärda/mildra dessa och marknadsmisslyckanden med hjälp av styrmedel för att de nationella målen för energieffektivisering ska nås. Utifrån denna analys bedöms vilka nuvarande nationella styrmedel som är mest ändamålsenliga och betydelsefulla för att åtgärda marknadsmisslyckanden och marknads och därmed ger störst bidrag till energieffektivisering. Om befintliga styrmedel inte bedöms vara ändamålsenliga ska utredningen omfatta konkreta förslag på alternativa styrmedel eller förslag om hur styrmedlen kan förbättras. 19 december

15 2 Metod I detta kapitel beskrivs det teoretiska ramverket, avgränsningar, genomförande och analys. 2.1 Teoretiskt ramverk Enligt nationalekonomisk teori resulterar en fri marknad till en effektiv fördelning av resurser, under förutsättning att ett antal antaganden är uppfyllda (det så kallade första välfärdsteoremet). Viktiga antaganden är att det finns marknader för alla varor och tjänster och att ingen enskild producent eller konsument kan påverka marknadspriserna. Andra viktiga antaganden är att marknadens aktörer har fullständig information och att marknadstransaktioner inte indirekt påverkar andra aktörer i samhället. Det senare antagandet beskrivs teoretiskt i termer av att det inte får förekomma några externa effekter. Om marknader fungerar i enlighet med bland annat dessa antaganden kan inte ett ingripande förbättra för en person, utan att samtidigt försämra för någon annan. I en sådan värld är motiven för statliga ingripanden begränsade. I realiteten är dessa antaganden sällan, eller aldrig, fullt ut uppfyllda. I princip kan marknadsmisslyckanden identifieras inom i stort sett varje marknad. I många av dessa fall är dock omfattningen eller effekten av dessa avvikelser begränsade. Eftersom det uppstår kostnader av olika slag vid ingrepp för att adressera dessa avvikelser är särskilda ingrepp vanligtvis inte motiverade. En första frågeställning är därmed hur stora avvikelser från det samhällsekonomiskt optimala utfallet som de identifierade marknadsmisslyckandena ger upphov till. För detta kan det vara relevant att dela in marknadsmisslyckanden i olika kategorier. Vi har använt oss av följande marknadsmisslyckanden: negativa externa effekter, kunskap och osäkerhet kring ny teknik, bristande konkurens samt Asymmetrisk information. Förutom regelrätta marknadsmisslyckanden behandlas även olika typer av som ofta omnämns i energieffektiviseringssammanhang. Till skillnad ifrån marknadsmisslyckanden är något aktörerna på marknaden i teorin själva borde kunna hantera och skapa marknadslösningar för. De som beaktas i denna studie är Transaktionskostnader, Begränsad rationalitet, Organisatoriska, Finansiella samt Policy instabilitet. Nedan beskrivs de marknadsmisslyckanden och som är relevanta i denna utvärdering Negativa externa effekter Det finns ett antal centrala faktorer till att marknadsmisslyckanden kan uppstå. I miljösammanhang handlar det normalt om negativa externa effekter. Detta handlar i grunden om en avsaknad av marknad för miljövaror. Negativa externa effekter innebär att en person eller företags produktions- eller konsumtionsbeslut har negativ påverkan på andra och att det saknas ett pris för dessa effekter. Därmed har en enskild beslutsfattare inte incitament att ta med dessa effekter i sitt produktions- eller konsumtionsbeslut. Genom att definiera äganderätter skulle man teoretiskt kunna komma till rätta med problem med negativa externa effekter, men i många fall kan Transaktionskostnaderna vara alltför höga. 19 december

16 Vanliga styrmedel för att åtgärda denna typ av marknadsmisslyckande är skatter eller direkta regleringar, till exempel i form av gränsvärden för utsläpp eller teknikregleringar. Även konstruerade marknader för handel med utsläppsrätter kan används i detta syfte. Det kan också finnas positiva externa effekter, det vill säga någon typ av positiv spillover från en aktörs produktions- eller konsumtionsbeslut, exempelvis kunskapsgenerering från investeringar i forskning- och utveckling Kunskap och osäkerhet kring ny teknik Vissa varor och tjänster är kollektiva varor. En kollektiv vara karaktäriseras av icke-rivalitet och icke-exkluderbarhet. Icke-rivalitet innebär att en persons konsumtion av varan inte påverkar andra personers möjlighet att konsumera samma vara. Icke-exkluderbarheten innebär helt enkelt att det inte är möjligt att stänga ute någon från att konsumera en vara när den väl producerats. På en fri marknad kan man förvänta sig att en kollektiv vara produceras i för liten omfattning, jämfört med den samhällsekonomiskt optimala nivån. Icke-rivaliteten i konsumtion innebär dessutom att det skulle vara ineffektivt att stänga ute någon från att konsumera varan, även om man kunde stänga ute någon. Offentlig produktion är därmed en vanlig intervention för kollektiva varor. Ett ytterligare exempel på kollektiva varor finns i grundläggande forskning, där forskaren normalt sett endast kan tillgodogöra sig en mycket liten del av det totala värde som uppstår. Den generella kunskapen som uppstår i samhället sprids till många aktörer, men upphovsmannen har små möjligheter att ta betalt för den nytta som uppstår. Uppfinningar kan även vara svåra att skydda, vilket gör intjäningsförmågan begränsad. Detta medför att den privata sektorn investerar för lite i forskning och utveckling i ett samhällsekonomiskt perspektiv. Offentlig forskningsfinansiering och patent är marknadsingrepp som syftar till att korrigera för detta. Denna studie omfattar inte någon analys huruvida forskning och utveckling (FoU) inom energieffektivisering genomförs på en samhällsekonomiskt optimal nivå. Istället granskas ifall information och kunskap om FoU, demonstrationsprojekt och teknikupphandlingar tas fram och sprids på den nivå som är samhällsekonomiskt optimalt. Detta område kommer att granskas då det förekommer att aktörer inte har kunskap om ny teknik alternativt inte investerar i sådan på grund av varierande faktorer. Ett exempel är att tekniken kan vara obeprövad. Det kan även handla om att viss riskvärdering av ny teknik skulle kunna sänkas genom fler demonstrationsprojekt och/eller ökad kunskap hos aktörerna. Det gäller därmed att hitta rätt nivå och avvägning mellan vad staten kan göra på ett kostnadseffektivt sätt och vad aktörerna själva bör ansvara för Bristande konkurrens Ett tredje exempel på marknadsmisslyckanden är bristande konkurrens. Monopol är extremexemplet, men finns även andra former av bristande konkurrens. Monopolisten har incitament att hålla tillbaka produktionen och höja priserna, vilket reducerar i att en vara produceras i för liten omfattning. 19 december

17 Bristande konkurrens kan uppstå av en mängd skäl, exempelvis att kostnadsstrukturen i en bransch omöjliggör flera konkurrenter, olika typer av inträdes, samt sök- och byteskostnader som låser inne kunderna hos en aktör. Generell konkurrenspolitik är ett vanligt ingripande, men för vissa marknader förekommer också sektorsspecifik reglering för att komma tillrätta med mer allvarliga problem med bristande konkurrens. Det sistnämnda gäller i synnerhet viss infrastruktur, som exempelvis elnät. Monopol behandlas särskilt i miljöekonomiska sammanhang eftersom ineffektiviteten från monopolet minskar problemet med negativa externa effekter. Den optimala miljöbeskattningen bör reflektera detta och därför sättas på en lägre nivå när konkurrensen är bristfällig Asymmetrisk information Ett fjärde exempel är informationsasymmetri, det vill säga att olika parter som ska ingå ett avtal eller har ingått ett avtal inte har tillgång till samma information. Så kallade moral hazard -modeller avser situationer när ett avtal ingåtts och det inte är möjligt för exempelvis ett försäkringsbolag att observera beteendet hos försäkringstagare vilket kan skapa incitament att ta för stora risker eller att inte anstränga sig tillräckligt etcetera. I adverse selection -modeller är det i stället egenskaperna hos en aktör som inte är observerbara och problemen uppstår innan ett kontrakt skrivs. Även om marknadsaktörer på olika sätt kan utforma kontrakt eller erbjuda tjänster för att hantera informationsasymmetrier, är det en betydande anledning till marknadsmisslyckanden. Olika statliga ingripanden görs för att hantera problem kopplade till Asymmetrisk information. Obligatoriska försäkringar är ett exempel på ingripande och informationsinsatser ett annat exempel. I relation till energieffektivisering är energimärkning ett sådant exempel. Nedan beskrivs de marknads som inkluderats i studien Transaktionskostnader Transaktionskostnader brukar ofta nämnas i diskussioner om för energieffektivisering. Med Transaktionskostnader avses sökkostnader för att hitta rätt produkt och rätt företag samt eventuella kostnader för att förhandla fram avtal och genomföra en affär. Transaktionskostnader är i sig inget marknadsmisslyckande utan har som all annan resursanvändning en alternativkostnad. Alla konsumtions- och produktionsval inbegriper Transaktionskostnader. Inom nationalekonomi gör man oftast det förenklande antagandet att Transaktionskostnaderna är negligerbara. Viktigt att notera är emellertid att Transaktionskostnaderna är verkliga kostnader och att de inte förändrar nationalekonomiska principresonemang. Transaktionskostnader antas vara noll av samma anledning som handelsmodeller antar negligerbara transportkostnader, de underlättar en teoretisk framställning utan att förståelsen går förlorad. Givetvis måste dock Transaktionskostnader beaktas då teori blir empiri. Transaktionskostnader är nära förknippade med marknadsmisslyckandet ofullständig information (inkl. Asymmetrisk information). Fullständig information är en av flera förutsättningar för att en marknadsekonomi ska resultera i en samhällsekonomiskt effektiv resursfördelning utan politiska ingrepp. 19 december

18 I verkligheten kostar det tid, tankemöda och ibland pengar att informera sig, teckna avtal och fatta beslut, vilket betyder att rationella aktörer kommer att engagera sig mindre i aktiviteter som innebär stora Transaktionskostnader, allt annat lika. Formulerat annorlunda innebär höga Transaktionskostnader att en del samhällsekonomiskt effektiva avtal inte kommer att realiseras. Transaktionskostnaderna förväntas vara extremt höga i situationer som inkluderar många aktörer och där det förekommer Asymmetrisk information. Exempelvis, i teorin ska marknaden kunna lösa marknadsmisslyckanden i form av negativa externa effekter om lagstiftaren fördelar äganderätter, dvs. rätten att släppa ut eller rätten till ren luft. När väl äganderätterna är fördelade kan aktörerna på marknaden förhandla sig fram till samhällsekonomiskt optimala utsläppsnivåer. I praktiken hindras en sådan lösning av extremt höga kostnader för informationsinhämtning, avtalsskrivning, koordinering och kontroll. Marknadsmisslyckanden i form av negativa externa effekter har därför istället adresserats med reglerande styrmedel som till exempel miljöskatter, utsläppsregleringar och teknikregleringar. Vissa informationsmisslyckanden kan avhjälpas genom politiska ingrepp som minskar Transaktionskostnaderna för hushåll och företag. Exempelvis, harmonisering av trafikregler och produktstandarder kan sägas vara åtgärder som motiveras av minskade friktionskostnader i samhällsekonomin. För att sådana åtgärder ska vara samhällsekonomiskt motiverade måste de skapa mer välfärd än de förstör. I nationalekonomi är alternativkostnad ett centralt begrepp. Med alternativkostnad avses att alla val samtidigt inbegriper ett välja bort något som har ett värde. Allt vi gör har därför en kostnad i det värde som väljs bort. Hushåll, företag och myndigheter måste prioritera hur de ska använda sina resurser, till exempel tid och finansiella resurser. Detta är viktigt att beakta i energipolitiken. Energieffektivisering har inget egenvärde utan är ett medel för att öka vinsten i företag, skapa mer nytta för hushåll och skapa värden för samhället i stort Begränsad rationalitet Begreppet Begränsad rationalitet inbegriper att aktörer inte alltid agerar så som ekonomiska modeller förutsätter. Vår kapacitet att välja rätt begränsas av vår kognitiva förmåga. Beteendevetenskaplig forskning tyder på att vi systematiskt avviker från val som anses rationella enligt nationalekonomisk teori, detta då aktörer exempelvis använder sig av tumregler när de fattar beslut, missbedömer små sannolikheter, väger förluster tyngre än vinster och ogillar förändring Organisatoriska Organisatoriska kan exempelvis yppa sig som bristande intresse för energifrågan ifrån en organisations ledning, bristfälliga incitamentsstrukturer inom organisationen, att energiförbrukningen är dold och därför negligeras, att det saknas personer med helhetsgrepp om energifrågan, samt förekomsten av samordningsproblem mellan berörda aktörer. Organisationer kan även erfara bristande kompetens, tid och finansiella medel och därmed få svårt att genomföra energieffektiviseringar. 19 december

19 Viktigt att notera är dock att dessa inte har karaktären av marknadsmisslyckanden och att dessa därför teoretiskt borde kunna åtgärdas inom ramen för marknadsbaserade lösningar. Marknadens styrka som resursfördelningsinstrument är att den selekterar mellan effektiva och ineffektiva verksamheter. Effektiva verksamheter belönas och växer medan ineffektiva verksamheter bestraffas och krymper. Denna anpassning kan dock ta lång tid och att avhjälpa vissa ineffektiviteter kan ha ett samhällsekonomiskt värde, till exempel om de leder till minskade miljöproblem eller har andra positiva effekter på samhällsekonomin i stort Finansiella och resursbrist Brist på kapital, låg kreditvärdighet, en svårighet att få lån och höga räntor är exempel på faktorer som kan utgöra Finansiella. Om en aktör inte har råd att göra lönsamma energieffektiviseringar på grund av svårigheter att få tag i kapital till rimlig ränta föreligger ett finansiellt för energieffektiviseringar. Att notera sorteras stridande budgetintressen samt stridande prioriteringar under Organisatoriska. Viktigt att notera är att dessa generellt inte är marknadsmisslyckanden, utan snarare resultatet av kreditkontroll Policyinstabilitet Faktisk eller upplevd oförutsägbarhet i ändringar av och förutsättningar för styrmedel som regelverk, skatter etcetera skapar osäkerhet hos aktörer och hindrar därför investeringar i ökad energieffektivitet. Om aktörer avvaktar med att göra energieffektiviseringar eller undviker att satsa på vissa tekniker, drivmedel eller dylikt som skulle kunna förbättra energieffektiviteten på grund av att de inte vet hur kommande policyförändringar kommer att slå så kan policyinstabiliteten sägas vara hindrande. Det är naturligt att företag inte vet hur framtiden kommer att utvecklas, att ta risker och få avkastning för detta är en naturlig del av företags verksamet. Osäkerhet kring policyutveckling kan ge upphov till en ytterligare risk som kan innebära att aktörer exempelvis kräver en högre avkastning för en investering för att kompensera för den höjda risken. 2.2 Beteendeekonomi Under de senaste åren har intresset runt beteendeekonomi vuxit, delvis som en kritik mot att neoklassisk nationalekonomisk teoris antaganden inte överensstämmer med aktörers beteende och därmed inte är en tillräckligt användbar förklaringsmodell för hur aktörer agerar. Istället ska beteendeekonomi ge ett större förklaringsvärde för hur aktörer agerar. Det ska dock påpekas att individen i neoklassisk teori är en aktör som upprepat agerar på konkurrensutsatta marknader. Den individ som beskrivs bör därmed ses som institutionaliserad och är inte konstruerad för att förutsäga beteende i allmänhet. I Tabell 1 presenteras några av de systematiska avvikelser från ekonomisk rationalitet som påvisats i beteendevetenskapliga experiment. I följande rapport har Sweco använt sig av nationalekonomisk teori för metodens stomme. Dock har beteendeekonomi tagits i beaktning för att fånga de aspekter som inte täcks in av marknadsmisslyckanden men som likafullt hindrar aktörer i deras agerande. 19 december

20 Tabell 1: En översikt av hur ett antal aspekter inom neoklassisk nationalekonomi och beteendeekonomi skiljer sig åt Neoklassisk nationalekonomi Preferenser Väldefinierade och stabila som korrekt reflekterar individens eget bästa Helt egoistiska i bemärkelsen att individen endast bryr sig om sitt egenintresse (även viss grad av altruism). Föreställningar Har inte några begränsningar när det gäller att ta till sig innehållet i relevant information. Att aktörer inte har några begränsningar när det gäller att ta till sig information innebär att de antas känna till och korrekt kunna tillämpa sannolikhetsteoretiska lagar. Rationell sållning av information Begränsningar Fokuserar på ekonomiska begränsningar, till exempel att konsumenter inte kan konsumera mer än sin inkomst och att företag inte långsiktigt kan gå med förlust. Beslutsfattande Individen antas fatta rationella beslut, med vilket förstås att hon utifrån sina föreställningar och begränsningar fattar det beslut som bäst överensstämmer med hennes preferenser. Källa: Östling, Robert, Bearbetad av Sweco Icke standard preferenser Icke standard föreställningar Icke standard begränsningar Icke standard beslutsfattande Beteendeekonomi Självkontrollsproblem Inramningseffekter Förlustaversion Besittningseffekt Sociala preferenser Begränsad uppmärksamhet Informations- och valöverbelastning Sannolikhetslagar Informationsvärdet i andras handlingar Systematiskt inkorrekta föreställningar om framtiden Kognitiva begränsningar och psykologiska att utöva vissa handlingar. Begränsad rationalitet Tumregler Nöjd med Tillräckligt bra Inlärningsprocess 19 december

21 2.3 Analysmodell Utvärderingens design består av en analysmodell i tre steg. I steg 1 genomfördes en kvantitativ och kvalitativ bedömning där marknadsmisslyckanden och marknads blev identifierade och värderade. I detta steg gjordes intervjuer med tillhörande värderingsmatriser, expertpaneler med tillhörande värderingsmatriser, litteraturstudier, en statistikstudie och en kvantifiering av matrisresultat samt bedömning. I steg 2 analyserades den samhällsekonomiska potentialen för energieffektivisering i utvalda sektorer. Under detta steg gjordes en litteraturstudie samt en kvantifiering av den samhällsekonomiska potentialen. Slutligen i steg 3 genomfördes en samlad bedömning av behov att korrigera olika marknadsmisslyckanden och med hjälp av styrmedel för att nå de nationella målen. Bedömningen skedde i fyra stadier. Först jämfördes storleken av med de styrmedel som är riktade mot hindren, både i form utav styrmedlens kostnad, ändamålsenlighet samt omfattning och betydelse. Sedan jämfördes kostnaden av styrmedlen med den samhällsekonomiska potentialen. Utifrån denna process har slutsatser dragits av nuvarande styrmedels ändamålsenlighet och betydelse samt förslag på alternativa styrmedel och förbättringar. Slutsatserna är en samlad bedömning av projektgruppen. De olika stegen i utvärderingen har till viss del löpt parallellt med varandra. Nedan beskrivs metoder som använts för datainsamling samt analys. 2.4 Avgränsningar och metodutmaningar Ett avtal avgränsningar har gjorts. Under projektets gång har även ett antal metodutmaningar stötts på. Hanteringen av dessa beskrivs övergripande i detta delkapitel Avgränsningar Ett avtal avgränsningar har gjorts vad gäller val av marknadsmisslyckanden och som bedöms relevanta att innefatta i denna studie, definitioner av energieffektiviseringspotentialen samt val av sektorer. Val och avgränsning av marknadsmisslyckanden och Att värdera marknadsmisslyckanden och marknads är komplext och det har inte varit möjligt att inom uppdragets ramar värdera samtliga marknadsmisslyckanden och marknads. Dessutom samspelar och överlappar hindren med varandra i varierande grad vilket försvårar indelning och därmed värdering. I syfte att värdera hindren kvantitativt har likväl en indelning gjorts. Denna indelning har använts i samtliga sektorer för att möjliggöra jämförelser mellan hindren i respektive sektor. I vilken utsträckning hindren tar sig uttryck samt på vilket sätt skiljer sig dock åt i olika sektorer. Processen att genomföra indelningen utgick ifrån de som identifierades i Swecos utvärdering av energieffektiviseringsstyrmedel hösten Indelningen reviderades sedan utifrån såväl interna och externa samtal som befintlig internationell och svensk litteratur. 19 december

22 Jämfört med de definitioner som användas i Swecos tidigare utvärdering 3 genomfördes följande revideringar och avgränsningar: Hinder som inte var formulerade efter målgruppsperspektiv reviderades. Exempelvis omformulerades kollektiva varor till kunskap och osäkerhet om ny teknik. Den aspekt av kollektiva varor som berör forskning och utveckling av ny teknik bortsågs ifrån då den inte ses som relevant i denna studie. Ur ett samhällsekonomiskt perspektiv kan otillräcklig grundforskning vara ett för ökad energieffektivitet. Studien har valt att inte bedöma denna fråga. Istället värderas huruvida aktörer upplever att det är ett för energieffektivitet med att ny teknik inte blir etablerad på marknaden, något som till viss del kan avhjälpas med teknikupphandling, demonstrationsprojekt och informationsspridning. Ett flertal studier värderar externa effekter från energiproduktion. Det är också allmänt accepterat att negativa externa effekter existerar. Därmed genomför inte Sweco nya miljöekonomiska värderingar av de negativa externa effekterna från energiproduktion samt utsläpp från fordonsanvändning. Istället används resultat från existerande studier. Framöver använder sig studien begreppet för att samlat beskriva marknadsmisslyckanden samt marknads. 3 Sweco: Utvärdering av 24 styrmedel för energieffektivisering, december

23 Avgränsningar och definitioner av energieffektiviseringspotentialen De olika potentialerna samhällsekonomisk potential, ingenjörspotential och teknisk potential samt deras inbördes förhållanden illustreras schematiskt i Figur 1 nedan. Figur 1: De olika potentialerna och hindren MWh Teknisk potential Ingenjörspotential Organisatoriska Finansiella Samhällsekonomisk potential Transaktions kostnader Begränsad rationalitet BAU Aktiva åtgärder Fiskala skatter Asymmetrisk information Kunskap & osäkerhet om ny teknik Negativa externa effekter Negativa externa effekter Fiskala skatter Indirekta åtgärder Källa: Sweco, 2014 Det finns flera olika sätt att beakta energieffektiviseringspotentialen i samhället. Dels finns den tekniska potentialen, som är den energieffektivisering som är teknisk möjlig med bibehållen nytta. Denna är inte så intressant att beakta, eftersom den inte alls tar hänsyn till kostnaden för energieffektiviseringarna. Nästa nivå är ingenjörspotentialen, som i denna studie definieras som summan av alla tekniskt möjliga energieffektiviseringsåtgärder med ett positivt ekonomiskt nuvärde med en given kalkylränta. Både rena investeringar och förbättrad förvaltning ingår. Det finns dock (inklusive marknadsmisslyckanden) som gör att denna inte realiseras. Hindren består dels i att det finns som medför faktiska kostnader för aktörerna, men som inte innefattas i den rena investeringskostnaden för en specifik energieffektiviseringsåtgärd för aktörerna. Transaktionskostnader är ett sådant, där en möjlig energieffektiviseringsåtgärd är förknippad med en tidsåtgång och associerad kostnad som gör att åtgärden möjligtvis inte längre är lönsam. Begränsad rationalitet och Organisatoriska kan innebära Transaktionskostnader för att överbrygga, vilket kan innebära att dessa inte är lönsamma att komma över, sett till en enskild åtgärd. 19 december

24 De organisationer som arbetat med dessa och att bygga upp en intern kompetens har dock ofta lyckats sänka tröskeln för att energieffektiviseringsåtgärder ska bli lönsamma. Begränsad rationalitet och Organisatoriska kan även bestå i att den upplevda kostnaden, tidsåtgången och risken med en energieffektiviseringsåtgärd skattas fel, och att aktörerna därför väljer att inte genomföra den. Om en aktör har Finansiella kan även det göra att de inte har möjlighet att genomföra det som förefaller lönsamt. Hindren Organisatoriska, Finansiella, Begränsad rationalitet och Transaktionskostnader är inga marknadsmisslyckanden, och brukar således inte räknas in i vad som bör åtgärdas från statligt håll för att nå den samhällsekonomiska energieffektiviseringspotentialen. Istället ses dessa som något som marknads aktörer själva ska arbeta med för att optimera sin egen nytta, samt som marknaden själva ska ta fram marknadslösningar för att hantera (exempelvis att ett företag erbjuder en tjänst som gör att en annan aktör kan komma över ett ). Dock kan sägas att exempelvis Transaktionskostnader ibland kan vara motiverat av staten att åtgärda, i de fall då staten på ett kostnadseffektivt sätt kan sänka dessa (med hjälp av skalfördelar) för aktörerna på att sätt som marknaden själv inte kan göra. Efter att de fyra nämnda hindren dragits av finns nivån med den samhällsekonomiska potentialen. För att denna nivå ska vara i sin rätta storlek krävs att externa effekter som i dagsläget inte är internaliserade adderas. Den samhällsekonomiska potentialen innefattar emellertid inte de fiskala skatter som idag möter elanvändare, eftersom fiskala skatter har ett annat syfte än att internalisera externa effekter. Dessa innefattas dock i ingenjörspotentialen, eftersom de fiskala skatterna ingår i den prissignal på energi som energianvändarna möter. För att den samhällsekonomiska energieffektiviseringspotentialen ska nås bör dock marknadsmisslyckanden åtgärdas, förutsatt att dessa kan åtgärdas på ett kostnadseffektivt sätt. I denna studie innefattas marknadsmisslyckandena Asymmetrisk information samt Kollektiva varor sett ur aktörernas perspektiv: Kunskap och osäkerhet om ny teknik. Efter att den del av energieffektiviseringspotentialen som dessa marknadsmisslyckanden hindrar har dragits av återstår de energieffektiviseringar som faktiskt sker: dagens energieffektiviseringstakt. Denna business as usual -potential kan delas in i aktiva åtgärder, i form av aktiva beslut om energieffektiviseringsåtgärder, och indirekta åtgärder såsom att uttjänt utrustning byts ut och det nya är energieffektivare. Dagens energieffektiviseringstakt påverkas av dagens befintliga styrmedelsportfölj. Val och avgränsning av sektorer I valet av sektorer utgick Sweco ifrån Statistiska centralbyråns (SCB) sektoruppdelning vilka är industri, transport samt övrigt (bostäder och service med mera). Därefter delades dessa sektorer in i undergrupper. Industrisektorn delades upp i energiintensiv industri, areella näringar, byggindustrin och övrig tillverkande industri. Transportsektorn delades in i de fyra transportslagen väg, spår, flyg och sjöfart. Sweco valde att Övrigt-sektorn enbart skulle innefatta bebyggelse, då den största energianvändningen sker inom just bebyggelse. Slutligen delades bebyggelse i sin tur upp i småhus, flerbostadshus och tjänstesektorn. 19 december

25 Tjänstesektorn är heterogen och dess uppdelning baserades på Energimyndighetens uppdelning. Hinder och förutsättningar för ökad energieffektivitet skiljer sig åt inom dessa delsektorer. Sweco valde att fokusera på kontor för närmare studier, eftersom de har stor yta och energianvändning. Det finns även en stor energieffektiviseringspotentialen i absoluta mått mätt. I nästa skede användes ingenjörspotentialen 4 för varje sektor för att välja de sektorer med stor energianvändning och stor potential. Utifrån detta val exkluderades areella näringar, byggindustrin, sjöfart och flygfarten då de har en förhållandevis låg energianvändning. Statistiken inom dessa sektorer var även bitvis bristfällig samt missvisande 5. Trots att spårsektorn även har en förhållandevis låg energianvändning inkluderades den 6. Det fanns ett intresse att titta på möjligheten mellan överflytt mellan väg och spår. Vidare har även spårsektorn få antal aktörer, vilket gör möjligheten att nå ut till dessa större än för många andra sektorer. Transportsektorn har därför studerats utifrån godstransporter respektive persontransporter, för att på detta sätt bättre fånga överflytt mellan transportslag. De slutliga sektorerna som beaktas är: Flerbostadshus Småhus Kontorslokaler Energiintensiv industri Övrig tillverkande industri Persontransporter Godstransporter Uppdelningen är gjord främst utifrån vilken verksamhet företagen har och vilken energianvändning de har (typ av energi, storlek på energianvändning i förhållande till omsättning). Andra faktorer som kan påverka graden av energieffektivitet mycket är exempelvis ägarform och om det är ett stort eller litet företag. Detta analyseras inom ramen för respektive sektor. Offentlig sektor utgör inte en egen kategori utan är inkluderad i bebyggelse och transport med avseende på verksamheter Metodutmaningar Få studier har tidigare försökt kvantifiera hindren för energieffektivisering. Då förutsättningar och kontext skiljer sig åt mellan länder har det inte varit möjligt att använda sig av internationella studier i någon större omfattning. Det statistiska underlaget har även visat sig vara bristfälligt. Exempelvis är statistik gällande energianvändning per sektor ofullständig. Sammanfattningsvis finns otillräcklig sekundär data i form av statistik och litteratur inom det studerade området, vilket har gjort att Sweco har behövt utgå mer på primärdata för att besvara uppdragets frågeställningar. 4 Ingenjörspotentialen definieras i denna studie som summan av alla tekniskt möjliga energieffektiviseringsåtgärder med ett positivt ekonomiskt nuvärde med en given kalkylränta. 5 Statistiken för sjöfart och flygfart innefattar endast transporter inom Sverige vilket är missvisande. 6 Tågoperatörer schablondebiteras ofta elanvändningen och har således inte direkta incitament att hålla nere elanvändningen. 19 december

26 Det var även varit en utmaning att säkerställa att urvalet av intervjupersoner är representativt för branschen samt att individerna har tillräcklig kunskap och kompetens inom energieffektiviseringsområdet. Utmaningen överkoms genom ett noga urval baserat på Swecos nätverk. Fördelningen av intervjupersoner har även tagits i beaktning när bedömningarna har justerats. En relaterad utmaning var att få intervjupersoner och deltagare i expertpanelen att tolka och värdera hindren korrekt då marknadsmisslyckanden och inte är en intuitiv terminologi för de flesta. Det fanns därmed en risk att de associerade hindren tolkades utifrån praktikerns synsätt, inte utifrån hindrens definition. Utmaningen hanterades genom att upprepade gånger återvända till hindrens definitioner och kontrollera att individen beskrev hindret utifrån vald definition. Val av indelning var även en utmaning, framförallt eftersom hindren inte är separata utan överlappar varandra - speciellt Transaktionskostnader, Organisatoriska och Begränsad rationalitet. Dessutom existerar inte alla i samtliga sektorer. Samma kategorier användes likväl för att främja jämförbarhet. Då sektorernas framtida utveckling är beroende på konjunkturutveckling och andra osäkra trender har antaganden därmed gjorts. För att minska osäkerheten och möjliggöra jämförbarhet med andra analyser, har samma antaganden använts i den mån det är möjligt, såsom antaganden gjorda i Konjunkturinstitutets prognoser. Vissa antaganden har även presenterats vid expertpanelerna för att kontrollera att de överensstämmer med deras syn på utvecklingen. De potentialbedömningar som har använts som underlag för vår bedömning av sektorpotential innehåller även osäkerheter och baseras på olika metoder. De är dessutom från olika år och sträcker sig olika långt. Hänsyn har tagits till de varierande förutsättningarna när den sammanvägda bedömningen har gjorts. Slutligen är den spontant realiserade potentialen schablonmässigt antagen, vilket ger en osäkerhet i värdena. Anledningen är att det finns begränsat med tidigare studier som kvantifierar denna. För bedömningen av den spontana potentialen har vi utgått från de bedömningar som finns angående befintliga styrmedels effekt, samt en analys av historisk trend för energieffektivitet per nytta i respektive sektor. 19 december

27 2.5 Genomförande Datainsamling har skett genom litteratur- och statistikstudier, samt genomförandet av intervjuer och expertpaneler. Dessa moment beskrivs i detalj nedan Litteraturstudie Litteraturstudien gemomfördes för att i första hand kartlägga kunskapsläget inom kvantitativa bedömningar av marknadsmisslyckanden och för energieffektivisering. Det finns ett begränsat antal vetenskapliga studier gjorda i Sverige, varför även internationella artiklar har beaktats. Litteraturstudien visar att det finns ett begränsat antal studier gjorda vad gäller kvantifiering av för energieffektivisering. Dock finns det ett flertal studier som kvalitativt beskriver hindren. I den mån värdering av för energieffektivisering har gjorts, är det vanligast förekommande inom bebyggelsesektorn. Ett fåtal värderingsstudier har även påträffats inom transport- och industrisektorn. Asymmetrisk information och Transaktionskostnader är de som det främst finns ansatser till att kvantifiera. Det finns ytterst lite litteratur som försökte kvantifiera Finansiella- och Organisatoriska samt Policyinstabilitet. Källorna värderades efter deras metod, land, akademisk nivå och datum för publikation. Exempelvis kontrollerades huruvida de som utfört studien har tagit hänsyn till observerbar karakteristika, det vill säga om författarna har anpassat resultaten efter faktorer som kan påverka resultatet i en viss riktning, såsom olika utomhustemperatur för byggnader etcetera. Studierna värderades efter land då olika förutsättningar kan råda i olika länder och således ha stor påverkan på ett energieffektiviseringss storlek. Faktorer som kan skilja sig åt är till exempel landets ekonomiska situation, förekomst av varm- respektive kallhyra, typ av industri, hierarki och nivå av lokala utsläpp. Studier som publicerats angående länder som är likartade Sverige, såsom Norge och Holland, anses därmed mer användbara än studier från exempelvis Kina. I en separat litteraturstudie genomfördes en kartläggning av litteraturen kring negativa externa effekter. Ändamålet var att kartlägga och sedan använda sig av redan existerande miljöekonomiska värderingar av de negativa externa effekterna från energiproduktion samt utsläpp från fordonsanvändning. Externa kostnader är uppskattade kostnader från negativa externa effekter som inte återspeglas i marknadspriserna, exempelvis kostnader för miljö- och hälsopåverkan av luftföroreningar. Det har pågått relevant forskning på området under en längre tid, både i Sverige och i Europa, som Sweco tagit del av under arbetets gång. Uppskattningar för externa kostnader för el- och värmeproduktion i Sverige som presenteras här är baserade på den senaste sammanställningen av uppgifterna i Ecofys interimrapport 7 som i sin tur hänvisar till forskningsresultat i följande projekt: ExternE ( ), CASES ( ), 7 EU-kommissionen: Subsidies and costs of EU energy, En interimrapport publicerad den 10 oktober december

28 NEEDS ( ), ReCiPe ( ) and CE Delft (2010). Även tidigare litteratur på området förankrar analysmetoder och kvantifieringar av externa effekter i dessa forskningsprojekt, vilket är en bidragande orsak till att Sweco valt att hänvisa till denna källa. Andra fördelar är bland annat att siffrorna är aktuella, framtagna per produktionsteknologi och jämförbara i ett europeiskt sammanhang. Ecofys betonar att metoderna för att kvantifiera de externa kostnaderna kommer med en hög grad av osäkerhet, och att rapporten endast syftar till att identifiera storleksordningen för externa kostnader. En kort beskrivning av analysmetoden och relaterade osäkerhetsfaktorer ges för att belysa betydelsen av metodval för resultaten. Uppskattningar på internaliseringsgraden av de externa kostnaderna är baserade på en sammanställning av de viktigaste styrmedlen på respektive sektor i Sverige. Uppskattningar av externa kostnader och deras internaliseringsgrad för transporter i Sverige är baserade på Trafikanalys årliga rapportering kring transportsektorns samhällsekonomiska kostnader 8. Vid kvantifiering av externa kostnader hänvisar Trafikanalys till Trafikverkets tidigare arbete kring samhällsekonomiska principer och kalkylvärden för transportsektorn 9, som i sin tur har använt bland annat CE Delfts handbok 10 vid definition av analysmetoder. Trafikanalys sammanställning på området är den mest aktuella och täcker samtliga trafikslag för både person- och godstransporter i Sverige. Analysen innehåller även uppskattningar av internaliseringsgrader för respektive trafikslag och transportform Statistikstudie Statistik togs främst fram för olika sektorers energianvändning. Detta lät sig göras ganska väl, eftersom denna studies sektorsindelning gjordes med hänsyn tagen till tillgänglig statistik. I den mån statistik fanns tillgängligt togs det även fram data för andra förhållanden som kan påverka hindrens storlek såsom ägandeförhållanden, storlek på företaget samt energiintensivitet. Statistik har tagits från SCB, Energimyndigheten och Trafikanalys då de anses vara pålitliga källor. De flesta statistikkällor baserades på urvalsanalyser, även om ett fåtal var framräknade. Statistiken har använts för att få en bild över den totala energianvändningen, räkna fram energieffektiviseringspotentialen och således även storleken på hindren som hindrar denna potential samt för att beräkna utveckling av energianvändning över tid Intervjuer Huvudsyftet med intervjuerna var informationsinhämtning om påverkan av olika marknadsmisslyckande och/eller marknads samt dess upplevda effekter. Intervjuerna gav bidrag till dels en värdering av hindren, dels validering av de värderingar som gjordes genom expertpaneler. Genom att stegvis använda flera kvalitativa värderingsmetoder som baserades på resultaten av de tidigare genomförda arbetsstegen byggdes en systematisk kvalitetssäkring in arbetsprocessen. 8 Trafikanalys: Transportsektorns samhällsekonomiska kostnader, rapport 2014:4, Trafikverket: Samhällsekonomiska principer och kalkylvärden för transportsektorn, Rapport , CE Delft: Handbook on Estimation of External Costs in the Transport Sector, projekt framtaget för EU-kommissionen DGTREN, december

29 Sweco genomförde semi-strukturerade intervjuer där hindren diskuterades och konkretiserades. Avslutningsvis ombads intervjupersonerna i några steg värdera och kvantifiera hindrens storlek. Det sammanvägda resultatet från alla intervjuer har sedan använts för att få en samlad bedömning av hindrens storlek per sektor. Sammantaget genomfördes 45 intervjuer. Intervjupersonerna som valdes var mestadels företagsrepresentanter då vi sökte fånga bilden av hur tog sig uttryck bland just företag. En så kallad snöbollsansats nyttjades för att finna relevanta intervjupersoner, utifrån såväl Swecos eget nätverk som öppna sökningar identifierades organisationer och individer. Följande kriterier användes även för att nå en adekvat bredd av intervjupersoner: Intresse och engagemang för energifrågan Hur välutvecklat deras energieffektiviseringsarbete är Geografisk spridning i landet: norra Sverige, mellersta Sverige, södra Sverige Storlek på företag Utifrån intervjuernas syfte söktes främst organisationer och individer som de facto arbetat med energieffektiviseringsfrågor. De som knappt arbetat med energieffektiviseringsfrågor visade sig oftast inte vara medvetna om vilka de står inför. En större tonvikt lades därför på intervjuer med företag som arbetar mer utförligt med energieffektiviseringsfrågor. Att nå ut till målgruppen privatpersoner är svårt. Dessa behövdes för värdering av som småhusägare och bilägare står inför. För dessa två sektorer (persontransport och småhus) har därför organisationer som företräder dessa grupper, alternativt har god inblick i dessa gruppers förutsättningar, valts Expertpaneler För att få ytterligare en värdering av för ökad energieffektivitet samt för att kontrollera intervjupersonernas sammanvägda värdering av har Sweco använt sig av den semikvantitativa analysmodellen, TEQUILA, för expertpanelerna. Den är inspirerad av Delphimetoden, och har utvecklats inom EU-programmet ESPON 11 för att vetenskapligt och praktiskt bedöma och diskutera effekter av politiska åtaganden. I korthet består den av att sammansatta expertpaneler systematiskt får göra en bedömning i flera steg under ledning av en facilitator och i förväg uppgjorda kriterier. Målet med expertpanelerna har varit att få fram kvantitativa bedömningar av hur stor påverkan olika har på energieffektivitet i sektorn. Expertpanelens bedömningar har genomförts i tre steg. I steg 1 har expertpanelen genomfört en bedömning av hur respektive marknadsmisslyckande och marknads påverkar energieffektiviseringspotentialen inom vald sektor. Målet var bland annat att urskönja hur stort gapet är mellan samhällsekonomiskt effektiva åtgärder och faktiskt vidtagna åtgärder. 11 TEQUILA-modellen, utvecklad av Robert Camagni för ESPON (European Spatial Planning Observation Network), ESPON project 3.2: Spatial Scenarios and Orientations in relation to the ESDP and Cohesion Policy, december

30 I steg 2 identifierades, diskuterades och bedömdes förändringar och anpassningar som kan tänkas ske inom andra sektorer och i kundled. Exempel av dessa är rekyleffekter eller regionala/lokala begränsningar som kan uppkomma inom vald sektor, till exempel brist/tillgång på arbetskraft med rätt kompetens, otillräcklig kunskap om konsekvenser och möjligheter, otillräckliga ekonomiska incitament för förändring, attityder som försvårar mottagandet av kunskap och information etcetera. Bedömningarna graderades som positiva eller negativa. I steg 3 genomförde deltagarna individuellt en justerad sammanvägd bedömning av de initiala effektbedömningarna i steg 1 med hänsyn till de i steg 2 identifierade negativa och positiva effekter och anpassningar. Expertpanelens deltagare valdes ut för att kombinera vetenskaplig kunskap med erfarenhet från till exempel näringslivet och specifikt berörda sektorer. Vikt lades vid att deltagarna skulle förstå branschens/sektorns förutsättningar, vilka och möjligheter sektorn står inför vad gäller energieffektivitet samt hur incitament kan bidra till att hindren överkoms och möjligheter realiseras. Inbjudna experter visade stort intresse av att delta, dock satte en snäv tidplan vissa begränsningar och för några personer genomfördes därför separata kompletterande samtal. Expertpaneler genomfördes inom följande sektorer: Bebyggelse med fokus på flerbostadshus Industri Transporter Bedömning av energieffektiviseringspotentialen För att bedöma potentialen för energieffektivisering har Sweco först identifierat ingenjörspotentialen ifrån litteratur och utifrån respektive sektors förväntade trender och förutsättningar. Därefter har den energieffektivisering som Sweco bedömer kunna realiseras spontant med befintliga styrmedel subtraherats. Det är denna potential, den som förefaller privat- och företagsekonomiskt lönsam men som ändå inte kommer till stånd under rådande förutsättningar, som kan sägas hindras av de sju identifierade hindren. I syfte att få en grov indikation om den samhällsekonomiska potentialen har sedan den potential som hindras av de som inte är äkta marknads subtraherats. Storleken på denna potential härrör ifrån resultaten av intervjuerna och expertpanelerna. Observera dock att för att denna potential verkligen ska vara den samhällsekonomiskt optimala nivån förutsätts att negativa externa effekter är internaliserade. 19 december

31 2.6 Analys I analyssteget beräknades resultaten ifrån de bedömningsmatriser som intervjupersoner och deltagare i expertpaneler fyllt i. Dessa bedömningar justerades därefter baserat på projektgruppens samlade och omfattande erfarenhet inom sektorn samt intervjumaterialet som helhet. Utifrån dessa togs aspekter fram som anses viktiga att beakta vid styrmedelsutformning inom respektive sektor, samt ett antal konkreta styrmedelsförslag för vidare utredning Beräkning av resultat från matriser Följande datainsamling har skett per sektor. Intervjupersonerna har först rankat s relativa vikt 1-7 samt bedömt hur mycket respektive motverkar energieffektiviserings beslut på en fyrgradig skala 12. Expertpanelerna för sektorerna flerbostadshus, godstransport och industri fick genomföra samma ranking och bedömningsövningar. De fick även göra en bedömning hur angeläget det är att åtgärda respektive på skalan [-3, -2, -1, 1, 2, 3] ur följande perspektiv: samhällsekonomiskt, företagsekonomiskt och måluppfyllnad/ energibesparing. En normerad kvantifiering av bedömningarna genomfördes på följande vis. Intervjupersonernas markeringar för respektive och intervall summerades först. Därefter viktades värdet i respektive intervall genom multiplikation med 0 / 1 / 2 / 3, och summering gjordes sedan över intervallen per så att ett viktat värde per erhölls. Dessa värdens relativa andel utgör procentsatser i cirkeldiagram. Expertpanelens bedömning beräknades som ovan, men här fick även expertpanelen ta del av sitt resultat och kommentera. Rankingövningen sammanställdes på ett något annorlunda vis. Intervjupersonernas ranking summerades per och inverterades. De inverterade värdena analyserades av projektgruppen för att få en uppfattning om hindrens relativa vikt. I det andra tillvägagångssättet beräknades expertpanelens ranking som ovan, men här fick även expertpanelen ta del av sitt resultat och kommentera Justerad bedömning av resultat I många fall representerar intervjupersonerna sig själva och vissa delsektorer i högre grad än sektorn som helhet och de har ofta kommit längre i att överkomma för energieffektivisering än andra marknadsaktörer. Resultaten ifrån intervjuerna och expertpanelerna har därmed justerats utav Sweco för att ta detta i beaktning. Justeringen är baserad på projektgruppens samlade och omfattande erfarenhet inom sektorn samt intervjumaterialet som helhet. Expertpanelens resultat har även använts för att ytterligare kalibrera vilken situation som faktiskt råder i en sektor, samt hur närliggande samverkar och överlappar enligt deltagarnas protokollförda uppfattning om vilka företeelser som hör ihop med respektive /26-50/51-75/ procent 19 december

32 2.6.3 Styrmedelsutformning Utifrån analysen togs aspekter av vad som är viktigt vid styrmedesutformning både generella och sektorsspecifika fram. Utifrån dessa mer generella aspekter har även arbetats fram ett antal mer specifika styrmedelsförslag. De styrmedelsförslag som projektgruppen bedömde intressanta att gå vidare med listades och kategoriserades utifrån ett antal olika kategorier: Typ av styrmedel (Administrativt, Informativt, Ekonomiskt, Fou) Syfte (Löpande energieffektivisering, Nya processer/produkter, Samverkan och systemsyn) Systemnivå (Övergripande system, Process/fastighet, Komponent) Aktörsnivå (Samhälle, Företag, Individ) Hinder det överbygger (Asymmetrisk information, Kunskap och osäkerhet om ny teknik, Transaktionskostnader, Begränsad rationalitet, Organisatoriska, Finansiella, Policyinstabilitet) Utifrån dessa skapades en överblick över vilken typ av styrmedelsförslag som uppkommit, hur väl dessa svarar mot de främsta hindren (som bör åtgärdas) i respektive sektor samt vilken spridning det finns i kategorier av styrmedel. Genom detta kunde eventuella luckor av styrmedelsförslag identifieras och vid behov kompletteras med ytterligare förslag. Därefter diskuterades styrmedelsförslagen igenom och de som ansågs av extra stort intresse konkretiserades ytterligare. Framtagande av programlogik ryms inte inom detta projekt, dock noterades styrmedel är tänkt att överbygga, övergripande tankar om målgrupp samt tänkt påverkan i målgrupp. En uppdelning gjordes mellan faktiska styrmedel, samt önskvärda initiativ för energieffektivisering där Sweco inte ser att staten har en tydlig roll att fylla. Det är inte säkert att analysen har fångat upp alla de former som hindren tar sig uttryck i. Ytterligare styrmedel kan därför vara av intresse att överväga. Det föreslås därför man också bör undersöka hur övriga uttryck av dessa kan adresseras av styrmedel. Specifika tematiska förslag ges. 19 december

33 3 Kvantifiering av i litteraturen Som nämnts tidigare finns få studier med fokus på kvantifiering av för att öka energieffektivitet. Bland dem som ändå har gjorts återfinns främst Delade incitament och andra former av Asymmetrisk information, samt Transaktionskostnader. Först sker en genomgång av de studier som gjort ansatser till att kvantifiera hindren inom bebyggelse, därefter kommer en kortare del med de studier som gjort ansats att kvantifiera inom andra sektorer. En del litteratur med kvantifieringar finns även vad gäller negativa externa effekter, denna del behandlas separat i kapitel 4. Det finns ett antal marknadsmisslyckanden och som påverkar i vilken utsträckning energieffektivisering sker i fastigheter. Delade incitament framhålls ofta som ett viktigt skäl till att energieffektiviseringar i bebyggelsen inte sker i större utsträckning. Det finns ett antal studier, speciellt internationellt sett, som gjorts i syfte att kvantifiera detta marknadsmisslyckande. IEA, International Energy Agency, har gjort en omfattande ansats till att kvantifiera Delade incitament-problematiken för ett antal olika energianvändande sektorer och komponenter i olika länder. IEA har tagit fram ett ramverk för hur man kan kategorisera hur stor del av energianvändningen inom en sektor eller för en komponent som berörs av Delade incitament-problematiken. Denna indelning görs som en matris baserat på huruvida användaren betalar för energi eller inte och huruvida användaren kan välja teknik eller inte. 13 Dessa ger de fyra kategorierna inget delade-incitament-problem, effektivitetsproblem, effektivitetsproblem och användningsproblem samt användningsproblem, se Tabell 2. Tabell 2: IEA:s ramverk för att kvantifiera Delade incitament-problematik Slutanvändare betalar energiräkningen Slutanvändare betalar inte energiräkningen Källa: IEA, 2007 Slutanvändare kan välja teknik Case 1: Inget problem Case 3: Användnings- och effektivitetsproblem Slutanvändare kan inte välja teknik Case 2: Effektivitetsproblem Case 4: Användningsproblem Utifrån denna metodik har IEA genomfört ett antal kvantitativa uppskattningar av hur stor del av energianvändningen som hamnar inom respektive kategori. Bland resultaten kan nämnas att 31 procent av den totala energianvändningen i bostadssektorn i USA påverkas genom delade-incitamentsproblem i kylskåp, uppvärmning och belysning, att 41 procent av uppvärmningen av bostäderna och 40 procent av energianvändningen i kontorslokaler i Holland påverkas av Delade incitament, samt procent av Norges kontorslokaler IEA: Mind the Gap Quantifying Principal-Agent Problems in Energy Efficiency, IEA: Mind the Gap Quantifying Principal-Agent Problems in Energy Efficiency, december

34 I de flesta fall har de dock stannat vid att ange hur stor del av energianvändningen som berörs, vilket gör resultaten svåra att använda i andra länder. Rapporten beskriver dock hur metodiken kan användas för att gå vidare och även kartlägga hur stor del av energianvändningen som har potential att minskas om problematiken med Delade incitament undanröjdes. Wilkerson har använt IEA:s metodik och kvantifierar Delade incitament-problematiken för kylskåp, varmvattenberedare, uppvärmnings- samt kylsystem i USA. För kylskåp och varmvattenberedare fann Wilkerson att Delade incitaments påverkar dessa apparaters energianvändning med 4,7 respektive 3,4 procent. För uppvärmning och kylsystem (aircondition) var resultaten en besparingspotential på 11,9 respektive 25,2 procent om Delade incitament-problemetiken kunde undanröjas. Om man ser enbart till det huvudsakliga kylskåpet (det vill säga inte innefattar eventuella extra kylskåp) för hus som hyrs (där de boende generellt sett betalar elräkningen), finner Wilkerson att 10,2-12,0 procent kan sparas om Delade incitament-problematiken elimineras. Studien kontrollerar dock inte för faktorer som hushållens inkomstnivå, sammansättning och karakteristika. Det kan potentiellt finnas ett samband mellan inkomstnivån och viljan att köpa dyrare och mer energieffektiv utrustning. Om inkomstnivån även är korrelerad med förekomsten av Delade incitament, kan resultaten ovan både under- och överskatta den faktiska betydelsen av Delade incitament. 15 Även Maruejols & Young har använt IEA:s matrismetodik för sin studie av Delade incitament och energieffektivitet i kanadensiska flerfamiljsbostäder. Undersökningen innefattar temperaturinställningar, energianvändande apparater, beteende och energieffektivitetsförbättrande renoveringar. Resultaten ger kvantitativa resultat som indikerar att de Delade incitamenten påverkar vissa aspekter av de boendes beteende, som att de har högre inomhustemperatur och inte reglerar utifrån om någon är hemma eller inte. De finner att energianvändningen per ytenhet är 41 procent lägre för de som äger sitt boende och som själva betalar sin energikostnad än de som inte gör det, samt att den är 60 procent lägre för hyresgäster som betalar själva än för de som inte gör det. Maruejols & Young kontrollerar för inkomstnivå (intervall), hushållets storlek och vissa andra karakteristika. 16 Davis jämför beståndet av elanvändande hushållsapparater mellan boende som hyr respektive själva äger sin bostad i USA. Kontrollerat för inkomst och andra hushållskarakteristiska visar resultaten att de som hyr är mindre troliga att inneha energieffektiva ( energy star -märkta) kylskåp, tvättmaskiner och diskmaskiner. De som hyr är 6,7 procent mindre troliga att uppge sig inneha energieffektiva kylskåp. Motsvarande siffror för diskmaskiner och tvättmaskiner är 9,5 procent respektive 3,3 procent. Gillinghamn et al (2012) finner att boende i Kalifornien som själva betalar sin uppvärmningskostnad är 16 procent mer troliga att ändra värmeinställningarna nattetid och att de som dessutom själva äger sitt boende och betalar värmekostnaden för denna är 20 procent mer troliga att ha tilläggsisolerat tak och 13 procent mer troliga att ha tilläggsisolerade väggar. Även Gillinghamn et al kontrollerar för observerbara karakteristiska. 15 Wilkerson T., Jordan: The Energy Gap from Split Incentives in U.S. Residential Appliances, Stanford University, Maruejols, Lucie, Young, Denise: Split incentives and energy efficiency in Canadian multi-family dwellings, december

35 Dock finner dessa inget stöd för skillnader i generell temperaturnivå och total energiförbrukning som kan förklaras av Delade incitament från upplåtelseform och vem som betalar för energi. 17 Krishnamurthy & Kriström har gjort en landsöverskridande undersökning av Delade incitaments påverkan på energiförbrukningen för energieffektiva apparater, lågenergilampor, värmepumpar, solpaneler, isolering, värmetermostater, vindturbinder och lågenergifönster i elva olika OECD-länder. Efter att ha kontrollerat för inkomstnivå (intervall), hushållets storlek och vissa andra karakteristika finner de att ägare är 45 procent mer troliga än de som hyr att ha tillgång till energieffektiva apparater, 50 procent mer troliga än de som hyr att ha tillgång till energieffektiva lampor, 9,4 procent mer troliga än de som hyr att ha tillgång till tak/väggisolering, 9,8 procent mer troliga än de som hyr att ha tillgång till väggtermostat och 12,4 procent mer troliga än de som hyr att ha tillgång till isolerade fönster. 18 För bergvärmepump, solpaneler och vindturbiner hittades endast små skillnader. Dock borde utsträckningen av om de som hyr och själva betalar energin skilja sig åt mellan dessa länder, vilket borde påverka resultatet på ett sätt som är svårt för studien att kompensera för. Detta kontrollerar inte studien för. Phillips har gjort en undersökning av betalningsviljan i termer av högre hyra för bättre isolering, värme och energimärkning i Nya Zealand, och jämfört detta med hur mycket investeringar hyresvärden är beredd att göra. Resultaten visar att betalningsviljan hos hyresvärdar för olika energieffektiviserande investeringar är procent av vad hyresgästerna är villiga att betala för investeringarna. 19 I Sverige har vi hyresreglering, vilket gör att hyresvärdar inte kan vidareförmedla förhöjd kvalité på de boende fullt ut och således är denna undersöknings resultat svåra att applicera på Sverige. Den visar dock på hur Delade incitament och Asymmetrisk information påverkar hyresmarknaden. Sudarshan tar fram en ekonomisk modell vars resultat indikerar att cirka 20 procent av de energibesparingar som gjorts under senare tid kommer från styrmedel inriktade mot att minska Delade incitament. Sudarshan använder mikrodata ifrån 1993 till 2005 och hänsyn tas till heterogenitet av hushållstyper i populationen. 20 Resultaten bör dock betraktas med viss försiktighet, då författaren själv uppger att det denne gjort inte ska ses som en ansats att kvantifiera storleken på Delade incitament-problematiken. Studiens syfte är istället att räkna baklänges och härleda hur stor del av energibesparingarna som gjorts som kommer från styrmedel inriktade mot att minska Delade incitament En stor del av dessa studier som presenteras ovan har gjorts i andra länder, speciellt i USA. Det är viktigt att ta hänsyn till att dessa studier har gjorts i andra länder där byggnadsbeståndet, demografi, upplåtelseform, traditioner, energiengagemang, energikällor, energipriser med mera ibland kan skilja sig väsentligt ifrån Sverige. 17 David W., Lucas: Evaluating the slow adoption of energy efficient investments: are renters less likely to have energy efficient appliances?, Kiran Krishnamurthy, Chandra, Kriström, Bengt: How large is the Owner-Renter Divide? Evidence from an OECD cross section, Phillips, Yvonne: Landlord versus tenants: Information asymmetry and mismatched preferences for home energy efficiency, Sudarshan, Anant: Deconstructing the Rosenfeld curve: Structural determinants of energy consumption, december

36 Ett flertal svenska studier uppskattar den så kallade ingenjörspotentialen för energieffektivisering i bebyggelse. Ett fåtal svenska studier har även gjort ansatser att kvantifiera de marknadsmisslyckanden och som hindrar energieffektivisering. En underlagsrapport till Statens offentliga utredning SOU 2008:110 har tagits fram av Profu och innehåller en värdering av ingenjörspotentialen till 34 TWh möjlig energieffektivisering av slutlig energi inom bebyggelse. Denna räknades sedan av mot ett antal marknadsmisslyckanden och, samt mot det som antas ske spontant. 21 År 2010 publicerades en rapport som Profu gjort på uppdrag av Fastighetsägarna där värdena uppdaterats och anpassats till flerbostadshus och icke-offentliga lokaler. Denna finner att ingenjörspotentialen från 2008 till 2020 är 18,8 TWh för flerbostadshus och lokaler (exklusive offentliga lokaler och industrilokaler). Transaktionskostnader kvantifierades till att motsvara 3 TWh av den totala potentiella besparingen (16 procent), Delade incitament 2,4 TWh (13 procent), höga lönsamhetskrav och att ägare inte vill ta lån för investeringen 1,4 TWh (8 procent) och övriga 9 TWh (48 procent). Det spontana genomförandet uppskattades till 2,8 TWh (15 procent). 22 Vissa av siffrorna som nämns i rapporten skriver författarna själva att de gjort grova uppskattningar för och kan därför sägas vara behäftade med osäkerhet. WSP har på uppdrag av Sveriges Kommuner och Landsting beräknat ingenjörspotentialen för energieffektivisering för kommunala och landstingsägda fastigheter till 9 TWh (35 procent) Bland annat Delade incitament, finansieringsproblem och bristande kunskap lyfts fram som för energieffektivisering. 23 I denna rapport kritiseras marginalperspektivet, eftersom denna tar bort en stor del av besparingspotentialen. Ur ett samhällsekonomiskt och även investerarmässigt perspektiv är dock marginalkostnadsperspektivet det relevanta för att bestämma vad som är lönsamt. Resultaten ifrån studierna i Sverige och utomlands indikerar att Delade incitament generellt sätt är ett större problem för lokaler än för bostadshus. Kvantifiering av olika former av Delade incitament tyder på att kallhyra är det som hindrar energieffektivisering mest, eftersom detta ger minskade incitament för fastighetsägare att göra investeringar i klimatskal, kylning och uppvärmningssystem. Uppvärmning och nedkylning står för den största energianvändningen i bebyggelse, och det är temperaturinställningar och fasta installationer i byggnaden som har störst potential att minska den. Temperaturinställningar styrs i moderna hus generellt sett automatiskt via styr- och reglersystem, vilket medför att de som bor/brukar lokalen i dessa fall inte kan påverka denna. I Sverige är vidare inte kallhyra lika vanligt förekommande som i andra länder, vilket medför att Delade incitament inom bebyggelse (speciellt flerbostadshus) är ett mindre problem i Sverige än i många andra länder. Tidigare studier som gjorts stannar oftast vid att kvantifiera hur stor andel av en sektors/användargrupps energianvändning som berörs, snarare än i vilken utsträckning de berörs. Eftersom förekomsten av hyra/äga respektive kall/varmhyra kan se olika ut i olika länder är dessa resultat svåra att applicera i Sverige. Ifrån litteraturstudien är det därmed ett fåtal av studierna som kvantifierat och marknadsmisslyckanden på ett sätt som är applicerbart i Sverige. En kvantitativ uppskattning som bedöms applicerbar på svenska förhållanden är Wilkersons resultat att energianvändningen för kylskåp (exklusive potentiella extra kylskåp). 21 Profu, SOU 2008:110: Vägen till ett energieffektivare Sverige, Profu för Fastighetsägarna: Så når vi de nationella energimålen bebyggelsens energieffektivisering, Sveriges Kommuner och Landsting: Miljarder skäl att spara! Lönsamma energimål i kommunala fastigheter, december

37 Wilkerson finner att energianvändningen hos kylskåpen i hyresrätter skulle vara 10,2-12,0 procent lägre om Delade incitament-problematiken eliminerades. I Sverige ingår generellt sett kylskåp (hyresvärden ser till att det finns ett kylskåp när den boende flyttar in och ersätter det vid behov), medan den boende (hyresgästen) betalar elen. Detta deladeincitament-problem är därför aktuellt även i Sverige. I Sverige finns även Delade incitamentproblematik gällande varmvatten: varmvattnet ingår i hyran och den boende har därför lågt incitament att hålla nere på varmvattenförbrukningen. Wilkerson finner i sin studie att 4,8 5,9 procent av varmvattenanvändningen hos de som hyr skulle kunna sparas om Delade incitament-problematiken eliminerades. Utöver dessa värden bedöms Profus studier, om ingenjörspotentialen och storleksordningen på marknadsmisslyckanden och som utgör denna potential, vara användbara. Även om det är grova uppskattningar som Profu gör bedöms deras kvantifieringar att Transaktionskostnaderna motsvarar 3 TWh av den totala potentiella besparingen (16 procent), Delade incitament 2,4 TWh (13 procent), höga lönsamhetskrav och att ägare inte vill ta lån för investeringen 1,4 TWh (8 procent) och övriga 9 TWh (48 procent) vara användbara storleksbedömningar. Dock bedöms storleksuppskattningarna vad gäller Transaktionskostnader vara osäkra, eftersom dataunderlag i stort saknats. Den framgår inte huruvida problematiken med att hyresvärdar i storstäder generellt vill rusta sina fastigheter men att många hyresgäster inte vill det eftersom de då inte klarar hyran innefattas. Detta kan sägas vara ett exempel på Delade incitament, men Profu-studien verkar inte ha innefattat denna form av Delade incitament i studien. Det framgår inte heller vad som innefattas i övriga. Nedan redovisas andra studier (ej inom bebyggelse) som påträffats där ansatser gjorts att kvantifiera för energieffektivisering. Dessa är inom industri och övrigt näringsliv, transport, samt övergripande. Schleich har gjort en ansats att (ekonometriskt) värdera relevansen hos olika till ökad energieffektivitet i Tysklands kommersiella- och servicesektor. Studien baserar sig på data ifrån ett antal olika aktörer inom denna sektor. Bland annat återfinns bagerier, slaktare, bilreparatörer, byggföretag, tvätterier, hotell, banker och snickerier. Det som i studien värderas som starkast är Delade incitament som kommer av att en lokal hyrs. Även okunskap om energianvändningsmönster, brist på tid hos personalen och andra prioriteringar påvisas vara statistiskt signifikanta. Dock faller inte kunskapsbrist om energieffektiviseringsåtgärder, osäkerhet och en brist på kontinuerligt arbete med energi även i driftfas (att inte bara tänka på energi vid nyköp) ut som statistiskt signifikanta. 24 Det är svårt att säga om det faktum att vissa faller ut som betydelsefulla och andra inte beror på dataunderlag och metod eller om det speglar de faktiska hindrens storlek i sektorn. 24 Schleich, Joachim: Barriers to energy efficiency: A comparison across the German commercial and service sector, december

38 Venmans gör en ansats att kvantifiera triggers och barriärer för energieffektiviseringsåtgärder I keramik, cement- och kalksektorn i Belgien. Dessa industrier kan betraktas som energiintensiva. Studien baserar sig på fallstudier med diskussion av energieffektiviseringsprojekt, frågeformulär samt en intervjustudie med ett antal aktörer som fått värdera hindren samt kvalitativt beskriva dem. De hindren som får högst värdering i studien är att andra investeringar än energieffektiviseringsinvesteringar prioriteras (medelvärde 1,5), risken för att binda sig vid stora investeringar i lågkonjunkturer (1,2), osäkerhet kring ny teknik (1,2), svårigheter med intern och extern finansiering (1,2) samt osäkerhet om investeringen verkligen är lönsam (0,9). Totalt värderades 16. De som får lägst värdering är att energiansvarige hade lågt inflytande (0,1), att de som kan påverka energianvändningen internt inte är ansvariga för detta (0.2) samt Delade incitament internt (0,3). 25 Resultaten ifrån denna studie bedöms vara av intresse även för Sverige, även om förutsättningarna kan skilja sig något mellan Sverige och Belgien. Kvantifieringen är inte heller gjord i procent av total missad energieffektivitet eller i energimängd, utan har mer karaktären av en ranking. De definitioner som valts är givetvis inte heller helt överensstämmande med de som antagits i denna studie, vilket ytterligare försvårar användbarheten något. Settle & Tschirhart har gjort en ansats att generellt (inte för en specifik sektor) kvantifiera Asymmetrisk information vad gäller energibesparingar i Nederländerna. I studien indikeras en skillnad på 3,73 procent energibesparing beroende på om asymmetrisk eller fullständig information gäller. Dock påvisar studien även att detta är mindre än inverkan av energipriser och Transaktionskostnader. Att studien gjorts på övergripande nivå och inte för en specifik sektor reducerar användbarheten. 26 Valentova diskuterar hindren energipriser (att samtliga kostnader inte reflekteras i priset), begränsat tillgång till kapital, informationsbrist, felaktig riskbedömning, principal-agentproblem och Transaktionskostnader. Extra stort fokus läggs på Transaktionskostnader, med motiveringen att detta är relaterat till de övriga. Valentova sammanställer resultat ifrån sju andra studier som kvantifierat Transaktionskostnader där storleken på Transaktionskostnaderna varierar mellan 8 och 40 procent av den totala kostnaden för ett energieffektiviseringsprojekt. 27 Studien är användbar eftersom en översikt av spannet för Transaktionskostnaders storlek fås. Även denna studie är dock gjord på övergripande nivå och med resultat ifrån olika länder. Brown värderar hur stora energibesparingar som kommit av teknik som utvecklats inom ramen för statligt finansierade program i USA (fem olika), vilket kan sägas vara ett sätt att uppskatta värdet av kollektiva varor (det är ett för energieffektivisering om inte kollektiva varor tillhandahålls i lämplig utsträckning). 25 Venmans, Frank: Triggers and barriers to energy efficiency measures in the ceramic, cement and lime sectors, Settle, Chad, Tschirhart, John: Measuring the Impact of Asymmetric Information: An Example from Energy Conservation, Valentova, M.: Barriers to Energy Efficiency Focus on Transaction Costs, december

39 Exempelvis uppskattar Brown att lågemissionsfönster sparar 3 miljarder US dollar, kylkompressorer 6 miljarder dollar och mjukvara för byggnadsdesign 11 miljarder dollar fram till Då dessa värden är redovisade i dollar och inte i energimängd är de svåra att relatera till dagens pengavärde och energiförbrukning i Sverige (populationsutveckling, inflation, ändrade valutakurser, ändrade energipriser). Meier & Vernon använder sig av statistik (från amerikanska staten och branschorganisationer) för att kvantifiera hur stor del av lastbilsbranschen som är utsatt för Delade incitament, i form av att den som har möjlighet att påverka energieffektiviteten inte är den som betalar för energin. De finner att upp till 91 procent av den totala bränslekonsumtionen i lastbilar i USA påverkas av så kallade användarproblem inom principal agent, eftersom chauffören i dessa fall inte betalar för använt bränsle och således saknar incitament att agera energieffektivt. Studien finner även att 23 procent av lastbilarna är utsatta för ett effektivitetsproblem inom principal agent, där den som äger en lastbil hyr ut denna och därför inte betalar för drivmedlet, vilket innebär att incitament saknas att gör energieffektiviserande investeringar i lastbilen (exempelvis förbättrad aerodynamik, lägre däckmotstånd). Studien har inte kvantifierat hur mycket av energieffektiviteten som hindras på grund av den principal agent-situation och de Delade incitamenten som råder. 29 Trots Delade incitament internet har ju företag incitament att vara energieffektiva totalt sett. Troligtvis ser strukturen vad gäller ägande och vem som betalar för drivmedel i lastbilstransportbranschen i Sverige annorlunda ut, vilket gör studiens resultat svåra att applicera på svenska förhållanden. Graus & Worrell gör en ansats att värdera hur principal agent (vilket är en form av Asymmetrisk information) mellan företag och de som kör företagsbilar leder till en överkonsumtion av drivmedel i berörda bilar. De visar att 11 procent av personbilarna är företagsbilar, men att dessa konsumerar 21 procent av den totala energikonsumtionen i personbilsflottan i Nederländerna. Å ena sidan är företagsbilar generellt sett nyare och har mer dieselmotorer (vilket är mer energieffektivt). Å andra sidan tenderar de också att vara större, vilket sänker energieffektiviteten ner till något sämre än andra personbilar i snitt. Studien lyfter även att företagsbilar kör något mer (längre sträcka per år) än andra personbilar. Totalt sett menar studien att förekomsten av Asymmetrisk information gällande företagsbilar kan innebära en ökad bränsleförbrukning på 1-7 procent (vilket innebär försämrad energieffektivitet) per år i den nederlänska personbilsbilsflottan. 30 Även i detta fall är det troligt att aktörsrelationerna och incitamentsstrukturen kan se annorlunda ut i Sverige, vilket gör att studiens resultat har begränsat värde att använda i Sverige. 28 Brown, Marilyn A.: Market failures and barriers as a basis for clean energy policies, Maier, Alan, Vernon, David: Identification and quantification of principal-agent problems affecting energy efficiency investments and use decisions in the trucking industry, Graus, Wina, Worrell, Ernst: The principal-agent problem and transport energy use: Case study of company lease cars in the Netherlands, december

40 4 De negativa externaliteterna Enligt välfärdsekonomin definieras en externalitet som en sidoeffekt av en agents agerande på marknaden som inte är avsiktlig eller prissatt och som har en direkt påverkan på en annan agents välfärd. Externaliteter kan vara både positiva och negativa. Om externaliteter inte prissätts, kommer dessa hindra en optimal resursfördelning på en fri marknad och därmed leda till marknadsmisslyckande. Genom att tilldela äganderätter eller prissätta externaliteter genom införandet av skatter, avgifter, regleringar eller subventioner kan deras effekter bli internaliserade av marknaden och incitamenten till en mer effektiv resursfördelning därmed skapas. I praktiken är dock både positiva och negativa externaliteter svåra att identifiera, kvantifiera och därmed prissätta. Kvantifieringen förutsätter att en rad antaganden, förenklingar och värderingar görs kring parametrarna. När externa kostnader och internaliseringsåtgärder jämförs på en aggregerad nivå görs också antaganden kring den förutsatta kausaliteten mellan styrmedlen och marknadsinternaliseringen, vilket kan vara missvisande. En högre internaliseringsgrad skapar en prissignal, men beroende på olika marknadsmisslyckanden behöver denna inte leda till den önskade omallokeringen. Effekten av olika styrmedlen borde därmed analyseras i en specifik marknadskontext med hänsyn till marknadsmisslyckanden innan slutsatser av marknadseffektivitet kan dras. Detta kapitel syftar till att identifiera de negativa externaliteter som energiproduktionen i Sverige innebär. Sektorn är uppdelad i elproduktion, värmeproduktion och transporter. Kapitlet syftar även till att utifrån befintlig litteratur på området sammanställa hur dessa externaliteter kvantifierats och prissätts i Sverige. På detta sätt kan den nuvarande internaliseringsgraden uppskattas. Det finns en mängd externa effekter för transportsektorn och en mängd styrmedel, och alla dessa externaliteter och styrmedel är inte kopplade till energianvändning. Dock finns en stark koppling mellan energianvändning och den faktiska sträcka som körs. I denna analys är enbart styrmedel i form av de viktigaste skatter och avgifter medtagna 31, då fokus ligger på hur väl de negativa externa effekterna är internaliserade i prissignalen. Det finns även flera styrmedel, bland annat kvantitativa gränsvärden, som är inriktade mot att korrigera negativa externa effekter. Observera även att de skatter och avgifter som möter elanvändare inte alltid är avsedda att internalisera de externa effekterna; det kan även röra sig om fiskala skatter. Följden blir dock ändå en förstärk prissignal, varför dessa skatter tagits med vid beräknandet av internaliseringsgrad. De viktigaste kvantitativa regleringar är medtagna i uppskattningar av de nationella externa kostnaderna. 31 Inklusive prisgenomslaget på el som uppkommer av handeln med utsläppsrätter. 19 december

41 4.1 Val av metod De negativa externaliteterna i form av föroreningar sprider sig genom luft, vatten och mark och har en påverkan på människornas hälsa, ekosystemet, den biologiska mångfalden samt utarmningen av olika tillgångar såsom vatten, metaller, bränslen, grödor med mera. Det finns även andra externaliteter från energiproduktion och transportarbetet såsom buller och olycksrisk. Uppskattningar för externa kostnader för el- och värmeproduktion i Sverige som presenteras här är baserade på den senaste sammanställningen av uppgifterna i Ecofys interimrapport 32 som i sin tur hänvisar till forskningsresultat i följande projekt: ExternE ( ), CASES ( ), NEEDS ( ), ReCiPe ( ) and CE Delft (2010) (se Bilaga 1 för ytterligare information om dessa källor). Det finns flera metoder som kan användas vid kvantifiering av externa kostnader. Kvantifieringsmetoden som tillämpas i Ecofys-rapporten baseras på bedömning av de skador som externaliteterna orsakar, så kallad damage cost approach. Metoden syftar till att bedöma den totala sociala kostnaden förknippad med energiproduktion. Ecofys betonar att metoderna för att kvantifiera de externa kostnaderna kommer med en hög grad av osäkerhet, och att rapporten endast syftar till att identifiera storleksordningen för externa kostnader. Uppskattningar på internaliseringsgraden av de externa kostnaderna är baserade på en sammanställning av de viktigaste ekonomiska styrmedlen för respektive sektor i Sverige. Uppskattningar för externa kostnader och deras internaliseringsgrad för transporter i Sverige är baserade på Trafikanalys rapportering för 2014 av transportsektorns samhällsekonomiska kostnader. 33 Vid kvantifiering av externa kostnader hänvisar Trafikanalys till Trafikverkets tidigare arbete kring samhällsekonomiska principer och kalkylvärden för transportsektorn 34, som i sin tur har använt bland annat CE Delfts handbok 35 vid definition av analysmetoder. Trafikanalys sammanställning på området är den mest aktuella och täcker alla relevanta trafikslag för både person- och godstransporter i Sverige. Analysen innehåller även uppskattningar av internaliseringsgrader för respektive trafikslag och transportform. 4.2 Kraftproduktion Kraftproduktion ger upphov till externa kostnader. Det finns olika kategorier av externa kostnader, exempelvis miljöpåverkan, försurning av mark och utarmning av resurser. Olika produktionsteknologier ger upphov till olika externaliteter och i olika hög grad. Utöver beskattning i produktionsledet sker även beskattning i användarledet. Internaliseringsgraden skiljer sig åt mellan olika kategorier av elanvändare. 32 EU-kommissionen: Subsidies and costs of EU energy En interimrapport publicerad den 10 oktober Trafikanalys: Transportsektorns samhällsekonomiska kostnader, rapport 2014:4, Trafikverket: Samhällsekonomiska principer och kalkylvärden för transportsektorn, ASEK 5. Rapport , CE Delft: Handbook on Estimation of External Costs in the Transport Sector, projekt framtaget för EU kommissionen DGTREN, december

42 4.2.1 Kategorier för externa kostnader Ecofys har använt sig utav External-E verktyg för uppskattning av externa kostnader. Verktyget integrerar (1) en livscykelanalys för de externa effekterna som omfattar hela värdekedjan och produktionsanläggningens hela livslängd, (2) faktiska produktions- och kapacitetsdata som aggregerar de externa effekterna på medlemsstatsnivå samt (3) metoder för kvantifiering av de externa effekterna i monetära termer (se bilaga 2 för en schematisk beskrivning av analysmetoden). För varje enskild produktionsteknologi har samtliga externa kostnader, inklusive elanvändningen i leveranskedjans uppströmsprocesser, tagits i beaktning. I den totala sammansatta nationella produktionsportföljen har dock de externa effekter som annars skulle räknats två gånger dragits bort, dubbelräkning föreligger således inte. Det finns totalt 18 stycken kategorier av miljöpåverkan som livscykelanalysen omfattar (se Tabell 3). Dessa kategorier sammanfattar påverkan av flera parametrar. Ett exempel är klimatförändringen som mäts i enheten kg CO 2 -ekvivalent, denna kategori omfattar samtliga växthusgasernas påverkan på klimatförändringen. Ett annat exempel är kategorin partikelbildning med enheten kg PM 10 eq som utöver PM 10 även omfattar konsekvenserna av NH 3, SO 2 och NO x. I tabellen nedan presenteras även de externa kostnaderna som kvantifieringsmetoder för respektive kategori ger upphov till. 19 december

43 Tabell 3: Kategorier av miljöpåverkan och relaterade externa kostnader Kategori av miljöpåverkan Enhet Externa kostnader (EUR 2012 /unit) Klimatförändringar kg CO 2 eq 0, ,00667 EUR/kgCO 2 e (EU-ETS) Uttunning av ozonskiktet kg CFC-11 eq 107 Försurning av mark kg SO 2 eq 0,2 Eutrofiering av sötvatten kg P eq 0,2 Eutrofiering av havsvatten kg N eq 1,8 Toxicitet för människor kg 1.4-DB eq 0,04 Fotokemisk oxidantbildning kg NMVOC 0,0023 Partikelbildning kg PM 10 eq 15 Toxicitet för ekosystemet/mark species.yr.m 2 1,04E-09 Toxicitet för ekosystemet/sötvatten species.yr.m 3 2,95E-12 Toxicitet för ekosystemet/havsmiljö species.yr.m 3 5,68E-17 Joniserande strålning Kg U235 eq kbq 0,001 Användning av mark till jordbruk m 2 a 0,09 Användning av mark till städer m 2 a 0,1 Naturlig omvandling av mark m 2 3,6 Utarmning av vatten m 3 0,2 Utarmning av metaller kg Fe eq 0,07 Utarmning av energiresurser 36 kg oil eq 0,05 Källa: Ecofys, EU-kommissionen, 2014 Vid kvantifiering av kategorin klimatförändringar har den skadan som utsläppen idag har på ekosystemet i framtiden mäts. De flesta estimaten om den faktiska kostnaden varierar mellan 25 EUR/tCO 2 eq och 85 EUR/tCO 2 eq beroende på referenstidspunkt, klimatscenarier med mera. Det innebär att det nuvarande marknadspriset på CO 2 är lågt i förhållande till skadekostnaden. Värdet som Ecofys redovisar, 50 EUR/tCO 2 eq, anses motsvara ett medelhög scenario för den globala uppvärmningen. Marknadspriset för utsläppsrätter av CO 2 (European Emission Allowances (EUA) inom det europeiska handelssystemet för utsläppsrätter 37 ), för närvarande kring 7 EUR/tCO 2 eq, redovisas separat i Tabell 3 i och med att den har subtraherats som internaliserad kostnad från uppskattningar av externa kostnader som redovisas nedan. 36 Framtida värdet på resurser är svårt att bedöma och kan skilja sig åt mellan de olika resurserna. T.ex. de bränslen som inte har så många alternativa användningsområden kan komma att ha ett lägre värde i framtiden än vad de har idag. 37 EU Emission Trading System (EU-ETS) 19 december

44 4.2.2 Externa kostnader för kraftproduktionsteknologier Analysen för externa kostnader har genomförts för olika kategorier av produktionsteknologier i Europa, inklusive processer i både uppströms och nedströms av leveranskedjan. Det är teknologier som använder sig utav fossila bränslen som har de högsta externa kostnaderna, följt av kärnkraft och förnybara kraftproduktionsteknologier. En betydande del av de externa kostnaderna förknippade med förnybara kraftproduktionsteknologier är från uppströmsprocesser, såsom bränslen för transport eller elanvändning i produktion. Av kostnadskategorierna är klimatförändringen, utarmningen av energiresurser, partikelbildning och toxicitet för människor de kategorier som har högsta externa kostnader. Figur 2 visar de externa kostnaderna per produktionsteknologi för el. 38 Figur 2: Externa kostnader per produktionsteknologi för el [EUR 2012 /MWh th ] Källa: Ecofys, EU kommissionen, 2014 Det kan också noteras att externa kostnader från kraftproduktion i kraftvärmeverk är mycket lika värdena från renodlade kraftproduktionsanläggningar med samma bränsle. De externa kostnaderna är högst för kraftvärmeverk som drivs med stenkol, följt av gas, avfall och biomassa. Även om verkningsgraden i kraftvärmeverk är potentiellt högre än i kraftverk som enbart producerar el, visar statistiken att detta i praktiken ofta inte är fallet. Uppskattningen av externa kostnader för kärnkraft skiljer sig från de övriga teknologierna i och med svårigheten att uppskatta kostnader för olyckor. Alla former av energikällor och energiproduktion har en associerad olycksrisk. 38 Avfallsförbränning ger å ena sidan upphov till utsläpp, vilket är en negativ extern effekt. Å andra sidan skulle alternativet till förbränning många gånger vara deponi vilket har andra negativa externa effekter. Såldes är det även en undviken negativ extern effekt att förbränna soporna. Dock är det bästa alternativet vad gäller sopor en högre grad av återvinning. I figuren redogörs för Ecofys (på uppdrag av EU-kommissionen) bedömning. 19 december

45 Exempelvis har det inträffat olyckor i kolgruvor (främst utanför EU) samt olyckor vid utvinning av gas och olja. Vad gäller kärnkraft är de möjliga konsekvenserna av en olycka mycket högre än för andra energikällor. Även om riskerna kan anses små är påverkan potentiellt mycket stor. Beroende på vilken typ och omfattning av olycka det är (härdsmälta eller en kritisk olycka), samt hur ofta en olycka inträffar, påverkar storleksuppskattningen av de negativa externa effekterna. Ecofys hänvisar i sin studie till ett femtal olika tidigare gjorda uppskattningar av externa effekter för kärnkraft som kommer av olycksrisken och uppskattar sammanvägt att de externa kostnaderna för kärnkraftsolyckor ligger i intervallet 0,5 4 EUR/MWh. 39 Sweco har använt den högsta bedömningen, 4 EUR/MWh. Detta illustreras i en separat kostnadskategori i Figur 2 ovan Externa kostnader i kraftproduktion i Sverige Analysen för externa kostnader har även genomförts för alla medlemsländer i EU. Uppskattningarna utgår ifrån sammansättningen av produktionsteknologier i varje land och tar inte hänsyn till marknadsområden, analysen omfattar exempelvis inte den nordiska produktionsmixen. Den externa kostnaden för Sverige är uppskattad till 8,9 EUR 2012 /MWh e, vilket motsvarar cirka 81 Kr/MWh e 40. Som nämnt ovan tar siffran hänsyn till internaliseringen av den delen av klimatpåverkan som täcks av EU-ETS. Uppskattningen är därmed något högre än de resultat som presenterades av kommissionen utifrån Extern-E metodiken år 2008, där externa kostnader för Sverige uppskattades variera mellan 4,6 och 9,8 uttryckt i EUR 2012 /MWh e 41. Dessa externa kostnader är låga i europeisk jämförelse, där det genomsnittliga värdet för alla EU-länder är 38,3 EUR 2012 /MWh e och enbart för två länder redovisas lägre estimat än för Sverige, nämligen Danmark (2,9 EUR 2012 /MWh e ) och Luxembourg (6,1 EUR 2012 /MWh e ). Den totala externa kostnaden för Sverige är en summa av de olika kostnadskategorierna enligt uppskattningsmetoden som presenterats ovan. De fyra största kategorierna i Sverige överensstämmer med de motsvarande största kategorierna på europeisk nivå och står tillsammans för cirka 90 procent av den totala externa kostnaden. Utarmningen av energiresursen är den största kategoring med 57,6 procent av de totala externa kostnaderna följt av klimatförändringen (13,2 procent), toxiciteten för människor (11,1 procent) samt partikelbildningen (7,6 procent) (Figur 3). 39 EU-kommissionen: Subsidies and costs of EU energy En interimrapport publicerad den 10 oktober Med valutakurs 9,1 SEK/EUR. 41 European Environmental Agency: EN35 External costs of electricity production, december

46 Figur 3: De viktigaste kategorier av externa kostnader i kraftproduktion i Sverige 10,4% 7,6% Utarmningen av energiresurser Klimatförändringen 11,1% Toxicitet för människor 57,6% Partikelbildning 13,2% Övriga kategorier Källa: Ecofys, EU kommission, 2014 Ett annat sätt att betrakta externa kostnader är att betrakta kostnader relaterade till marginalproduktionen av el, vilket i Sveriges fall är kolkraft. De externa kostnaderna för kolkraft är betydligt högre än den genomsnittliga kostnaden på 8,9 EUR 2012 /MWh e för produktionsmixen i Sverige. För el som produceras av stenkol är den externa kostnaden uppskattad till 95,3 EUR 2012 /MWh e enligt ovan Internalisering av externa kostnader för kraftproduktionen Det finns två huvudsakliga styrmedel i Sverige som är direkt kopplade till internalisering av externa kostnader från elproduktionen. Det första är handeln med utsläppsrätter (EU-ETS) som infördes år 2005 som ett verktyg för EU att minska utsläpp av växthusgaser i enlighet med åtagandena i Kyotoprotokollet. Utsläppshandeln bygger på att ett tak sätts för den totala utsläppsnivån. Företag som har höga kostnader för minskning av utsläpp kan köpa utsläppsrätter från företag med lägre kostnadsbild, vilket leder till en ekonomiskt effektiv resursfördelning. Under de senaste åren har priser på utsläppsrätter varierat, men låg i genomsnitt på 6,67 EUR/tCO 2 år Uppskattningsvis medför detta pris en ökning med knappt 5,3 öre/kwh, eller 53 kr/mwh (motsvarande 5,8 EUR/MWh) på elpriset på Nord Pool Spot. 42 Denna prispåverkan är alltså redan inräknat i kalkylen ovan. Det andra styrmedlet är elcertifikat. Elcertifikat är ett marknadsbaserat stödsystem med syftet av att främja produktion av el från förnybara källor. Elcertifikat tilldelas för varje producerad MWh e för de berättigade teknologierna. Genom försäljningen av elcertifikat till kvotpliktiga elanvändare 43 får producenterna en extra intäkt vilket ökar de förnybara teknologiernas möjlighet att konkurrera. Tumregeln för beräkning av elcertifikatprisets påverkan på elpriset i konsumentled är certifikatpris * kvot/1000 = öre/kwh. 42 Tumregeln är att ett pris på 10 EUR/tCO2 leder till en ökning med knappt 8 öre/kwh på elpriset på Nord Pool Spot. 43 Kvotplikten 17,9 procent år 2012 och 14,2 procent år 2014, hämtat från den 28 november december

47 Kr 2012/kWhe Kvantitativ utvärdering av marknadsmisslyckanden och För det genomsnittliga certifikatpriset på 167 kronor år 2012 och kvotplikten 17,9 procent resulterar detta i en höjning av konsumentpriset på el med cirka 3 öre/kwh, eller 30 kr/mwh (motsvarande 3,3 EUR/MWh) 44. EU ETS och elcertifikat har införts för att styra mot politiskt satta mål. EU ETS är tänkt att få fram en marknadsmässig prissättning på utsläpp. Dock är EU ETS inte en korrekt prissättning för att hantera klimatfrågan, utan en kompromiss mellan EU:s medlemsstater för att vara ett första steg i att reducera utsläppen av växthusgaser. Priset på EU ETS och elcertifikat varierar över tid. Detta gör att internaliseringsgraden kan ändras över tid; ifall priset på utsläppsrätter stiger ökar även internaliseringsgraden, eftersom kunderna möter en högre prissignal. Utöver utsläppshandel och elcertifikat finns det även en energiskatt på el i Sverige som är hög i europeisk jämförelse. Energiskatten på el är i grunden fiskal och egentligen inte ett optimalt verktyg för att reducera negativa externa effekter, exempelvis har den inte någon påverkan på underliggande produktionsmix. Internaliseringsgraden bedöms dock här inte utifrån olika skatters syfte, utan den påverkan de har på prissignalen som målgruppen möter, varför denna har inkluderats. I större delen av Sverige ligger energiskatten på el på 29,3 öre/kw, eller 293 kr/mwh (motsvarande 32,2 EUR/MWh). Enbart Danmark har en energiskatt på el som överstiger grundnivån för skatten i Sverige. Kommuner i norr och nordväst 45 har en något lägre energiskatt (19,4 öre/kwh), och tillverkande industriell verksamhet betalar 0,5 öre/kwh. En del verksamheter, såsom exempelvis kemisk reduktion, metallurgiska processer och tågdrift, är helt undantagna energiskatten på el. 46 Även i flera andra länder har framförallt elintensiva industrier skattereduktioner, men skattenivån 0-0,5 öre/kwh är bland de lägsta i Europa. I Figur 4 visas internaliseringen av de externa kostnaderna för elproduktion. Figur 4: Internalisering av externa kostnader för elproduktion referensår 2012 [öre/kwh] Externa kostnader Internalisering konsumenter Internalisering norra Sverige Tillverkande industri Externa kostnader EU-ETS Elcertifikat Elskatt Källa: Sweco, År 2014 är motsvarande prispåverkan 2,5 öre/kwh, eller 25 kr/mwh (alt. 2,7 EUR/MWh). 45 Den reducerade elkraftskatten gäller i samtliga kommuner i Norrbotten, Västerbotten och Jämtland, samt i kommunerna Örnsköldsvik, Sollefteå, Ånge, Ljusdal, Torsby, Malung-Sälen, Mora, Orsa och Älvdalen 46 Skatteverket: Energiskatt på el, hämtat från den 28 november december

48 Även om energiskatten på el inte primärt är ett styrmedel riktat till internalisering av externa kostnader har den en motsvarande effekt. Utifrån detta resonemang kan konkluderas att externa kostnader i sin helhet är internaliserade i Sverige, framförallt i konsumentpriset på el. Detta innebär att det framförallt är industrier och andra användare med skattereduktioner på energiskatten som möjligen inte bär sina externa kostnader, beroende på de rådande prisnivåerna på utsläppsrätter och elcertifikat 47. Observera dock att detta gäller för när genomsnittlig svensk produktionsmix antagits. Om ett marginalelsperspektiv istället antas, det vill säga att det är kolproduktion på marginalen som minskas då energieffektiviseringar sker, är de externa kostnaderna cirka tio gånger högre. Detta indikerar en internaliseringsgrad på 43 procent i skatterna och avgifterna som konsumenter betalar på el. Kväveoxidavgiften innefattas inte i uppskattningen av internaliseringsgraden i denna studie på grund av avgiftens konstruktion. Förbränningsanläggningar med produktion över 25 GWh per år betalar 50 kr per kg utsläppt NOx, varefter de inbetalda avgifterna återbetalas till de avgiftsskyldiga i förhållande till deras energiproduktion samma år 48. Om en marknadsaktör ändrar i sin bränslemix på ett sätt som ökar/minskar utsläppen av NOx med 1 kg, allt annat lika, är den marginella kostnadspåverkan 50 kr. I och med avgiftens konstruktion är det dock svårt att bedöma den marginella kostnadspåverkan och därmed prissignalens storlek, vilket är anledningen till att kväveoxidavgiften inte inkluderats i uppskattningen av internaliseringsgraden. 4.3 Värmeproduktion Värmeproduktion kan ske både i större anläggningar och distribueras ut till slutanavändare (främst som fjärrvärme), eller lokalt hos slutanvändarna. Värmen används sedan främst för att värma yta, vatten, eller i industrins processer Externa kostnader för värmeproduktionsteknologier Utifrån den metod och de kategorier av miljöpåverkan som definierats ovan har Ecofys även genomfört en analys av externa kostnader för värmeproduktion. I analysen, där externa kostnader uppskattas för olika värmeproduktionsteknologier i Europa, kan tre teknologikategorier skiljas: industriell värmeproduktion, värmeproduktion i kraftvärmeverk och värmeteknologier för lokalt småskaligt bruk. Resultaten visar att externa kostnader är högst för industriella processer där en blandning av bränslen, bland annat kol, används. Det som avses här är den värme som industrierna själva producerar från olika bränslen de köper in och som används direkt i deras processer, exempelvis för smältning. Denna följs av värmeproduktion från fossila bränslen, det vill säga värmeproduktion i kraftvärmeverk som drivs med stenkol och värmeproduktion från gasanläggningar. Externa kostnader är lägst för värmeproduktion i kraftvärmeverk som drivs med biobränslen Elintensiv betalar dessutom inte elcertifikat i sina tillverkande processer. 48 Naturvårdsverket: Översiktligt om kväveoxidavgiften, hämtat från den 8 december Begreppet biobränslen innefattar inte energigrödor utan enbart biomassa från biprodukt- och avfallsflöden. 19 december

49 En betydande del av de externa kostnaderna förknippade med solvärme eller värmepumpar kommer av dess uppströmsprocesser, även om elanvändningen är också av betydelse. Liksom för elproduktionen är kostnadskategorierna för klimatförändringen, utarmningen av energiresurser, partikelbildning och toxicitet för människor de kategorierna med högst externa kostnader (se Figur 5 nedan). Att elproduktionen i kraftvärmeverk ofta ersätter koleldad kondenskraft skulle möjligtvis kunna betraktas som en positiv extern effekt, denna är dock inte medräknad i bilden. Figur 5: Externa kostnader per produktionsteknologi för värme [EUR 2012 /MWh th ] Källa: Ecofys, EU kommission, Externa kostnader från värmeproduktion i Sverige Analysen för externa kostnader har även genomförts för alla medlemsländer i EU. Uppskattningarna utgår ifrån sammansättningen av produktionsteknologier i varje land med hänsyn till de lokala förutsättningarna. Den externa kostnaden för Sverige är uppskattad till 15,4 EUR 2012 /MWh th, vilket motsvarar cirka 140 Kr/MWh e 50. Dessa externa kostnader är låga i europeisk jämförelse där det genomsnittliga värdet är 19,5 EUR 2012 /MWh th och enbart för tre länder redovisas lägre estimat än för Sverige, nämligen Lettland (12,8 EUR 2012 /MWh th ), Danmark (13,8 EUR 2012 /MWh th ) och Lithauen (14,3 EUR 2012 /MWh th ) 51. Den totala externa kostnaden för Sverige summan av de olika kostnadskategorierna enligt uppskattningsmetoden som presenterats ovan. Den totala årliga externa kostnaden är uppskattat till 1,1 miljard EUR, vilket motsvarar 10 miljarder kr. De fyra största kategorierna är samma som för elproduktion och täcker tillsammans 95 procent av de totala externa kostnaderna, dock är den inbördes ordningen något annorlunda än för elproduktionen. 50 Med valutakurs 9,1 SEK/EUR. 51 I alla dessa länder produceras stor del av värmen med hjälp av gas. 19 december

50 I värmeproduktion är klimatförändringen den största kategorin med 47,3 procent, följt av partikelbildning med en 19,1 procent och utarmningen av energiresurser och toxicitet för människor, vardera med 14,5 procent av totalen (se Figur 6 nedan). Figur 6: De viktigaste kategorier av externa kostnader i värmeproduktion i Sverige 4,5% 14,5% 19,1% Utarmningen av energiresurser Klimatförändringen Toxicitet för människor 14,5% Partikelbildning 47,3% Övriga kategorier Källa: Ecofys, EU kommission, Internalisering av externa kostnader för värmeproduktionen De viktigaste styrmedlen riktade till internalisering av externa kostnader relaterade till värmeproduktion är skatter. Det betalas ett antal punktskatter för den fossila bränsleanvändningen till värmeprocesser inom industrin, det vill säga det fossila bränsle som industrin köper in för att göra värme att använda i egna processer 52. Dessa skatter är energiskatt, koldioxidskatt och svavelskatt. Utifrån SCB:s statistik för inbetalda skatter har Sweco kunnat uppskatta andelen miljöskatter som kan allokeras till värmeprocesser. Statistiken är från , men anses trots detta fungera som indata till Swecos beräkningar av internaliseringsgraden. Energiskatten för uppvärmningsbränslen baseras på energiinnehållet. Energiskatten för naturgas, kol och eldningsolja är 8,2 öre/kwh, energiskatten på bensin (miljöklass1) 34,6 öre/kwh och energiskatten på diesel (miljöklass 1) 17,7 öre/kwh. Framställning av skattepliktig el är helt undantagen från energibeskattningen och industrin, kraftvärmeproduktion och andra sektorer som omfattas av handeln med utsläppsrätter betalar endast 30 procent av den generella energiskattenivån för sina bränslen. År 2012 betalades miljoner kronor in till staten i form av energiskatt, varav 242 miljoner kronor av el-, gas- och värmeverk. Uppskattningsvis ytterligare 1,2 miljarder av de energiskatter på bränslen som inbetalats av övriga näringsgrenar, framför allt industrier, kan allokeras till värmeproduktionen (en annan stor del är transportsektorn). 52 En del av industrins värmeproduktion säljs som överskottsvärme till andra aktörer, exempelvis fjärrvärmeföretag. 53 Statistiska centralbyrån: Branschdata År, hämtat från den 28 november december

51 För hushållen är motsvarande siffra, det vill säga den energiskatt som betalats för att producera värme lokalt i huset (med gas, olja eller andra petroleumprodukter), 970 miljoner kronor. Koldioxidskatten tas ut med ett skattebelopp per vikt- eller volymenhet bränsle, som har beräknats utifrån bränslets innehåll av fossilt kol. Koldioxidskatten är idag 110 öre/kg CO 2 (108 öre/kg CO 2 referensåret 2012). Biobränslen anses koldioxidneutrala i ett livscykelperspektiv och är därmed undantagna i beskattningen. Även torv undantas i och med att bränslet inte omfattas av EUs energiskattedirektiv. Fram till 2015 gäller vissa koldioxidskattelättnader för naturgas och gasol som används i motordrivna fordon, fartyg och luftfartyg. Från 1 januari 2015 kommer dock samma principiella utgångspunkt gälla för samtliga fossila bränslen. Det finns också verksamheter som är undantagna från koldioxidbeskattningen. Framställning av skattepliktig el är en sådan verksamhet och sedan 2013 är även kraftvärmeproduktion som omfattas av EU:s handelssystem undantagen från koldioxidbeskattningen. Samma regler gäller för industrier som omfattas av handelssystemet som för värmeproduktion som används vid industriell tillverkning inom handelssystemet. För bränslen som förbrukas i värmeverk som ingår i handelssystemet är koldioxidskattenivån 80 procent av den generella koldioxidskattenivån. År 2012 betalades miljoner kronor in till staten i form av koldioxidskatt, varav 815 miljoner kronor av el-, gas- och värmeverk. Uppskattningsvis ytterligare 2,4 miljarder av de koldioxidskatter som inbetalats av övriga näringsgrenar kan allokeras till värmeproduktionen. För hushållen är motsvarande siffra 890 miljoner kronor. Det tredje styrmedlet är svavelskatten. Vid förbränning av fasta fossila bränslen och torv är skatten 30 kr/kg svavel vid utsläpp av svaveldioxid. För flytande bränslen är skatten 27 kr/m 3 för varje tiondels viktprocent svavel i bränslet. Skatt tas inte ut om svavelhalten är 0,05procent eller lägre. År 2012 betalades 30 miljoner kronor in till staten i form av svavelskatt, varav 21 miljoner kronor av el-, gas- och värmeverk. Uppskattningsvis ytterligare 7 miljoner av de svavelskatter som inbetalats av övriga industrier kan allokeras till värmeproduktionen. Sammanfattningsvis betalas miljoner kronor i miljöskatter av el-, gas- och värmeverk. Utöver dessa skatter betalas uppskattningsvis 3,6 miljarder kronor i miljöskatter av övriga näringsgrenar för deras värmeprocesser 1,86 miljarder kronor av hushållen. Detta innefattar skatter för de bränslen som används för att lokalt tillverka uppvärmning (exempelvis olja till en oljepanna som värmer ett hus), samt de bränslen som används för att göra värme till processer (exempelvis smältprocesser i en industri). Totalt sett innebär detta att miljöskatterna för värmeproduktionen uppskattas till cirka6,5 miljarder kronor, vilket indikerar en internaliseringsgrad på 65 procent av den totala årliga externa kostnaden enligt Ecofys. I och med undantagsfallen i beskattningen, framför allt för kraftvärme och biobränslen, är det ett förväntat resultat att internaliseringsgraden i värmeproduktionen inte är fullständig. 19 december

52 4.4 Transportsektorn Både de externa kostnadernas storlek respektive internaliseringsgrad skiljer sig åt mellan transportslag och fordon Externa kostnader Trafikanalys sammanställer årligen uppskattningar av trafikens externa kostnader med syftet av att skapa förutsättningar för en diskussion om korrekt prissättning. Analysen är genomfört separat för persontrafik respektive godstrafik och för samtliga transportformer; vägtrafik, järnväg, sjöfart och luftfart. Marginalkostnaderna för trafikens externa effekter som skattats är kostnader för slitage och deformering av infrastruktur (drift, underhåll och reinvesteringar) 54, olyckskostnader (den del som inte drabbar trafikanten själv), utsläpp av koldioxid och klimateffekter, utsläpp av övriga luftföroreningar och deras hälso- och miljöeffekter samt buller och bullerstörningar. För många kategorier anges uppskattningen i form av ett intervall eftersom utfallet inom varje kategori beror på bland annat geografi, (tätort/landsbygd), tid (dag/natt, sommar/vinter) och fordonstyp (teknik/årsmodell). Här presenteras de genomsnittliga värdena (för samtliga resultat se bilaga 3). Trafikanalys noterar också att beräkningarna för sjöfart och luftfart anses något mer osäkra än beräkningarna för väg och järnväg Externa kostnader för persontrafik Persontrafiken uppdelas mellan trafikarbetet som görs av bensin- och dieseldrivna personbilar, dieseldrivna bussar, tåg, färjor och flyg. I och med att trängseln är ett lokalt problem har den exkluderats från den kvantitativa analysen. Enheten som använts vid kvantifieringen av externa kostnader för persontrafik är kronor per personkilometer. De externa kostnaderna är högst för flygtrafik, där koldioxidutsläppen representerar 60 procent av de totala externa kostnaderna. Färjetrafiken har näst högst externa kostnader, dessa orsakas nästan i sin helhet av utsläppen av koldioxid och övriga emissioner. Vägtransporter har något lägre externa kostnader. För bensin- och dieseldrivna personbilar är kostnaderna högst för koldioxidutsläpp följt av olyckor. Busstrafik har näst lägst externa kostnader, och liksom som för personbilar är koldioxidutsläpp och olyckor de största externa kostnaderna för bussar. Externa kostnaderna är lägst för tågtrafik, enbart en femtedel i jämförelse med personbilar och en tiondedel i jämförelse med flygtrafik. Se Figur Det är tveksamt om slitage och deformering av infrastruktur (exempelvis vägar) är en renodlad extern effekt. Dock är det något som vägtrafiken bör vara med och finansiera. Då denna innefattades i Trafikanalys uppskattning av trafikens externa kostnader tas den med även i denna studie. 19 december

53 Figur 7: Externa kostnader för persontrafik [kronor per personkm] 0,7 0,6 0,5 0,4 0,3 0,2 0,1 0 Pb bensin Pb diesel Buss diesel Persontåg Färjetrafik Flygtrafik Infrastruktur Olyckor Koldioxid Övriga emissioner Buller Källa: Trafikanalys, Externa kostnader för godstrafik Godstrafiken är uppdelad i transportarbete med dieseldrivna lätta lastbilar, tunga lastbilar utan och med släp, godståg och sjöfart. Även här har trängseln exkluderats från den kvantitativa analysen. Enheten som använts vid kvantifieringen av externa kostnader för godstrafik är kronor per tonkilometer. Trafikanalys uppskattningar visar att de externa kostnaderna är allra högst för tunga lastbilar utan släp. Buller är den största kostnadskategorin (65 procent) följt av utsläppen (23 procent). De externa kostnaderna är näst högst för dieseldrivna lätta lastbilar, dock 40 procent lägre än för tunga lastbilar utan släp. För lätta lastbilar är utsläppen av koldioxid och övriga emissioner de viktigaste kostnadskategorierna, tillsammans står de för 63 procent av den totala kostnadsmassan. Av vägtransporter för gods är externa kostnader lägst för tunga lastbilar med släp och liksom för tunga lastbilar utan släp domineras de externa kostnaderna av buller (53 procent) och utsläpp (33 procent). Sjöfart och godståg har de lägsta externa kostnaderna. Godstågs externa kostnader är enbart en tjugondedel av kostnaderna för tunga lastbilar utan släp, se Figur december

54 Kr/tonkm Kvantitativ utvärdering av marknadsmisslyckanden och Figur 8: Externa kostnader för godstransporter 1,4 1,2 1 0,8 0,6 0,4 0,2 0 Lätt lastbil, diesel Tung lastbil utan släp Tung lastbil med släp Godståg Sjöfart Källa: Trafikanalys, 2014 Infrastruktur Olyckor Koldioxid Övriga emissioner Buller Internalisering av externa kostnader för persontrafik Trafikanalys har valt att uppskatta internaliseringsgraden utifrån de skatter, avgifter etcetera som har en påverkan på marginalkostnaden för transportarbetet. Detta betyder att enbart de rörliga skatterna och avgifterna är inkluderade vid uppskattning av internaliseringsgraden. I Tabell 4 nedan sammanfattas de skatter och avgifter som internaliseringsgraden innefattar för respektive transportslag. I och med att uppskattningarna för externa kostnader är uttryckta i intervall resulterar detta i att även internaliseringsgraden blir ett intervall. Här presenteras de genomsnittliga värden (för samtliga resultat se bilaga 3). Tabell 4: Skatter och avgifter som kvantifieringen av internaliseringsgraden omfattar Trafikslag Vägtrafik Järnväg Sjöfart Luftfart Källa: Trafikanalys, 2014 Skatter och avgifter Drivmedelskatt (energiskatt, CO 2 -skatt) Spåravgift, särskild avgift för persontrafik, driftsavgift, olycksavgift, emissionsavgift, tåglägesavgift, passageavgift Farledsavgift, lotsavgift Startavgift, passageraravgift, Terminal Navigation Charge, undervägsavgift, avgasavgift, bulleravgift 19 december

55 kr/personkm Internaliseringsgrad Kvantitativ utvärdering av marknadsmisslyckanden och Kalkylen visar att det finns stora skillnader i internaliseringsgrader mellan de olika trafikslagen i persontrafik (36,5 procent-106,5 procent). Internaliseringsgraden är allra högst för flygtrafik följt av tågtrafik, bensindrivna personbilar och färjetrafik. Internaliseringsgraderna är lägst för dieseldrivna fordon, både personbilar och bussar, se Tabell 5 och Figur 9. Trafikanalys känslighetsanalys där jämförelsen är gjort mellan landsbygd och tätort visar att de externa kostnaderna är lägre för landsbygd än för tätort, eftersom fler personer i tätort påverkas av externaliteter som buller och luftföroreningar. Tabell 5: Internaliseringsgrader för olika kategorier av persontrafik Kategori av persontrafik Internaliseringsgrad Personbil, bensindriven 88 % Personbil, dieseldriven 63 % Buss, dieseldriven 36 % Persontåg % Färjetrafik 70 % Flygtrafik 106 % Källa: Trafikanalys, 2014 Det ska dock noteras att fordonskatten för dieseldrivna bilar är inte inkluderat i analysen på grund av att skatten är fast, inte rörlig. Därmed kan det anses syftesenligt att sänka denna skatt och öka energiskatten på diesel för att skapa en beskattning likformig med bensindrivna bilar. Figur 9: Externa kostnader och internaliseringsgrad för persontrafik Pb bensin Pb diesel Buss diesel Persontåg Färjetrafik Flygtrafik 120% 100% 80% 60% 40% 20% 0% Totala externa kostnader Internaliseringsgraden Källa: Trafikanalys, 2014: Transportsektorns samhällsekonomiska kostnader, rapport 2014:4 55 Att internaliseringsgraden är högre för persontåg än för godståg beror dels på de externa kostnaderna: olycksrisk och buller är lägre för persontåg än för godståg. Det beror även på att det tas ut en särskild olycksavgift för persontrafik, samt att persontrafik även har högre tåglägesavgift. 19 december

56 kr/tonkm Internaliseringsgrad Kvantitativ utvärdering av marknadsmisslyckanden och Internalisering av externa kostnader för godstrafik Skillnaderna i internaliseringsgraderna mellan de olika trafikslagen är stora även för godstrafik (30 procent-74 procent), se Tabell 6. Internaliseringsgraden är allra högst för dieseldrivna lätta lastbilar följt av sjöfart och tunga lastbilar med släp. Internaliseringsgraderna är lägst för tunga lastbilar utan släp och för tågtrafik. Tabell 6: Internaliseringsgrader för olika kategorier av godstrafik Kategori av godstrafik Internaliseringsgrad Lätt lastbil, dieseldriven 74 % Tung lastbil utan släp 36 % Tung lastbil med släp 44 % Godståg % Sjöfart 48 % Källa: Trafikanalys, 2014 Det kan noteras att internaliseringsgraderna är lägre för godstrafik än för persontrafik och överstiger inte 100 procent för något av trafikslagen, se Figur 10. Trafikanalys påpekar också i sin rapport att internaliseringsgraderna för transporter är låga i Sverige även i en europeisk jämförelse. I och med att tunga lastbilar utan släp har de högsta externa kostnaderna och näst lägsta internaliseringsgrad, är det denna kategori av godstrafik som sticker ut i analysen. Likheten med slutsatserna från persontrafiken är att även tunga lastbilar är dieseldrivna. En högre internalisering och därmed en högre marginalkostnad för tunga transporter skulle dock kunna ha en påverkan på industrins konkurrenskraft, i de fall den inte internaliseras i andra länder. Figur 10: Externa kostnader och internaliseringsgrad för godstrafik Lätt lastbil, diesel Tung lastbil utan släp Tung lastbil med släp Godståg Sjöfart 80% 70% 60% 50% 40% 30% 20% 10% 0% Externa kostnader Internaliseringsgraden Källa: Trafikanalys, Att internaliseringsgraden är högre för persontåg än för godståg beror dels på de externa kostnaderna: olycksrisk och buller är lägre för persontåg än för godståg. Det beror även på att det tas ut en särskild olycksavgift för persontrafik, samt att persontrafik även har högre tåglägesavgift. 19 december

57 5 Beskrivning av sektorerna och deras potential I detta kapitel beskrivs de definitioner och antaganden som gjorts kring begreppet energieffektivisering. Syftet med rapporten är att ta fram relativa kvantifieringar för att kunna jämföra hindrens betydelse mellan olika sektorer, snarare än att ta fram noggranna beräkningar. Ett antal antaganden har gjorts med detta som bakgrund. Detta medför visst utrymme för osäkerhet och kanske särskilt i de antaganden som gäller framtida utveckling i respektive sektor. Utifrån studiens syfte utgör de värden som räknats fram ett jämförande underlag för analys av styrmedelsportföljen för energieffektivisering eftersom storleksordningen på respektive tal bedöms vara inom rimlig härad. Efter kapitlet om definitioner och antaganden följer en introduktion och potentialbedömning för respektive av de sju sektorer som rapporten fördjupar sig i. De sju sektorer som denna rapport fokuserar på står för cirka 88 procent av landets totala slutanvändning av energi. 5.1 Energieffektivisering definitioner och antaganden i denna rapport Målet för energieffektivisering i Sverige är att energiintensiteten, det vill säga förhållandet mellan den totala energiförbrukningen och BNP, ska minska med 20 procent mellan 2008 och I målet avses den totala energianvändningen, vilket tolkats som total tillförd energi enligt officiell statistik. I de sektorsvisa bedömningarna beaktas även nyckeltal som är relevanta inom sektorn, det vill säga den nytta som fås av energianvändningen, i stället för energiintensitet i relation till BNP. En uppräkning till absolut energianvändning görs sedan för att kunna jämföra energipotentialernas storlek mellan sektorer. Nyckeltal som används redovisas i Tabell 7. Tabell 7: Definitioner av energieffektivitet som används i Sveriges målformulering respektive i denna rapport Sveriges mål Total energianvändning i Sverige Energianvändning i relation till BNP (energiintensitet = MWh per krona) Källa: Sweco, 2014 Rapporten Slutanvändning av energi Energianvändning i relation till nytta i respektive sektor: Persontransporter MWh per personkilometer Godstransporter MWh per tonkilometer Uppvärmning inom bostäder och servicesektorn MWh per kvadratmeter Industrin MWh per förädlingsvärde i kronor Med utgångspunkt från dagens energianvändning görs en framskrivning till år 2030 för respektive sektor. Beroende på förväntad utveckling av mängden nytta, till exempel antal kvadratmeter inom bebyggelsen och antal personkilometrar inom persontransporter, räknas en framtida energianvändning fram. 19 december

58 Energianvändning, MWh Kvantitativ utvärdering av marknadsmisslyckanden och Utgångspunkten i denna beräkning är att energiintensiteten är densamma som idag, det vill säga ingen ytterligare effektivisering sker. Detta scenario benämns här som worst case, se Figur 12. Ingenjörspotentialen år 2030 antas ha samma proportion gentemot energianvändning som den har idag. Detta illustreras i Figur 11 nedan. Den senaste heltäckande potentialbedömningen för samtliga sektorer gjordes 2008 inom utredningen Vägen till ett energieffektivare Sverige, där horisonten var år Trots detta, antas i denna studie att potential från idag till år 2030 är ungefär lika stor i procent räknat. Grunden till antagandet är dels att inte all potential har realiserats ännu i alla sektorer och dels att det har skett och sker en teknisk utveckling som ökar potentialen. Figur 11: Schematisk bild över energianvändningen och ingenjörspotentialen år 2014 respektive 2030 Ingenjörspotential 2014 Ingenjörspotential 2030 Källa: Sweco SOU 2008:110: Vägen till ett energieffektivare Sverige, december

59 Energianvändning, TWh Kvantitativ utvärdering av marknadsmisslyckanden och Spontan energieffektivisering En viss utveckling av energieffektiviteten sker till följd av pågående processer. Det handlar till exempel om pågående aktivt tekniskt utvecklingsarbete av energianvändande utrustning, pågående implementering av energiledningssystem eller annat strategiskt energiuppföljningsarbete och kontinuerlig effektivisering som sker passivt när gammal utrustning byts mot ny effektivare utrustning. Det handlar även om fortsatt verkan av befintliga styrmedel, till exempel gällande byggnormer. Denna trend definieras i denna rapport som business-as-usual, BAU, och illustreras i Figur 12. I textrutan som följer direkt efter figuren förklaras/definieras begreppen. Figur 12: Schematisk beskrivning av definitioner som används i denna rapport BAU Spontan Hindrad Ingenjörspotential 2030 Rekyl Källa: Sweco, efter rekyleffekt 19 december

60 Worst case : Ingen ytterligare energieffektivisering sker från idag till år BAU - Business as usual: Befintliga styrmedel finns kvar och fortsätter att ha samma effekt som idag. Branschinitiativ och annat redan pågående energieffektiviseringsarbete fortsätter i befintlig takt. Ingenjörspotential: Tekniskt möjliga energieffektiviseringsåtgärder som har ett positivt ekonomiskt nuvärde med en given kalkylränta. Både rena investeringar och förbättrad förvaltning, till exempel effektiv drift av fastigheter, logistikplanering för godstransporter etcetera. Spontan energieffektivisering: Den energieffektivisering som sker inom BAU (befintliga styrmedel, branschinitiativ etcetera). De spontana aktiviteterna realiserar den upplevda företagsekonomiskt lönsamma potentialen. Inga tillkommande statliga interventioner. Hindrad energieffektivisering: Marknadsmisslyckanden och andra står i vägen för full realisering av ingenjörspotentialen. Rekyleffekt: Att energieffektivisering föder ny energiefterfrågan som motverkar effektiviseringens energibesparande potential kallas för rekyleffekten. Baserat på historiska trender för energieffektivitet har en uppskattning av storleken på framtida spontan energieffektivisering gjorts för respektive sektor, med tillhörande bedömning av hur den absoluta energianvändningen kommer att påverkas av denna. Detta beskrivs i respektive sektors delkapitel, se avsnitt För de flesta sektorer går trenden mot ökad energieffektivitet, mätt i energianvändning per mängd nytta, det vill säga per kvadratmeter för bostäder och service, per förädlingsvärde för industrin och per ton-kilometer och person-kilometer för transportsektorn. Den absoluta energianvändningen ökar dock totalt sett. I sektorn bostäder ses en svag nedgång i absolut energianvändning, trots att den delen av bebyggelsen har ökat. Men för industrisektorn går den absoluta energianvändningen upp något och i transportsektorn sker en kraftig ökning Rekyleffekten Att energieffektivisering föder ny energiefterfrågan som motverkar effektiviseringens energibesparande potential kallas för rekyleffekten ( the rebound effect ). I stort sett handlar rekyleffekten om att det ekonomiska överskott som skapas av ökad energieffektivitet kommer att användas till något annat och att detta andra ofta också har en energianvändning. Rekyleffekten är en dynamisk effekt som verkar under lång tid. Detta bidrar till att det är svårt att mäta den. Att den är svårmätt betyder dock inte att den är mindre viktig och det finns ett antal studier som har gjort skattningar av rekyleffektens storlek. 19 december

61 Rekyleffekten är per definition mätt i absolut energianvändning, inte i energianvändning per nytta. Därför har den mindre betydelse för Sveriges nationella mål som är definierat som energianvändning per BNP, särskilt som den är störst i en av de sektorer som har störst inverkan på BNP, nämligen energiintensiv industri. Nedan följer dock en bedömning av ungefärlig rekyleffekt i respektive sektor som ingår i den här rapporten. Rekyleffekten delas in i direkt och indirekt rekyleffekt. Den direkta rekyleffekten relaterar till att nyttan som energi skapar kan vara oförändrad trots att energianvändningen minskar, här benämnt som värdeskapande energianvändning. Mekanismerna bakom den direkta rekyleffekten är i huvudsak: 1. Att energieffektivisering medför lägre energianvändning och såldes lägre kostnader för samma nytta och därför förväntas hushåll och företag öka konsumtionen av värdeskapande energianvändning på bekostnad av andra varor och tjänster, som blivit relativt dyrare (substitutionseffekt till följd av förändrade relativpriser). 2. Hushålls och företags köpkraft ökar när en värdeskapande energianvändning använder mindre energi för samma nytta och såldes blir billigare, det vill säga realinkomsten stiger (inkomsteffekt). Den indirekta rekyleffekten reflekterar hur inkomst- och substitutionseffekter påverkar konsumtionen av andra varor och tjänster som producerats med energi som insats, samt energieffektiviseringens effekter på konkurrenskraft (i de fall andra länders transportsektor inte internaliserat de externa effekterna), investeringar och branschstruktur. Summan av den direkta och indirekta rekyleffekten brukar benämnas den ekonomiövergripande rekyleffekten. Broberg 58 har sammanställt de uppskattningar av denna som har gjorts internationellt, se även Tabell 8. Uppskattningarna av den direkta rekyleffekten ligger för transportsektorn i intervallet procent. För uppvärmning av bostäder visar skattningarna en rekyleffekt i intervallet 0 65 procent. Variationen beror delvis på hur rekyleffekten har skattats, men också på vilket land som har studerats. Sverige förväntas enligt Broberg ligga i den lägre delen av intervallet för båda dessa sektorer. Motiveringen är att Sverige är ett relativt rikt land med hög värmekomfort och hög alternativkostnad för användningen av tid, vilket håller tillbaka energieffektiviseringens inverkan på inomhustemperaturen och bilåkandet. Den sektor där rekyleffekten är störst är energiintensiv industri; rekyleffekten kan vara över 100 procent 59. I och med att energieffektivisering sänker kostnaderna för den industriella produktionen, förbättras industrins konkurrensförmåga och produktionen kan ökas. Produktionsökningen ger i sin tur upphov till ökad energianvändning. Rekyleffekten förväntas dock vara betydligt mindre för effektivisering av stödfunktioner som inte är centrala i produktionsprocessen såsom belysning och uppvärmning eller ventilation av byggnader. 58 Broberg, Konjunkturinstitutet, Rekyleffekten - Är energieffektivisering effektiv miljöpolitik eller långdistans i ett ekorrhjul? Broberg, Konjunkturinstitutet, Rekyleffekten - Är energieffektivisering effektiv miljöpolitik eller långdistans i ett ekorrhjul? december

62 Generellt begränsas den direkta rekyleffekten av höga inkomstnivåer eftersom en mättnad på marknaden kan antas finnas. Detta gäller till exempel uppvärmning av hus eftersom effektivare uppvärmning inte nödvändigtvis gör att man vill ha varmare än man redan har det; det finns en optimal temperatur. Däremot kan en viss rekyleffekt ses om sänkta värmekostnader gör att man väljer att värma upp en större yta. Den indirekta effekten är dock sannolikt större, det vill säga att de pengar som kan sparas när uppvärmningen blir billigare kommer konsumeras på andra varor. Även privatbilism har karaktären att det finns en begränsning i hur stor den direkta rekyleffekten kan bli eftersom bilkörning är tidskrävande och därför inte kommer öka mer än måttligt även om kostnaden per mil sänks. 60 Om energieffektiviseringsåtgärderna redan från början är kostsamma mildras rekyleffekten. 61 Annars kan åtgärder som stimulerar energieffektivisering behöva kompletteras med ekonomiska styrmedel som håller uppe energikostnaderna om man önskar motverka rekyleffekten. En möjlig utvecklingsinriktning är även att konsumtionen blir mer frikopplad från energianvändning, vilket innebär att de pengar som frigörs vid energieffektivisering i högre grad används till konsumtion som inte direkt ger upphov till energianvändning. Detta ingår i konceptet cirkulär ekonomi, som omfattar att återvinnings- och återanvändningsgraden är mycket hög och ekonomisk tillväxt frikopplas från resursutnyttjande. EU-kommissionen har lagt förslag på hur EU ska kunna röra sig i denna riktning Rekyleffekterna inom transportsektorn beskrivs närmre av VTI, Statens väg- och transportforskningsinstitut. Jägerbrand et al, VTI rapport 827A: Rebound Effects of Energy Efficiency Measures in the Transport Sector in Sweden, Broberg, Konjunkturinstitutet, Rekyleffekten - Är energieffektivisering effektiv miljöpolitik eller långdistans i ett ekorrhjul? Europeiska kommissionen: The circular economy package, hämtat från den 3 december december

63 Tabell 8: Sektorsvis beskrivning av rekyleffektens yttring samt bedömning av effektens storlek Småhus Energi intensiv industri Övrig tillverkande industri Sektor Beskrivning av rekyleffektens yttring i sektorn Rekyleffekt Direkt effekt: Nära noll för Flerbostadshus en stor del av energianvändningen. 63 fastighetsel och hushållsel. uppvärmning. Uppskattning Samma resonemang som för småhus går att tillämpa eftersom uppvärmning utgör saknas för effektivisering av Indirekt effekt: Uppskattning saknas Kontorslokaler Persontransporter Godstransporter Den direkta rekyleffekten av effektivare uppvärmning är liten på grund av att ett lagom uppvärmt hus inte får ökad komfort av mer uppvärmning. Däremot finns en indirekt rekyleffekt av att hushållens köpkraft ökar. Rekyleffekten av effektivare elanvändning kan dock bli något större. Till exempel kan mer energieffektivare belysning göra att belysningen är påslagen längre tid. I jämförelse med småhus och flerbostadshus har kontor en större andel elanvändning. Inom denna kan en större rekyleffekt väntas än för uppvärmning. Därför blir rekyleffekten för kontorslokaler något högre. Ökad energieffektivitet som har relativt stor inverkan på produktionskostnaden. Detta leder till konkurrensfördel och produktionen kan antas öka. Den ökade produktionen leder till en ökning i energianvändning i absoluta tal mätt. Ökad energieffektivitet ger relativt liten påverkan på produktionskostnaden. Jämfört med energiintensiv industri leder därför ökad energieffektivitet inte till någon stor konkurrensfördel och rekyleffekten bedöms därför vara relativt liten jämfört med energiintensiv industri. De pengar som sparas kommer dock användas till något annat, som kan antas delvis ha en energianvändning. Energieffektivisering inom persontransporter utgörs till största del av effektivisering av bilar och överflytt från bil till kollektiv transport. Den direkta rekyleffekten av effektivisering av bilar begränsas dock av sektorns karaktär att det tar tid att transportera sig även om transporten är billig och tid är en begränsad resurs. Det blir istället främst en indirekt rekyleffekt i och med att hushållens köpkraft ökar. Rekyleffekten av överflytt från bil till kollektiv transport kan anses begränsad eftersom transportkostnaden inte nödvändigtvis sänks av detta. Påverkan på bränslepriset av att efterfrågan på fordonsbränslen minskar bedöms även som liten. Effektivisering av lastbilar sänker transportkostnad för gods. Efterfrågan på transporter totalt sett kan dock antas påverkas relativt lite av detta. Däremot kan en överflytt från spår till väg ske som ger en stor rekyleffekt gällande energianvändningen. Källa: Sweco, 2014 Direkt effekt: Nära noll för uppvärmning. 64 Uppskattning saknas för effektivisering av hushållsel. Indirekt effekt: Uppskattning saknas Uppskattning saknas Direkt effekt: Nära noll för uppvärmning. 65 Uppskattning saknas för effektivisering av fastighetsel och verksamhetsel. Indirekt effekt: Uppskattning saknas Ekonomiövergripande: Nära eller över 100 procent. 66 Ekonomiövergripande: Uppskattningsvis 30 procent. Direkt effekt: procent 67 Indirekt effekt: Uppskattning saknas Direkt effekt: procent 68 Indirekt effekt: Uppskattning saknas 63 Broberg, Konjunkturinstitutet, Rekyleffekten - Är energieffektivisering effektiv miljöpolitik eller långdistans i ett ekorrhjul? Broberg, Konjunkturinstitutet, Rekyleffekten - Är energieffektivisering effektiv miljöpolitik eller långdistans i ett ekorrhjul? Broberg, Konjunkturinstitutet, Rekyleffekten - Är energieffektivisering effektiv miljöpolitik eller långdistans i ett ekorrhjul? Broberg, Konjunkturinstitutet, Rekyleffekten - Är energieffektivisering effektiv miljöpolitik eller långdistans i ett ekorrhjul? Jägerbrand et al, VTI rapport 827A: Rebound Effects of Energy Efficiency Measures in the Transport Sector in Sweden, Jägerbrand et al, VTI rapport 827A: Rebound Effects of Energy Efficiency Measures in the Transport Sector in Sweden, december

64 5.1.2 Potentialbedömning För bedömning av dagens energianvändning har främst statistik från SCB:s hemsida använts. För vissa sektorer har dock värdena varit osäkra och ibland har uppdelningen i sektorer skilt sig från den som används i rapporten. I dessa fall har komplettering med ytterligare källor och en slutlig avvägning har gjorts. Detta beskrivs under varje sektors delkapitel nedan. En osäkerhet finns i underlaget som beror på osäkerheten i SCB:s statistik och den slutliga avvägningen. Dessutom finns en inexakthet i att senaste befintliga data som är sammanställd är från olika år för olika sektorer. Bedömningen baseras på data för slutanvändning mellan 2008 och 2013 beroende på sektor. För de sektorer som motsvarar tiotals TWh i slutlig användning, har bedömningar gjorts av energieffektiviseringspotentialen genom att per sektor väga samman ett antal tillgängliga referenser. Som främsta utgångspunkt har Ett energieffektivare Sverige 69 och dess underlagsrapport 70 använts. Komplettering med senare studier och studier som går djupare in i delsektorer har även gjorts. Detta beskrivs under varje sektors delkapitel nedan. Sammanvägningen ger ett procentuellt spann för minsta till största möjliga potential från vilket ett viktat medelvärde har bedömts genom att ge mer tyngd till de mest tillämpliga siffrorna. Kalkylränta I underlagsrapporterna används kalkylräntor för aktörsperspektivet på cirka 4 procent för offentlig sektor och cirka 8 procent för privata företag och hushåll. I Ett energieffektivare Sverige 71 har en känslighetsanalys gjorts på några procentenheter runt angivna värden Ingenjörspotentialen per sektor Ingenjörspotentialen definieras i denna studie som summan av alla tekniskt möjliga energieffektiviseringsåtgärder med ett positivt ekonomiskt nuvärde med en given kalkylränta. Både rena investeringar och förbättrad förvaltning, till exempel effektiv drift av fastigheter, logistikplanering för godstransporter etcetera ingår. I Figur 13 visas den uppskattade ingenjörspotentialen för energieffektivisering per sektor. Den sektor som använder störst mängd energi i Sverige är den energiintensiva industrin. I den sektorn finns också den största energieffektiviseringspotentialen sett i absoluta tal, cirka 22 TWh. Därefter följer persontransporter och lokaler som de sektorer som har näst störst energieffektiviseringspotential, cirka TWh vardera. Även småhus, flerbostadshus och godstransporter har en stor potential, cirka 8 10 TWh vardera. Den summerade potentialen för de sju mest energianvändande sektorerna är cirka 79 TWh. Om även de resterande sektorerna räknas med blir potentialen cirka 82 TWh. Se även Tabell SOU 2008:25: Ett energieffektivare Sverige, SOU 2008:110: Vägen till ett energieffektivare Sverige 71 SOU 2008:25: Ett energieffektivare Sverige, december

65 Figur 13: Bedömd slutanvändning av energi år 2030 samt uppskattning av energieffektiviseringspotential (ingenjörspotential) till 2030 för de sju sektorerna med störst energianvändning Kontorslokaler Godstransporter (väg, spår) Övrig tillverkande industri Flerbostadshus Småhus (inkl fritidshus) Persontransporter (väg, spår) Energiintensiv industri Källa: Sweco, Bedömd energianvändning år 2030 Varav potential år 2030 TWh/år Tabell 9: Bedömd energianvändning, energieffektiviseringspotential och spontan energieffektivisering år 2030, TWh Bedömd energianvändning år 2030 Bedömd energi- effektiviserings- potential år 2030 Spontan energieffektivisering år 2030 Energiintensiv industri Persontransporter (väg, spår) Småhus (inkl fritidshus) Flerbostadshus ,5 Övrig tillverkande industri Godstransporter (väg, spår) Kontorslokaler 8,4 2 0,2 Källa: Sweco, december

66 Antal lägenheter Kvantitativ utvärdering av marknadsmisslyckanden och 5.2 Flerbostadshus Flerbostadshus i Sverige omfattade år 2012 en uppvärmd yta på 186 miljoner kvadratmeter. Antal bostäder i flerbostadshus är cirka 2,5 miljoner, varav cirka tre femtedelar är hyresrätter och två femtedelar är bostadsrätter. 72 En stor del av flerbostadshusen byggdes inom Miljonprogrammet år och står nu i stor utsträckning inför renovering. Nybyggnadstakten har varit relativt låg de senaste 20 åren, se Figur 14. Figur 14: Färdigställda lägenheter i nybyggda flerbostadshus, Källa: SCB, 2014 Ägarskapet i flerbostadshussektorn är fördelat över de 300 allmännyttiga kommunala bostadsföretagen som äger cirka lägenheter, de privata fastighetsägarna som äger omkring lägenheter och landets bostadsrättsföreningar som äger den resterande andelen, cirka lägenheter. I Figur 15 visas slutanvändningen av energi i flerbostadshussektorn. Slutanvändningen av energi i ett äldre flerbostadshus är till cirka tre fjärdedelar värme inklusive varmvatten. Resterande del är fastighetsel och hushållsel. I nyare flerbostadshus ser fördelningen annorlunda ut, särskilt är andelen energi som används till uppvärmning lägre. Fjärrvärme står för cirka 85 procent av energitillförseln i flerbostadshussektorn 73. Eldningsolja har nästan helt fasats ut. 72 Energimyndigheten: Energistatistik för flerbostadshus 2012, ES 2013:03, Energimyndigheten: Energistatistik för flerbostadshus 2012, ES 2013:03, december

67 MWh Kvantitativ utvärdering av marknadsmisslyckanden och Figur 15: Slutanvändning av energi i flerbostadshussektorn Diesel Eldningsolja 1 Eldningsolja>1 Fjärrvärme El Källa: SCB, Potentialen inom flerbostadshus Energieffektivisering i flerbostadshussektorn kan grovt delas in i två huvuddelar: rationell drift och förbättrat klimatskal. Den sistnämnda är mer kapitalintensiv medan den första mer är en fråga om mätning, uppföljning, styrning och organisation. Mätning och uppföljning är dock viktigt även i samband med klimatskalsförbättrande åtgärder för att det ska gå att utvärdera åtgärdens effekt och lära sig inför nästa åtgärd vad som fungerar bättre och sämre. I bedömningen av energianvändningen år 2030 har det antagits att flerbostadsbeståndet ökar med cirka 10 procent från idag. Detta är baserat på att ungefär samma byggnadstakt som har setts det senaste decenniet håller i sig. I Ett energieffektivare Sverige 74 bedöms energieffektiviseringspotentialen i sektorn vara knappt 30 procent. 75 Detta bedöms även vara ungefärlig storlek på ingenjörspotentialen från idag till 2030, bland annat eftersom en stor del av sektorns potential finns kvar att realisera när miljonprogrammet renoveras. I energimängd räknat blir detta cirka 11 TWh/år år I Figur 16 visas en schematisk illustration av ingenjörspotentialen inom flerbostadshussektorn. Den uppskattade spontana energieffektiviseringen visas också i figuren. Den antas ske till följd av befintliga styrmedel, till exempel Ekodesigndirektivet 76, som gör att de minst energieffektiva produkterna tas bort från marknaden. Kylar, frysar och diskmaskiner är exempel på produkter som omfattas och påverkar energianvändningen i 74 SOU 2008:25: Ett energieffektivare Sverige, SOU 2008:25: Ett energieffektivare Sverige, Europeiska unionen: Europaparlamentets och rådets direktiv Ekodesigndirektivet (2009/125/EG), hämtat från den 22 november december

68 Energianvändning, TWh Kvantitativ utvärdering av marknadsmisslyckanden och flerbostadshussektor i hög grad. Dessutom antas en viss energieffektivisering ske i samband med renovering av miljonprogrammet. I Vägen till ett energieffektivare Sverige bedömdes energieffektivisering som sker till följd av befintliga styrmedel vara cirka 7 procent av energianvändningen i bostadssektorn. 77 Sammanlagt bedöms den spontana energieffektiviseringen vara drygt 20 procent av energieffektiviserings-potentialen i sektorn år 2030, cirka 2,5 TWh/år. Figur 16: Schematisk illustration av ingenjörspotentialen i flerbostadshussektorn Spontan Hindrad Ingenjörspotential 2030 Källa: Sweco, SOU 2008:110 Vägen till ett energieffektivare Sverige, december

69 5.3 Kontorslokaler För lokalsektorn studeras endast delsektorn kontorslokaler närmre i denna studie. Delsektorn kontorslokaler i Sverige omfattar ungefär byggnader vilka till drygt 60 procent ägs av aktiebolag och cirka 20 procent av offentlig sektor. 78 Det finns till antalet flest större lokaler över m 2, och dessa motsvarar också knappt hälften av delsektorns totala byggnadsyta. Totalt omfattar kontorslokalerna en uppvärmd yta på drygt 30 miljoner kvadratmeter. 79 Kontorslokalers totala energianvändning uppgick under år 2012 till ungefär 7,6 TWh, varav 3,1 TWh gick till uppvärmning och varmvatten. 80 I jämförelse med flerbostadshussektorn är beståndet yngre (se Figur 17); byggandet kulminerade under 70- till 80-talen istället för 60- till 70-talen. Detta innebär att renoveringskulmen kan antas komma senare än för flerbostadshus och en i jämförelse lägre andel av kontoren kommer att renoveras före år Figur 17: Uppvärmd area för kontorslokaler år 2013, fördelad efter byggår, miljoner m Miljoner m Källa: Energimyndigheten, Ungefär 34 procent av den uppvärmda kontorslokalytan är byggd efter Detta år infördes en ny byggnorm som, genom bland annat skärpta krav på isolering, har gett ett trendbrott i energianvändning för uppvärmning. I Figur 18 visas energianvändningen för uppvärmning inom kontorslokaler fördelat på byggnadsår. Noterbart är att den specifika uppvärmningsenergin gick nedåt under 70-, 80- och 90-talen, men har vänt uppåt det senaste decenniet. I lokalsektorn som helhet har dock 78 Energimyndigheten: Energistatistik för lokaler 2013, Energimyndigheten: Energistatistik för lokaler 2013, Energimyndigheten: Energistatistik för lokaler 2013, december

70 trenden fortsatt nedåt. Även när det gäller den totala energianvändningen per kvadratmeter, inklusive el och fjärrkyla, ses en uppåtgående trend bland de kontorslokaler som byggts det senaste decenniet. 81 Med tanke på ökade krav på energieffektivitet i BBR, kan detta tyckas vara anmärkningsvärt. En förklaring kan finnas i de ökande komfortkrav från användarna, men även den arkitektoniska trenden med glasfasader för kontor som har betonats under perioden. Glasfasader utgör en energiteknisk utmaning både vad gäller komfortvärme och - kyla. Figur 18: Energianvändning för uppvärmning i kontorslokaler (exklusive fjärrkyla och el för komfortkyla) per kvadratmeter år 2013, fördelat per byggnadsår kwh/m Källa: Energimyndigheten, I Figur 19 visas den slutanvända energin i hela lokalsektorn fördelningen på energibärare. Fjärrvärme står för cirka 75 procent av slutanvändningen och el är den näst största energibäraren. 81 Energimyndigheten: Energistatistik för lokaler 2013, december

71 Figur 19: Slutanvändning av energi i hela lokalsektorn år 2013, totalt cirka 21 TWh Olja Fjärrvärme Fjärrkyla El Naturgas/stadsgas Flis/spån Pellets Ved Övrigt Källa: Energimyndigheten, Potentialen inom kontorslokaler Energieffektivisering för kontorslokaler kan liksom i flerbostadshussektorn grovt delas in i två huvuddelar: rationell drift och förbättrat klimatskal. Den sistnämnda är mer kapitalintensiv medan den första mer är en fråga om mätning, uppföljning, styrning och organisation. Mätning och uppföljning är dock viktigt även i samband med klimatskalsförbättrande åtgärder för att det ska gå att utvärdera åtgärdens effekt och lära sig inför nästa åtgärd vad som fungerar bättre och sämre. I bedömningen av energianvändningen år 2030 har det antagits att kontorslokalbeståndet ökar med cirka 10 procent från idag. Detta är baserat på att ungefär samma byggnadstakt som har setts det senaste decenniet håller i sig. Energieffektiviseringspotentialen gällande uppvärmning och tappvarmvatten bedömdes i Ett energieffektivare Sverige till cirka 50 procent. 83 Inom projektet STIL2, som syftade till fördjupad kunskap om energianvändningen i lokalsektorn, bedömdes elbesparingspotentialen till cirka 20 procent. 84 Både fastighetsel och verksamhetsel är medräknat i den sistnämnda. Uppräknat till år 2030 bedömda nivå blir summan av dessa besparingspotentialen drygt 2 TWh/år. I och med att det ses en minskad energieffektivitet i de byggnader som byggts det senaste decenniet, bedöms den spontana energieffektiviseringen till år 2030 vara mycket liten. Befintliga styrmedel tycks ha begränsad verkan i sektorn. En viss inverkan av befintliga 82 Energimyndigheten: Energistatistik för lokaler 2013, SOU 2008:110 Vägen till ett energieffektivare Sverige 84 Energimyndigheten: Förbättrad energistatistik för lokaler Stegvis STIL Rapport för år 1 Inventeringar av kontor och förvaltningsbyggnader, ER 2007:34, december

72 Energianvändning, TWh Kvantitativ utvärdering av marknadsmisslyckanden och styrmedel bedöms dock finnas genom Ekodesigndirektivet 85. Swecos bedömning är att cirka 10 procent av energieffektiviseringspotentialen, det vill säga cirka 0,2 TWh, kommer att realiseras spontant i sektorn, se Figur 20. Figur 20:Schematisk illustration av ingenjörspotentialen i kontorslokalsektorn Spontan 7,6 BAU Hindrad 8,4 Ingenjörspotential 2030 Källa: Sweco, Europeiska unionen: Europaparlamentets och rådets direktiv Ekodesigndirektivet (2009/125/EG), hämtat från den 22 november december

73 Antal småhus Kvantitativ utvärdering av marknadsmisslyckanden och 5.4 Småhus Småhussektorn i Sverige är mycket heterogen då den karakteriseras av ett mycket stort antal ägare med högst varierade förutsättningar, både kunskapsmässigt och ekonomiskt. Sektorn utgörs av alla en- och tvåfamiljshus för permanent boende villahus, parhus, radhus och kedjehus. Ibland redovisas denna sektor gemensamt med fritidshus, men i denna rapport är dessa exkluderade. Småhus i Sverige omfattar en yta på drygt 292 miljoner kvadratmeter. Antalet småhus är cirka 1,9 miljoner, och ägs nästan uteslutande av enskilda fysiska personer. Ungefär 7 procent av beståndet ägs av allmännyttan, kooperationer eller juridiska personer och upplåts som hyres- eller bostadsrätter. Ungefär 43 procent av antalet småhus är byggda före 1970, och ungefär 22 procent de senaste 20 åren. Emellan dessa perioder, var nybyggnadstakten något högre, se Figur 21. Figur 21: Kalkylerat småhusbestånd 2012 efter nybyggnadsår Källa: SCB, 2014 Småhusens totala energianvändning uppgick under år 2013 till ungefär 41 TWh, varav 32 TWh gick till uppvärmning och varmvatten och resterande 9 TWh var hushållsel, enligt Energimyndighetens senaste urvalsundersökning. 86 Den årliga totala energianvändningen för uppvärmning och varmvatten har varierat mycket lite sedan Ett antal nya småhus har tillkommit, medan den genomsnittliga användningen för uppvärmning och varmvatten per kvadratmeter sjunkit något och nu ligger på ungefär 110 kwh/m2. Förändringen i genomsnittlig användning förklaras i huvudsak av variationer i klimatet från år till år samt förändrad insamlingsmetod för data. Men även det ökade antalet installerade 86 Energimyndigheten, Energistatistik för småhus 2013, ES 2014:05 19 december

74 TWh Kvantitativ utvärdering av marknadsmisslyckanden och värmepumpar inverkar genom en minskad användning av köpt energi. Detta är en energieffektivisering i samhällsekonomisk mening eftersom resterande värmemängd tas upp gratis ur omgivningen.87 Vid utvärdering och jämförelser av andra energieffektiviserande åtgärder mellan småhus med olika uppvärmningssätt, kan dock det faktiskt uppvärmningsbehovet behöva beaktas. För ett genomsnittligt småhus motsvarar 110 kwh/m 2 cirka 17 MWh per år. Äldre småhus byggda fram till 1960 har dock en genomsnittlig användning uppåt 20 MWh per år, medan de nyare husen ligger under 15 MWh per år. Den genomsnittliga användningen av hushållsel i småhus har ökat med över 58 procent sedan år 1970, men ungefär hälften av denna ökning bedöms komma från el för uppvärmning och ventilation. 88 Energiförsörjning till uppvärmning och varmvatten i småhus kommer i huvudsak från el med drygt 14 TWh och biobränsle med 11 TWh, motsvarande 45 procent respektive 34 procent av den totala försörjningen. Fjärrvärme är mindre vanligt än för flerbostadshus, men ändå betydande med knappt 6 TWh respektive 17 procent, se Figur 22. Figur 22: Slutanvändning av energi i småhussektorn Källa: SCB, 2014 diesel eldningsolja 1 eldningsolja>1 träbränsle fjärrvärme el Potentialen inom småhus Åtgärder för energieffektivisering i småhussektorn faller under två kategorier: beteende och förbättrat klimatskal. Dessutom kan även byte av energiförsörjning till uppvärmning och system för uppvärmning bidra till energieffektivisering. Direktverkande eller vattenburen eluppvärmning är det vanligaste uppvärmningssättet i svenska småhus, vilket fortfarande 87 Notera dock att beroende på om värmepumpen är installerad i fastigheten eller i ett fjärrvärmesystem blir effekten på inköpt energi mycket olika. 88 Energimyndigheten: Energistatistik för småhus 2013, ES 2014:05, december

75 TWh Kvantitativ utvärdering av marknadsmisslyckanden och utgör en betydande potential i form av minskad energiförsörjning vid byte till värmepump, se även Figur 23. Småhusen har också möjligheter till mer energilagring för att minska användning av elpatroner vid hög last för nuvarande och tillkommande värmepumpar. Solfångare, främst för varmvatten, bedöms också ha en viss framtida potential, men är än så länge relativt få till antalet. På hushållselssidan finns potential i form av effektivare apparater och solceller för elproduktion. Figur 23: Slutanvändning av energi för uppvärmning i småhussektorn Närvärme Naturgas/stadsgas Olja Fjärrvärme Biobränsle El Källa: Energimyndigheten, Förbättring av småhusens klimatskal utgör en betydande potential, i synnerhet för äldre hus där den genomsnittliga energianvändningen för uppvärmningen är väsentligt högre än för nyare hus. Dessa åtgärder är mer kapitalintensiva och energikostnaden utgör idag en förhållandevis låg andel av småhushållens boendekostnader. Det är därför även inom denna sektor viktigt med bra mätning och uppföljning för att kunna utvärdera nuläget och effekter av klimatskalsförbättrande åtgärder. Småhusbeståndets totala energianvändning har i denna bedömning antagits öka 10 procent från år 2012, vilket är i linje med de bedömningar som gjorts i de tidigare studier som använts i denna analys. 90 Potentialens storlek bedöms vara i princip oförändrad beroende på ytterligare teknikutveckling samt att många åtgärder kvarstår att göra. Den samlade bedömningen i denna utredning är att det finns en ingenjörspotential på ungefär 11 TWh motsvarande 25 procent av den totala energianvändningen på 44 TWh vid Detta är illustrerat i Figur Energimyndigheten: Energistatistik för småhus 2013, ES 2014:05, SOU 2008:110: Vägen till ett energieffektivare Sverige, december

76 Energianvändning, TWh Kvantitativ utvärdering av marknadsmisslyckanden och Den uppskattade spontana energieffektiviseringen visas också i Figur 24. Den antas ske till följd av befintliga styrmedel, till exempel Ekodesigndirektivet 91, som gör att de minst energieffektiva produkterna tas bort från marknaden. Kylar, frysar och diskmaskiner är exempel på produkter som omfattas och påverkar energianvändningen i småhussektorn i hög grad. I Vägen till ett energieffektivare Sverige bedömdes energieffektivisering som sker till följd av befintliga styrmedel vara cirka 7 procent av energianvändningen i bostadssektorn. 92 Sammanlagt bedöms den spontana energieffektiviseringen i småhussektorn vara i linje med denna bedömning, dvs. drygt 3 TWh/år år Figur 24: Schematisk illustration av ingenjörspotentialen i småhussektorn Spontan 40 BAU Hindrad 44 Ingenjörspotential 2030 Källa: Sweco, Energimyndigheten: Förbättrad energistatistik för lokaler Stegvis STIL Rapport för år 1 Inventeringar av kontor och förvaltningsbyggnader, ER 2007:34, SOU 2008:110: Vägen till ett energieffektivare Sverige, december

77 kwh/kr miljoner kronor Kvantitativ utvärdering av marknadsmisslyckanden och 5.5 Energiintensiv industri Den energiintensiva industrin står för cirka en tredjedel av Sveriges slutanvändning av energi, 112 TWh år Energianvändningen i sektorn karakteriseras av att den är starkt produktionsberoende och därmed också kopplad till BNP. Energiintensiteten i sektorn mäts i energianvändning per förädlingsvärde, kwh per krona. I och med att förädlingsvärdet har gått upp betydligt snabbare än energianvändningen, ses en minskning i energiintensitet, Figur 25. Figur 25: Energianvändning per förädlingsvärde samt näringslivets förädlingsvärde till baspris, referensår Energi per förädlingsvärde Förädlingsvärde Källa: Energimyndigheten, 2014 Den energiintensiva industrin karakteriseras av relativt få aktörer vid få anläggningar. Massaoch pappersindustrin består av 51 bruk totalt, med 20 ägare/koncerner. Järn- och stålverkssektorn består av 12 stålverk och 16 bearbetningsanläggningar, med 14 ägare/koncerner. I den kemiska industrin ser det dock annorlunda ut eftersom den består av över 400 företag där ett fåtal stora företag står för den största delen av energiförbrukningen. De senaste decennierna har en strukturomvandling ägt rum inom den energiintensiva industrin. Produktionen har samlats vid allt färre anläggningar. Enligt Skogsindustrierna har antalet massafabriker minskat från 72 stycken år 1980 till 41 anläggningar år och antalet pappersfabriker från 62 till 38 under samma period. Den totala produktionskapaciteten har dock ökat under perioden, från 10,5 till 12,6 miljoner ton massa per år respektive från 7,2 till 11,4 miljoner ton papper. Inom stålindustrin har en liknande trend skett. Förväntningen är att strukturomvandlingen kommer att fortgå på liknande sätt som tidigare Skogsindustrierna: Branschfakta, hämtat från den 24 november Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten december

78 Massa- och pappersindustrin står för cirka halva energianvändningen inom den svenska industrin, se Figur 26. Inom den energiintensiva industrin står massa- och pappersindustrin för en ännu högre andel av energianvändningen, cirka 70 procent. En stor del av massa- och pappersindustrins energianvändning är dock biobränsle i form av svartlut som förbränns som en del av kemikalieåtervinningen. Detta ingår i det stora segmentet biobränsle, torv i Figur 26. I rådande teknikparadigm är svartlutsförbränningen nödvändig. Detta faktum minskar incitamentet att effektivisera ånganvändningen inom de massa- och pappersbruk som har kemisk massaproduktion. Särskilt i de fristående massabruken, som inte är integrerade med pappersproduktion, är incitamentet lågt. Outnyttjad potential för ökad elproduktion i brukens egna turbiner kan öka incitamentet. På sikt kan även turbiner läggas till eller byggas ut. Det kan även finnas möjlighet att sälja andra restprodukter, särskilt bark, till värmeverk, vilket i så fall ökar incitamentet. Inom järn- stål- och metallverk används främst kol, koks och el som energibärare medan den kemiska industrin främst använder el och naturgas. Figur 26: Energianvändning inom den svenska industrin år 2012 (TWh) Massa- och pappersindustri Järn-, stål- och metallverk Kemisk industri Verkstadsindustri Övriga branscher Källa: Energimyndigheten, Energimyndigheten: Energiläget i siffror, december

79 Figur 27: Slutanvändning av bränslen och el inom den energiintensiva industrin (TWh) 14,1 11,8 4,1 58,5 52,7 Olje-produkter Naturgas och stadsgas El Fjärrvärme Biobränslen, torv Kol och koks 4,3 Källa: Energimyndigheten, Potentialen inom energiintensiv industri Konjunkturinstitutet bedömer i sin långtidsprognos att näringslivets förädlingsvärde ökar med i genomsnitt 2,3 procent per år mellan år 2016 och I worst case -scenariet för energiintensiv industri har produktionen antagits öka enligt detta från idag till år 2030, med bibehållen energiintensitet enligt dagens nivå, se Figur 27. Bedömningen av energieffektiviseringspotential baseras på Ett energieffektivare Sverige 97 i kombination med senare forskning. Ett energieffektivare Sverige gör den totala bedömningen att energieffektiviseringspotentialen är 20 procent i sektorn. Senare forskning har dock funnit att det i denna och tidigare bedömningar främst har ingått rent tekniska åtgärder. De åtgärder som har karaktären driftoptimering och beteendeförändringar har däremot inte räknats in i den utsträckning som borde vara möjligt. 98 Bedömningen i den här rapporten är därför att potentialen kan uppgraderas till cirka 25 procent. Den spontana potentialen som kan väntas realiseras till år 2030 utan ytterligare styrmedel, bedöms vara relativt stor på grund av den pågående strukturomvandlingen och den historiska trenden mot minskad energianvändning per förädlingsvärde. Sektorn kommer att påverkas av det nya beslutade kravet på kartläggning i stora företag. 96 Statens energimyndighet: Underlag till kontrollstation 2015, Analys av möjligheterna att nå de av riksdagen beslutade klimat- och energipolitiska målen till år 2020, Naturvårdsverkets och Energimyndighetens redovisning av uppdrag från regeringen, SOU 2008:25: Ett energieffektivare Sverige, Backlund et al: Extending the Energy Efficiency Gap, Energy Policy 2012; 51: , december

80 Energianvändning, TWh Kvantitativ utvärdering av marknadsmisslyckanden och I Vägen till ett energieffektivare Sverige 99 beskrivs Svenskt Näringslivs uppskattning av den spontana energieffektiviseringen inom energiintensiv industri till följd av befintliga styrmedel vara 2,3 TWh/år. 100 Detta utgör drygt 30 procent av den bedömda energieffektiviseringspotentialen som samma rapport anger för sektorn. Uppskrivet till 2030 års nivå blir den spontana energieffektiviseringen cirka 13 TWh/år år Figur 28: Schematisk illustration av ingenjörspotentialen i sektorn energiintensiv industri 112 Spontan Hindrad 154 Ingenjörs -potential 2030 Källa: Sweco, SOU 2008:110: Vägen till ett energieffektivare Sverige, SOU 2008:110: Vägen till ett energieffektivare Sverige, december

81 5.6 Övrig tillverkande industri Den del av industrisektorn som inte är energiintensiv, kallas här för övrig tillverkande industri, och omfattar till exempel verkstadsindustrier och livsmedelsindustrier. Denna del av industrin är mycket diversifierad gällande vad som tillverkas och består av ett mycket stort antal företag med olika typ av ägarstrukturer. Det är allt från multinationella koncerner till små familjeföretag. I och med att själva produktionsprocesserna i dessa industrier per definition är mindre energikrävande, används en större andel av energin i varje industri till kringutrustning såsom belysning och ventilation. Dessa tekniker kan sägas vara mer allmängiltiga till sin karaktär och kräver därför mindre expertkunskap för att genomföra energieffektiviseringsåtgärder. I och med att energikostnaderna står för en mindre andel av företagens totala kostnader, är inte energieffektivisering lika högt prioriterat som inom den energiintensiva industrin. Samtidigt som det rent tekniskt är enklare att genomföra energieffektivisering i denna sektor, finns alltså mindre incitament hos det enskilda företaget. Energikompetens finns inte alltid inom företaget, vilket kan leda till att även enkla åtgärder missas. Energiintensiteten mätt i energianvändning per förädlingsvärde, har minskat i alla delar av den svenska industrin, men särskilt mycket i verkstadsindustrin där minskningen har varit 50 procent mellan år 2000 och I verkstadsindustrin används främst el och fjärrvärme Potentialen inom övrig tillverkande industri Konjunkturinstitutet bedömer i sin långtidsprognos att näringslivets förädlingsvärde ökar med i genomsnitt 2,3 procent per år mellan år 2016 och I worst case -scenariet för övrig tillverkande industri har produktionen antagits öka enligt detta från idag till år 2030, med bibehållen energiintensitet enligt dagens nivå, se Figur 28. Bedömningen av energieffektiviseringspotential baseras på Vägen till ett energieffektivare Sverige 103 i kombination med senare forskning. Ett energieffektivare Sverige gör den totala bedömningen att energieffektiviseringspotentialen är 15 procent i sektorn. Såsom nämndes i förra avsnittet, kapitel 5.5 om energiintensiv industri, har senare forskning dock funnit att det i denna och tidigare bedömningar för industrisektorn främst har ingått rent tekniska åtgärder. De åtgärder som har karaktären driftoptimering och beteendeändringar har däremot inte räknats in i den utsträckning som borde vara möjlig. 104 Bedömningen i den här rapporten är därför att potentialen borde skrivas upp till cirka 20 procent. Den spontana energieffektiviseringen inom övrig tillverkande industri bedöms vara betydligt lägre än i den energiintensiva industrin. Befintliga styrmedel har bedöms ha relativt liten inverkan på sektorn. 105 Sammantaget bedöms den spontant realiserade 101 Energimyndigheten: Energiindikatorer, Energimyndigheten: Underlag till kontrollstation 2015, Analys av möjligheterna att nå de av riksdagen beslutade klimat- och energipolitiska målen till år 2020, Naturvårdsverkets och Energimyndighetens redovisning av uppdrag från regeringen, SOU 2008:110: Vägen till ett energieffektivare Sverige, Backlund et al, Extending the Energy Efficiency Gap, Energy Policy 2012; 51: , Energimyndigheten: Implementering av artikel 7 i energieffektiviseringsdirektivet, ER 2013:04, december

82 Energianvändning, TWh Kvantitativ utvärdering av marknadsmisslyckanden och energieffektiviseringen vara cirka 10 procent av potentialen år 2030, det vill säga cirka 1 TWh/år. Figur 29: Schematisk illustration av ingenjörspotentialen i sektorn övrig tillverkande industri 32 Spontan Hindrad 44 Ingenjörspotential 2030 Källa: Sweco, december

83 5.7 Persontransporter Denna studie inkluderar endast transporter på väg och spår, även vad gäller persontransporter. Energieffektivisering av kollektivtrafik utöver spårbunden, såsom buss, ligger utanför denna studie. Tågsektorns struktur Tåg står för 2,9 TWh per år, cirka 4 procent av transportsektorns energianvändning. 106 Av energin som används står el för 92 procent av energianvändningen och diesel för 8 procent. Persontrafik står för cirka 60 procent och godstrafik för cirka 40 procent. 107 Det finns 16 stycken tågoperatörer för persontransport inom Sverige, varav vissa även transporterar gods. De flesta är lokala och regionala (ofta del av den lokala kollektivtrafiken), medan exempelvis SJ är en aktör med större räckvidd. 108 SJ står för cirka procent av den energi som går åt till tågdrift i Sverige. 109 Majoriteten av all spårlängd i Sverige är elektrifierad, cirka kilometer av kilometer totalt. 110 Inom bantrafiken används främst el samt en mindre mängd diesel. 111 Vad gäller elen så saknas ofta exakt elmätning, och elen schablondebiteras istället. Det finns dock en större andel exakt elmätning vad gäller person- än vad gäller godstransport, till stor del beroende av att dessa tåg generellt sett är nyare, och har individuell mätning. Trafikverket handlar upp elen centralt och debiterar tågoperatörerna. Detta får påverkan vad gäller incitamenten för energieffektivisering, se avsnitt Enligt EU-direktiv får inte Trafikverket kräva att alla befintliga lok ska installera separat elmätning, då detta skulle kunna vara konkurrenshämmande. Dock finns en utveckling mot att allt fler har separat elmätning, i och med den successiva förnyelsen av tågen. Tåg är kapitalintensiva och har relativt lång teknisk livslängd, vilket gör att vissa åtgärder enbart lönar sig i samband med att man gör en större upprustning. 112 Energianvändningen i tåg avsedda för persontransport kan delas upp i två övergripande delar: den energi som går åt till att driva tåget samt hjälpkraft. Hjälpkraften används till ventilation, reglerteknik, uppvärmning av vagnar med mera. Hjälpkraftens andel av den totala energianvändningen varierar mellan cirka 3-5 procent de dagar det är som minst (runt grader utomhustemperatur) och 30 procent riktigt kalla vinterdagar. Det vanligaste är att vagnarna har kylbehov. 113 Tågens energiåtgång ökar kraftigt vid högre hastigheter. Mycket energi skulle därför kunna sparas genom att optimera hastigheten efter energiåtgång. Dock sänker detta attraktiviteten vid persontransporter, då människor värderar kort färdtid högt. Stora energibesparingar kan nås genom att flytta över persontransporter till tåg från andra färdmedel. Genom att öka 106 Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Trafikanalys: Statistik 2013, hämtat från den 28 oktober Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten Trafikanalys: Statistik 2013, hämtat från den 28 oktober Energimyndigheten: Transportsektorns energianvändning 2013, ES 2014: Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten december

84 attraktiviteten, ibland på bekostnad av energieffektiviteten i tåg, kan således energieffektiviseringar ske på systemnivå. Privatbilismens struktur Personbilism använder 45 TWh per år, vilket motsvarar 61 procent av transportsektorns totala energianvändning. 114 Sektorn har ett stort antal fordon och ett stort antal ägare, något som gör att det ibland kan vara svårt att nå ut till sektorn med exempelvis information. Majoriteten av bilarna är bensindrivna, och även diesel står för en stor andel. Fördelningen av personbilars drivmedel visas i Figur 30. Det säljs idag fler dieselbilar än bensinbilar, vilket successivt kommer ändra fördelningen vartefter äldre fordon skrotas. Figur 30: Fördelning av personbilar i trafik efter drivmedel, % 24% 0% 0% 5% 1% 0% 69% Bensin Diesel El Elhybrid Laddhybrid Etanol/ etanolflexifuel Gas/gas flexifuel Övriga Källa: Trafikanalys, 2013 Personbilar har främst privata ägare även om företagsbilar också förekommer. År 2013 ägdes 79 procent av personbilarna av privatpersoner, 11 procent av personliga företag och resterande 10 procent av övriga juridiska personer. Det finns cirka en bil per två invånare i Sverige: år 2013 fanns 467 personbilar i trafik per 1000 invånare. Det finns totalt cirka 4,4 miljoner personbilar i Sverige. År 2013 såldes cirka nya bilar i Sverige, vilket motsvarar en utbytestakt på cirka sex procent årligen. Utbytestakten är högre bland de bilar som körs mycket, men å andra sidan byts inte alla bilar ut Potentialen inom persontransporter För persontransporter kan energieffektiviteten förbättras genom förbättrad aerodynamik, återmatning, ecodriving, bättre drivsystem och bättre utrymmesutnyttjande. 116 Ett exempel är de X55-tåg som SJ har bytt ut en del X2000 mot, då dessa har procent lägre energianvändning per personkilometer än X2000. Utbytestakten är dock långsam. Ytterligare ett sätt att energieffektivisera är att öka beläggningsgraden. Som exempel kan nämnas att SJ mellan 2004 och 2010 höjde beläggningsgraden på X2000-tågen från cirka 114 Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Trafikanalys: Statistik 2013, hämtat från den 28 oktober Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, december

85 55 procent till cirka 70 procent. 117 Detta berodde bland annat på ett nytt bokningssystem. Ett annat sätt att få ner energianvändningen är att återmata energi vid inbromsning. Istället för mekaniska bromsar används då återmatande elbromsar, som överför ström i loket till elledningarna ovanför loket. 118 Att nyttja bromsarna på ett bra sätt och att på annat sätt köra energieffektivt kallas ecodriving. Genom att elektrifiera de sträckor där idag dieseltåg kör och genom minskade förluster i infrastruktur kan ytterligare energibesparingar uppnås. 119 Det är viktigt att notera att då energianvändningen för persontransporter på tåg går upp kan detta innebära en energieffektivisering totalt sett, om energiuppgången kommer av överflytt från andra färdmedel. 120 Vad gäller personbilism skulle energi kunna sparas genom en effektivare fordonspark, genom effektivare användning (sparsam körning, hastighet), optimering av befintliga fordon (däcktryck, service, däckval) och genom att minska bilkörningen. Bilkörningen kan minska på flera olika sätt, exempelvis genom samhällsplanering, byte till andra färdsätt och genom ändrad livsstil. Överflytt av persontransporter från bil till kollektivtrafik som tåg och buss kan medföra en energieffektivisering, men givetvis även överflytt till gång eller cykel. I Figur 31 visas den övergripande skillnaden i energianvändning per personkilometer för transport på väg respektive spår. Figur 31: Energiintensitet för persontransporter och godstransporter på väg respektive spår Källa: Trafikanalys, 2014 Genom samhällsplanering och resfria möten kan transportbehovet minskas. Dessa möjligheter inkluderas i vår studie. En mer optimal samhällsplanering kan både minska totala 117 Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, december

86 körsträckor och möjliggöra energieffektivare transportsätt. Med definitionen som valts inom denna studie av begreppet energieffektivisering gäller dock att den upplevda nyttan bör vara densamma eller högre. Om en komfortminskning sker bör detta kompenseras med en annan nyttoökning, till exempel minskad kostnad. I en rapport gjord på uppdrag av Energimyndigheten lyfts att gröna resplaner, resepolicys, resfria möten och parkeringsåtgärder (exempelvis högre prissättning för parkering) ger effekter på kort sikt, medan transportsnål samhällsplanering har stor långsiktig potential. 121 Bedömningen av energianvändningen i persontransportsektorn år 2030 baseras på att ökningen i efterfrågan på persontransporter har avstannat de senaste åren. En konstant efterfrågan har antagits. Om även energieffektiviteten bibehålls ( worst case -scenariet) fortsätter energianvändningen i sektorn att vara 47 TWh/år även år 2030, se Figur 32. Potentialbedömningen baseras på Elforsks rapport Roadmap för ett fossilbränsleoberoende transportsystem år , där cirka 37 procent energieffektivisering bedöms möjlig med hjälp av effektivisering av fordon, planering och överflytt inom persontransportsektorn. Uppräknat till 2030 års energianvändning blir potentialen cirka 17 TWh/år. Den spontana energieffektiviseringen till följd av skatter bedöms vara större för privatbilism än för lastbilar. 123 Även effekten av krav på motorer bedöms vara relativt stor då fordonsflottan successivt byts ut till år Lindfeldt et al bedömer i sin forskning att fossilbränsledrivna privatbilar blir 26 procent mer bränsleeffektiva mellan år 2004 och Sammantaget bedöms den spontana energieffektiviseringen vara cirka 30 procent av potentialen inom persontransporter, det vill säga cirka 5 TWh/år. 121 Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Profu: Elforsk rapport 12:68 - Roadmap för ett fossilbränsleoberoende transportsystem år 2030, SOU 2008:110: Vägen till ett energieffektivare Sverige, Lindfeldt, Saxe, Magnusson, Mohseni: Strategies for a road transport system based on renewable resources The case of an import-independent Sweden in 2025, Applied Energy 2010:87; , december

87 Energianvändning, TWh Kvantitativ utvärdering av marknadsmisslyckanden och Figur 32: Schematisk illustration av ingenjörspotentialen i persontransportsektorn Spontan 47 Worst case 47 Hindrad Ingenjörspotential 2030 Källa Sweco, december

88 5.8 Godstransporter Godstransporter har avgränsats till att titta på spår och väg, det vill säga flyg och sjöfart beaktas inte. Godstransporter på väg och spår verkar ofta kompletterande, så att längre och tyngre transporter går på järnväg medan kortare och lättare körs med lastbil. Av allt gods som transporteras med lastbil inrikes körs endast 10 procent på avstånd över 30 mil. 125 År 2013 utförde tåg ett godstransportarbete på cirka miljoner tonkm, medan lastbilstransporterna stod för miljoner tonkm. 126 All statistik som redovisas i detta kapitel innefattar endast inrikes trafik och svenskregistrerade fordon. Godstransporter på spår Tåg använde för år ,9 TWh, cirka 4 procent av transportsektorns energianvändning. 127 Av energin som används står el för 92 procent av energianvändningen och diesel för 8 procent. Persontrafik står för cirka 60 procent och godstrafik för cirka 40 procent. 128 Det finns elva stycken tågoperatörer som kör gods inom Sverige (2013), av vilka ett antal även kör persontransporter. 129 Företagen varierar i storlek, och många är små. Av det totala transportarbetet inom gods på spår står vagnlastgods för cirka miljoner tonkm och kombigods för miljoner tonkm. Med kombigods avses gods som fraktas i en lastenhet avsedd för att flyttas över mellan lastbil, tåg och fartyg. Detta kan vara i form av exempelvis containers, växelflak eller semitrailers. Kombigods möjliggör således ökad intermodalitet genom förenklad överflytt mellan transportslag. 130 Majoriteten av all spårlängd i Sverige är elektrifierad, cirka kilometer av kilometer totalt. 131 Inom bantrafiken används främst el samt en mindre mängd diesel. 132 Liksom för persontransporter på spår som beskrivs i föregående kapitel, saknas i de flesta fall exakt elmätning av elanvändningen för fordonen. Trafikverket handlar upp elen centralt och schablondebiterar tågoperatörerna. Detta får påverkan vad gäller incitamenten för energieffektivisering, se avsnitt Enligt EU-direktiv får inte Trafikverket kräva att alla befintliga lok ska installera separat elmätning, då detta skulle kunna vara konkurrenshämmande. Tågen har relativt långa tekniska produktcykler, vilket gör att vissa åtgärder enbart lönar sig i samband med att man gör en större upprustning. Dock finns en utveckling mot att allt fler har separat elmätning, även om detta tar tid innan alla fordon omfattas. 133 Godstransporter på väg Tunga lastbilar använde år TWh per år, vilket motsvarar cirka 23 procent av transportsektorns totala energianvändning. Lätta lastbilar står för 7 TWh, vilket i sin tur 125 Sveriges åkeriföretag: Fakta om Åkerinäringen 2013, hämtat från den 28 oktober Trafikanalys: Statistik 2013, hämtat från den 28 oktober Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Trafikanalys: Statistik 2013, hämtat från den 28 oktober Trafikanalys: Bantrafik 2012, hämtat från den 20 oktober Trafikanalys: Statistik 2013, hämtat från den 28 oktober Energimyndigheten: Transportsektorns energianvändning 2013, ES 2014: Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten december

89 motsvarar 9 procent av energianvändningen i sektorn. 134 Observera att utländska åkerier för in en del drivmedel som förbränns i Sverige men som inte ingår i statistiken. Vad gäller lastbilstransporter finns det cirka lastbilar i yrkesmässig trafik och i firmabilstrafik. 135 Firmabilstrafik avser grossister och återförsäljare som distribuerar varor till sina kunder, medan yrkesmässig trafik är lastbilar som kör transporter åt andra. 136 Kommersiellt gångbara alternativ till fossila drivmedel är begränsade i dagsläget, och diesel dominerar energianvändningen i sektorn. Av det totala transportarbetet så står yrkesmässig trafik för cirka miljoner tonkm (91 procent) och firmabilstrafik för resterande miljoner tonkm (9 procent). År 2011 fanns cirka åkeriföretag i Sverige. 137 Nästan vartannat åkeriföretag var då ett enbilsföretag, dock finns en trend mot att åkerierna blir färre och större. De större företagen med 16 bilar eller fler stod år 2011 för cirka 4 procent av antalet åkerier, men innehade 35 procent av fordonsflotta. Nästan vartannat åkeri (45 procent) hade år 2011 elva fordon eller fler. Den procentuella fördelningen av antalet bilar i åkerier samt den procentuella fördelningen av den totala yrkesmässiga fordonsflottan visas i Figur 33. Trots trenden mot större åkerier kan dock åkeribranschen fortfarande sägas bestå av främst små företag, vilket påverkar förutsättningarna för energieffektivitet i branschen. 138 Detta beskrivs i kapitel där Organisatoriska i godstransportbranschen beskrivs. Dessutom har det tillkommit ett flertal utländska åkerier som transporterar gods i Sverige på senare år. Dessa finns inte i branschstatistiken som beskrivs i detta stycke. Figur 33: Struktur i åkerinäringen vad gäller antalet fordon i åkerier och dessas del av den totala lastbilsflottan Procent av åkerier med ett visst antal fordon 8,9% 2,9% 4,2% Procent av lastbilsflottan som tillhör åkerier med ett visst antal fordon 12,1% 48,3% ,6% 25,9% ,7% Källa: Sveriges Åkeriföretag, ,4% 17,0% Figur 34 visar körda kilometer i tusental km för yrkesmässig trafik respektive firmabilstrafik. Som kan ses ifrån figuren körs den största delen transporter med last, 84 procent av alla kilometer som körs av yrkesmässig trafik respektive 85 procent av alla kilometer som körs med firmabil. Att det ändå är cirka 15 procent av alla kilometer som körs utan last kan förklaras av att de önskade transportflödena inte alltid möjliggör last åt bägge håll. Intervjupersonerna och expertpanelen lyfte ett antal exempel på detta. Exempelvis i ett 134 Koucky & Partners AB på uppdrag av Energimyndigheten: Energianvändning inom transportsektorn, Trafikanalys: Statistik 2013, hämtat från den 28 oktober Trafikanalys: Lastbilstrafik 2012 kvartal 1, hämtat från den 30 oktober Sveriges åkeriföretag: Fakta om Åkerinäringen 2013, hämtat från den 28 oktober Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten december

90 skogsbruk ska mycket mer skog transporteras bort än vad varor ska till skogsbruket. På samma sätt ska mycket fler konsumtionsvaror in till Stockholm varje dag än vad varor ska lämna staden. Att alla typer av gods inte kan åka i samma fordon försvårar också. Exempelvis är det inte lämpligt att transportera mat i samma fordon som sopor. 139 Figur 34: Fördelning av körd stäcka för firmabilstrafik och yrkesmässig trafik med och utan last 12% 2% 14% Yrkesmässig trafik med last Yrkesmässig trafik utan last Firmabilstrafik med last Firmabilstrafik utan last 72% Källa: Trafikanalys, 2013 I intervjuer och expertpaneler framkom det även att det finns en tendens att lastfyllnadsgraden minskat de senaste åren. Detta bedöms bero på ett antal olika saker, bland annat att beställarna ställer krav på stor exakta tider som godset ska vara framme, samtidigt som de kräver en större flexibilitet i att kunna ändra sig angående körningar. Trenden med just-in-time och att lager flyttat ut på vägarna förändrar förutsättningarna för logistik och möjligheten att kunna optimera transporter. 140 Godstransport på väg och spår Det finns ett antal aktörer som är involverade vid en godstransport kunder för beställningar av transporter, eventuell annan slutkund som varan ska levereras till, speditörer, lastbilscentraler, åkeriföretag eller tågoperatörer. Ofta är transparensen mellan beställaren och den som gör den faktiska körningen bristfällig, flera personer i intervjuer och expertpanel framhåller exempelvis att mellanledet i form av speditörerna ofta försvårar transparens. Initiativet Fair transport som tagits fram av åkeribranschen är ett sätt att skapa en kvalitetsstämpel som underlättar för transportköparna att göra bra val med avseende på miljöhänsyn med mera. Expertpanelen beaktade även andra aktörer utifrån ett systemperspektiv. Både tåg- och vägtransporter är beroende av välfungerande infrastruktur. Investeringarna i järnväg har under många år varit otillräckliga, vilket påverkar tilliten till att 139 Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten december

91 det som körs på spår kommer fram i tid. Detta, tillsammans med avsaknad av spårutbyggnad på många ställen, motverkar högre grad av transportöverflyttning till spår. Vad gäller vägar pekade intervjupersoner på bland annat bättre stadsplanering och logistik som kan reducera distributionsbilars körsträckor. Godstransporter är en bransch med små marginaler och stor prispress och våra muntliga källor understryker kunders priskänslighet i val av transport. Detta i kombination med att energikostnadens stora andel kan leda till att många företag arbetar med att hålla nere energikostnaderna. Flera företag framhöll under intervjuerna aktivt energieffektiviseringsarbete var en nödvändighet för att hävda sig i konkurrensen. Att utländska åkerier har pressat priserna ytterligare har tagit en del av marknaden både ifrån svensk väg- och spårbunden transport. Detta trots att de utländska bilarna ofta, enligt våra källor, sägs ha sämre energieffektivitet, säkerhet och ofta inte följer gällande regelverk. Ett konkret exempel på detta är att de, enligt uppgift, ofta tar med sig en större mängd drivmedel in i Sverige än vad som är tillåtet, och att de således undviker den beskattning som finns på svenska drivmedel. Detta får negativa inverkningar på bland annat skatteintäkter och på energieffektiviteten, eftersom de utlänska bilarna generellt sett har äldre bilar med sämre energieffektivitet Potentialen inom godstransporter Det är viktigt att notera att statistiken inte innehåller transporter som genomförs i Sverige av utländska åkare, vilket får påverkan på potentialbedömningarna. Det finns en potential i överflytt mellan alla fyra transportslag; väg, spår, sjöfart och flyg. Att vi i denna studie endast beaktar spår och väg får således även det konsekvenser för potentialbedömningarna. Sett ur ett systemperspektiv finns tre olika nivåer att arbeta med för att nå högre energieffektivitet i transportsektorn: Samhällsbyggnadsnivå: att planera och bygga så att en mindre mängd transporter efterfrågas. Transportsystemnivå: att planera så att olika transportslag kan utnyttjas optimalt. Detta minskar efterfrågan på vägtransporter och underlättar att få upp fyllnadsgrader. Effektiviseringar på fordonsnivå, inklusive framförandet av fordonet. 141 En stor potential finns således i stadsplanering, infrastrukturinvesteringar och förbättrad överflytt mellan transportslag. Vad gäller specifika energieffektiviseringsmöjligheter inom tåg kan nämnas nya energisnålare lok, fortsatt övergång från diesel till eldrift, återmatning av bromsenergi, start-stopp-system och ecodriving (inklusive anpassning av hastigheter). Generellt sett kan sägas att godstransporter har något äldre vagnar och lok än tåg för persontransporter: kundernas komfortkrav medför i praktiken moderna tåg medan 141 Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten 2014, denna information baserad på slutsatser ifrån studien Fossilfri fordonsflotta 19 december

92 godstransportköpare främst eftersöker ett lägre pris. Godstransporter kan därför sägas ha något högre potential än persontransporter vad gäller energieffektivisering. 142 Vad gäller energieffektiviseringsmöjligheter inom lastbilstransporter kan nämnas ecodriving, nyare bilar med effektivare motorer och lägre vikt, reducerat luftmotstånd, byte av drivmedel, förbättrade fyllnadsgrader och reducerat transportbehov med hjälp av bra ruttplanering, samkörning och optimerad logistik. Viktigt att nämna är dock att varken byte till modernare och miljömässigt bättre motorer eller byte till annat drivmedel per definition medför en högre energieffektivitet; ibland kan effekten vara den motsatta. Ytterligare en faktor värd att nämna är att nyare fordon blir allt bättre på att automatiskt optimera körningen, vilket leder till att vikten av separat fokus på ecodriving får minskad betydelse. 143 En skillnad mellan lastbilar och tåg är längden på livscykeln. Lastbilar som kör mycket ofta har betydligt kortare livscykel än tåg vilket medför att omsättningen av fordon sker fortare, till exempel gällande energieffektivitet. En lastbil kan visserligen finnas kvar länge men körs efter ett fåtal år mycket mindre. 144 Bedömningen av energianvändningen i godstransportsektorn år 2030 baseras på att efterfrågan på godstransporter följer det privata näringslivets produktivitet. Efterfrågan på godstransporter antas alltså i hög grad vara knuten till industrisektorns produktionsnivå. Konjunkturinstitutet bedömer i sin långtidsprognos att näringslivets förädlingsvärde ökar med i genomsnitt 2,3 procent per år mellan år 2016 och I worst case -scenariet för godstransporter har transportefterfrågan antagits öka enligt detta från idag till år 2030, med bibehållen energiintensitet enligt dagens nivå. Energianvändningen i sektorn år 2030 blir cirka 25 TWh enligt dessa antaganden, se Figur 35. Potentialbedömningen är baserad på Elforsks rapport Roadmap för ett fossilbränsleoberoende transportsystem år , där cirka 33 procent energieffektivisering bedöms möjlig med hjälp av effektivisering av fordon, planering och överflytt. Uppräknat till 2030 års energianvändning blir detta cirka 8 TWh/år. Den spontana energieffektiviseringen till följd av befintliga skatter har bedömts vara relativt liten i sektorn. 147 Lindfeldt et al bedömer i sin forskning att fossilbränsledrivna lastbilar blir 5 procent mer bränsleeffektiva mellan år 2004 och Sammantaget bedöms den spontana energieffektiviseringen vara cirka 10 procent av potentialen inom godstransporter, det vill säga mindre än 1 TWh/år. 142 Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten Energimyndigheten: Underlag till kontrollstation 2015, Analys av möjligheterna att nå de av riksdagen beslutade klimat- och energipolitiska målen till år 2020, Naturvårdsverkets och Energimyndighetens redovisning av uppdrag från regeringen, Profu: Elforsk rapport 12:68 - Roadmap för ett fossilbränsleoberoende transportsystem år 2030, SOU 2008:110: Vägen till ett energieffektivare Sverige, Lindfeldt, Saxe, Magnusson, Mohseni: Strategies for a road transport system based on renewable resources The case of an import-independent Sweden in 2025, Applied Energy 2010:87; , december

93 Energianvändning, TWh Kvantitativ utvärdering av marknadsmisslyckanden och Figur 35: Schematisk illustration av ingenjörspotentialen i godstransportsektorn Spontan 18 BAU Hindrad 25 Ingenjörspotential 2030 Källa Sweco, december

94 6 Hinder i respektive sektor I detta kapitel beskrivs hur de olika hindren tar sig uttryck inom respektive sektor. Varje sektorsdel avslutas även med en översikt av den bedömda storleken på respektive inom aktuell sektor. 6.1 Flerbostadshus Swecos underlag till s uttryck i de olika sektorerna kommer ifrån intervjuer och expertpaneler. De som medverkat är aktörer från byggindustrin, fastighetsbolag som äger och förvaltar bostäder, branschorganisationer samt myndigheter. Det bör dock noteras att urvalets tonvikt ligger på större fastighetsägare som har arbetat med energieffektivisering, vilket inverkar på deras beskrivning Asymmetrisk information och Delade incitament Både intervjupersoner och expertpanelen anser att Asymmetrisk information inklusive Delade incitament är ett relativt viktigt, om än inte avgörande,. I dagsläget betalar generellt sett boende elkostnader för bostaden och fastighetsägaren betalar värmekostnader samt även varmvattenkostnaderna och fastighetselen. 149 I praktiken innebär det att den aktör som har störst möjlighet att påverka energianvändningen även betalar energikostnaden. Dock anser flera intervjupersoner att hyresgäster och fastighetsägare har bristande incitament att sänka sina el- och värmekostnader på grund av låga el- och värmepriser. Endast en minoritet av fastighetsägare har infört alternativa betalningsmodeller. Enligt Energimyndigheten och Boverket (2013) har representanter från både bygg- och fastighetssektorn utryckt att nackdelarna överväger fördelarna angående individuell mätning och debitering av värme. 150 Boverket publicerade även nyligen en rapport som argumenterar att individuell värme och varmvattenmätning oftast inte är kostnadseffektivt. 151 Det existerar dock vissa Delade incitament inom fastighetsbranschen för varmvattenanvändning, fastighetsel samt för inkluderade hushållsapparater inom hyresrättsektorn. 152 Fastighetsägaren betalar generellt sett för varmvatten, de boende har således låga incitament att hushålla med varmvatten vid exempelvis dusch och handdisk. Även trapphuselen och el i gemensamhetsutrymmen betalas nästan uteslutande av fastighetsägaren. Detta innebär att de boende saknar incitament att använda el för trapphusbelysning, hissar och tvättstuga sparsamt. En dellösning för att minska Delade incitament är att införa betaltvättstugor. Delade incitament kan även uppstå vad gäller de hushållsapparater som byggföretaget eller fastighetsägaren står för, men som de boende sedan betalar den löpande elkostnaden för. Detta kan innefatta exempelvis kyl- och frys, tvättmaskin och diskmaskin. 149 El för tvättstugor, hiss, ljus i trapphuset och dylikt inkluderas i detta begrepp. 150 Energimyndigheten och Boverket: Analys av Delade incitament för energieffektivisering Med fokus på energiprestandaförbättrande investeringar. Regeringsuppdrag. Rapport 2013:32, Boverket: Individuell mätning och debitering vid ny- och ombyggnad, Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader, ET2013:24, december

95 Boende kan även ha en viss negativ påverkan på värmeanvändning genom att ha öppna fönster i onödan, då de boende inte betalar för uppvärmningen och således saknar incitament att hushålla med värme. Detta riskerar minska fastighetsägares incitament att genomföra energieffektiviseringsåtgärder som påverkas av hyresgästers beteende. 153 Observera dock att detta har liten påverkan i sammanhanget, jämfört med den energieffektiviseringspotential som finns i att exempelvis tilläggsisolera eller byta uppvärmningssystem. Delade incitament under byggskedet av fastigheter finns också då byggföretag inte alltid har tillräckliga motiv att göra byggnaden så energieffektiv som möjligt. Om byggföretag bygger i egen regi kan de bygga enligt egen energiprestanda. Ett flertal av de intervjuade byggföretagen har också egna miljökrav. När kunden är en extern beställare alternativt ingår i en totalentreprenad kan byggföretag även försöka påverka utformningen. Kundens val tycks dock vara svårare att påverka då byggföretagen strängt taget tycks sakna incitament för sådan påverkan. Desto senare byggföretaget kommer in i processen, desto svårare tycks det också vara att inkludera energieffektiviseringsåtgärder. De intervjuade byggföretagen argumenterar att det finns ett bristande kundintresse gällande energieffektiva byggnader. Istället anser de att kunder ofta ser bostadens läge, design samt kostnad som viktigare än dess energianvändning. Intervjuerna indikerar även att byggföretagen inte marknadsför fördelarna med energieffektiva hus i särskild stor utsträckning. Ett identifierat problem är också att bostadsrättsföreningar ofta saknar beställarkompetens angående energieffektivisering och att byggföretagen därmed har ett kunskapsövertag. För större fastighetsbolag, såsom hyresrättsföretag, är detta dock ett mindre problem. Ett relaterat problem som togs upp av expertpanelen är att beställaren ofta inte har kompetensen att säkerställa att slutprodukten överensstämmer med beställning. Utredningar visar att det ofta förekommer att byggnadsprojekts budget för bygg- samt driftkostnader är separerade. Det medför att de involverade aktörerna vanligtvis enbart ansvarar för sin del av byggprocessen och därmed ofta prioriterar låga inköps- och investeringskostnader. Detta riskerar leda till att de olika involverade aktörerna saknar incitament att optimera byggnadens energianvändning Kunskap och osäkerhet om ny teknik Det skiljer sig mycket mellan större och mindre bolag vad gäller kunskap kring ny teknik. Till exempel har större byggföretag teknikavdelningar som granskar marknaden för nya produkter och tekniker. I varierande grad arbetar bolagen med sina leverantörer för att bestämma och höja prestandan av produkter samt användandet av installationskonsulter. Omfattning, struktur och kvalitet på arbetsmetoderna varierar också beroende på hur väl etablerat och förankrat energieffektiviseringsfrågan är inom organisationen i fråga. Mängden av resurser som allokerats området, tillgången av kompetent personal samt företagens organisatoriska förutsättningar är också påverkande faktorer. 153 Energimyndigheten och Boverket: Analys av Delade incitament för energieffektivisering Med fokus på energiprestandaförbättrande investeringar. Regeringsuppdrag. Rapport 2013:32, Energimyndigheten och Boverket: Analys av Delade incitament för energieffektivisering Med fokus på energiprestandaförbättrande investeringar. Regeringsuppdrag. Rapport 2013:32, december

96 Kvaliteten av dessa arbetsmetoder påverkar i hög grad företagets osäkerhet kring, samt förmåga att hantera, ny teknik. Samtliga intervjuade anser att Kunskap och osäkerhet om ny teknik är ett väsentligt. Det råder samstämmighet bland intervjupersonerna både inom bygg- samt fastighetsbranschen om att osäkerhet kring ny teknik väsentlig minskar aktörers användning av ny teknik. Tre orsaker till detta framkom under intervjuerna. Det tar flera år innan tekniken kan anses vara beprövad. Byggföretag ansvarar även för att tekniken ska fungera över en tidsperiod vilket kan leda till stora kostnader om tekniken inte håller utlovad prestanda. En teknik som inte håller utlovad standard kan minska organisationens benägenhet att använda sig av energieffektiva produkter framöver. Utifrån våra källor framkommer det därmed en bild av att det finns hög motivation att använda sig av beprövad teknik. Ett intervjuat byggföretag säger sig endast använda sig av obeprövad teknik om kunden är beredd att ta ansvaret för dess prestanda. Dock varierar benägenheten att testa nya tekniker emellan de intervjuade företagen. Ett fastighetsbolag som har kommit mycket långt i sitt energieffektiviseringsarbete och som genomför omfattande renoveringar av sina miljonprogramshus bygger exempelvis referensbyggnader där de testar produkter. De byggföretag som har kommit längre i sitt energieffektiviseringsarbete har interna team, alternativt sammarbetar med leverantörer, som till viss del testar nya produkter. Andra aktörer är mindre benägna att utföra tester själva. Att testa ny teknik tycks inte endast vara kopplat till ett företags storlek, utan även beroende av det interna engagemanget. Detta fenomen är även relaterat till organistoriska då bristande intern kommunikation hindrar spridning av kunskap samt erfarenhet av ny teknik. För att delvis överkomma osäkerhet kring ny teknik efterfrågar majoriteten av de intervjuade att fler demonstrationsprojekt bör genomföras och granskas av en oberoende aktör. Det tycks finnas bristande tillit till nya produkters prestanda samt otillräcklig information om produkterna har testats i svenska klimatzoner. En oberoende aktör, såsom ett universitet eller institut, har högre trovärdighet än tillverkare och leverantörer vid testning. Flera intervjupersoner efterfrågar även förbättrad informationsspridning kring demonstrationsprojekt. Detta problem är även relaterat till hindret Transaktionskostnader, då det krävs tillräcklig intern kompetens för att möjliggöra mottagarkapacitet inom företagen. Energimyndigheten (2010) tar även upp problemet att early adopters av ny teknik för närvarande upplever större inlärningskostnader och risk än late adopters. 155, ett problem som skulle minska med genomförande av demonstrationsprojekt. Ett annat sätt att överkomma hindret är teknikupphandlingar. Intervjupersoners kunskap om förekomsten av teknikupphandlingar i branschen varierar. En möjlig förklaring kan vara otillräcklig informationsspridning av teknikupphandlingars resultat. 155 Energimyndigheten: Finansieringsinstrument för energieffektivisering. ER 2010:37, december

97 6.1.3 Transaktionskostnader De intervjuade anser att Transaktionskostnader är ett mindre allvarligt. Ur expertpanelens diskussioner framkom dock en något annorlunda bild där bristande ansvarsfördelning samt bristande kunskap inom företag kan leda till höga Transaktionskostnader. Deltagare i expertpanelen argumenterar för att större företag upplever lägre Transaktionskostnader då de har utvecklat intern energieffektiviseringskompetens samt åtnjuter stordriftsfördelar. Mindre fastighetsägare, som bostadsrättsföreningar som enbart äger ett fåtal byggnader saknar oftast tillgång till kompetent personal inom energieffektiviseringsfrågor samt saknar stordriftsfördelar. Även Energimyndigheten (2010) lyfter att Transaktionskostnader är ett påtagligt för genomförandet av energieffektiviseringsåtgärder inom denna sektor. 156 Tre orsaker har nämnts i intervjuerna som bidragande faktorer till Transaktionskostnader. Bristande kunskap om energieffektivisering försvårar genomförandet samt ökar kostnaden av energieffektiviseringsåtgärder är en orsak. Bristande kunskap kan även leda till suboptimala beställningar. Intervjuerna indikerar att det råder viss brist på tillgång till kompetent personal, en syn som återspeglas bland deltagare i expertpanelen. Denna syn delas även av SKL (2011) som anser att det råder bristande tillgång till specifik kunskap inom både den offentliga och privata sektorn om vilka energieffektiviseringsåtgärder som bör vidtas. SKL anser därmed att bristen på kunskap och dess ojämna fördelning är ett av de största hindren för energieffektivisering. 157 För att minska det här problemet erbjuder vissa företag interna utbildningar för att öka personalens kompetens. Ett företag anser att detta är nödvändigt då det ser energieffektiva hus som morgondagens standard. Den andra orsaken till Transaktionskostnader är den tid och de resurser som läggs på intern kommunikation inom företag för att genomdriva energieffektiviseringsfrågor. En tredje bidragande orsak är att informationsinsamling, planering, dialog med kund, val av teknik, leverantörskontakter samt projektering är tids- och resurskrävande. För att minimera dessa kostnader anses tillräcklig intern kompetens vara av vikt. Själva implementeringen, installationen och konstruktionen av energieffektiva teknologier anses däremot inte ta mer tid och resurser än mindre energieffektiva sådana. Om Transaktionskostnader är större eller mindre än den kostnad som sparas av energieffektiviseringsåtgärder är svårt att ta ställning till då det helt är avhängigt av vilken tidshorisont som används för analysen. Ett antal intervjupersoner poängterade även att aktörer tar in andra aspekter när de beslutar om investeringar i energieffektiviseringsåtgärder. Exempelvis kan vissa energieffektiviseringsåtgärder, såsom byte av fönster, leda till att bostadens värde ökar. Ett annat exempel är valet av högpresterande isolering som kan leda till minskad väggtjocklek. Detta i sin tur leder till en större uthyrningsbaryta vilket ger en bättre kalkyl. 156 Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader. ET2013:24, Sveriges Kommuner och Landsting: Miljarder skäl att spara! Lönsamma energimål i kommunala fastigheter, december

98 6.1.4 Begränsad rationalitet Intervjupersonerna anger även att Begränsad rationalitet är ett betydande. uppkommer bland annat av begränsat engagemang i, och kunskap om energieffektiviseringsfrågor hos aktörer. Det tycks dock finnas ett ökande intresse för, och insikt om, vikten av energieffektivisering inom både bygg- samt fastighetssektorn. Intervjupersoner beskriver att det ibland finns bristande engagemang och kunskap om energieffektiviseringsfrågor bland ekonomichefer inom företag vilket kan ge upphov till Begränsad rationalitet. Exempelvis framkom det i en intervju att ett företags ekonomiavdelning har använt en högre diskonteringsränta för energieffektiviseringsprojekt än andra investeringar på grund av bristande kunskap om teknologin i fråga. Ett stort antal intervjupersoner angav att bostadsrättsföreningar generellt sett är mindre intresserade av energieffektiviseringsfrågor. Bristande kunskap riskerar leda till att kunden inte förstår affärsvärdet av energieffektiviseringsåtgärder. Under intervjuer som Fastighetsägarna (2013) genomförde påpekades det även att det bland vissa bostadsrättsföreningar tycks finnas en motvilja till att låna pengar till energieffektiviseringsåtgärder, vilket kan vara ett tecken på Begränsad rationalitet Organisatoriska Organisatoriska tycks vara ett stort men inte avgörande. Storleken på hindret är kopplat till företagets storlek, dess decentraliserade organisationsmodell, geografiska spridning, bristande intern kommunikation och kunskap. Även incitamentstruktur samt kortsiktiga lönsamhetskrav och kortsiktigt ekonomiskt ägarperspektiv bygger upp till Organisatoriska. Ett flertal av de intervjuade företagen är större aktörer och har en decentraliserad organisation samt har verksamheter utspridda över landet. Detta riskerar leda till suboptimeringar då kunskap och erfarenheter av implementeringen av energieffektiviseringsåtgärder inte används och sprids tillräckligt inom företaget. Det har även visat sig vara komplicerat och tidskrävande att implementera strategier angående miljöfrågor på grund av organisationers struktur och till viss del geografiska spridning. Energifrågan faller ofta mellan stolarna, delvis på grund av brist på personal, speciellt inom mindre företag. Även bristande intern kommunikation inom bygg- och fastighetsbolag är ett. Enligt en intervjuperson på ett byggföretag kan ett projekterat lågenergihus som stöter på ökade kostnader, förseningar eller bristande kundintresse få vissa energieffektiviseringsprodukter borttagna av försäljningsavdelning för att minska kostnader. Bristen på intern kommunikation och ägandeskap av projektet från projektering till försäljning leder därmed till suboptimala resultat då byggnaden i slutändan inte uppnår planerad energiprestanda. Ökad erfarenhetsöverföring och informationsspridning internt har därmed efterfrågats av flera intervjupersoner för att överkomma detta. 158 Fastighetsägarna: Så når vi de nationella energimålen bebyggelsens effektivisering, december

99 Företags incitamentstruktur har även uppgetts vara ett för flera intervjupersoner, speciellt inom byggsektorn. Exempelvis är bonusstrukturen på ett intervjuat bolag till 90 procent baserat på kortsiktiga ekonomiska variabler. Om energieffektiviseringsåtgärder ökar kostnaden kortsiktigt på grund av installationskostnader leder det till minskade incitament för projektchefen att genomföra energieffektiviseringsåtgärder som medför en högre kostnad. Ett annat exempel från ett företag är att under rådande incitamentstruktur får anställda bonus efter hur snabbt de bygger, inte slutproduktens kvalitet. Det finns dock exempel på bonussystem som ger incitament för att genomföra energieffektiviseringsåtgärder. Företaget i fråga har gjort detta genom att sätta bonus efter driftsnettoresultat som i sin tur påverkas av byggandens energiförbrukning. Ett fåtal intervjupersoner har även uppgett lönsamhetskrav som ett potentiellt. Det vittnas även om att energieffektiviseringsåtgärder konkurrerar om tillgängligt kapital med interna projekt såsom nybyggnationer. Det finns exempel där energieffektiviseringsinvesteringar konkurrerar med andra investeringar i hela den globala koncernen ur ett lönsamhetsperspektiv. Detta agerande kan många gånger vara rationellt för att maximera företagets nytta, dock är det ett för energieffektiviseringsåtgärder. Ett annat fastighetsbolag är just nu i en expansiv fas gällande nybyggnationer. Problemet med konkurrens om resurser framkom även under expertpanelen. Det är oklart hur målet att minska bostadsbristen kan förlikas med behovet av att genomföra energieffektiviseringsåtgärder. Ytterliggare ett exempel av hur lönsamhetskrav påverkar energieffektivitet härrör från ett byggföretag där bristande kunskap om lågenergihus inom både företagets försäljningsenhet samt banken medför att båda dessa aktörer ökar marginalerna. Detta i sin tur leder till en förvrängd bild över lågenergihusets kostnad. Energimyndigheten (2010) bekräftar avsaknad av kunskap bland upphandlare, genomförare och utvärderare om beräkningsmodeller, metoder och analyser för energieffektiviseringsåtgärder vid större renoveringar. 159 Vidare argumenterar Fastighetsägarna (2010) att det råder bristande kunskap bland många mindre fastighetsägare om hur lönsamhetsberäkningar av energieffektiviseringsåtgärder bör genomföras. 160 Dessa problem är nära relaterade till aktörers kortsiktiga ekonomiska perspektiv. Även om bilden är heterogen så finns indikationer på att företag har börjat tänka mer långsiktigt kring energieffektiviseringsfrågor. Företagens krav på lönsamhet varierar både mellan och inom företag beroende på investeringens art, omfattning och kostnad. Exempelvis skiljer tidshorisonten sig åt mellan nyproduktion och renovering av nuvarande bestånd, generellt från 1-10 år och år. Diskonteringsräntan bland företag och projekt skiljer sig även åt, mellan 4 15 procent. En försvårande faktor för att räkna ut lönsamheten för enskilda energieffektiviseringsprodukter eftersom företag ofta genomför flera åtgärder samtidigt. Exempelvis installeras varmvattenmätning samtidigt som varmvattencentralen byts ut. Detta försvårar identifiering av sparad energianvändning per åtgärd. 159 Energimyndigheten: Finansieringsinstrument för energieffektivisering, ER 2010:37, Fastighetsägarna: Så når vi de nationella energimålen bebyggelsens effektivisering, december

100 6.1.6 Finansiella Våra källor anser inte att Finansiella är ett betydande. Ingen av de intervjuade erfar att företag har svårt att få tillgång till kapital till energieffektiviseringsinvesteringar. I de allra flesta av intervjuerna som genomfördes av Fastighetsägarna (2013) ses inte finansiering av lönsamma åtgärder heller som ett problem. 161 Exempelvis angav en intervjuperson att det kommunala fastighetsbolaget lånar tillsammans med kommunen som i sin tur har en mycket god kreditvärdighet. Dock nämndes det att speciellt kommunala fastighetsbolag som ägs av en kommun med sämre kreditvärdighet kan finna det mycket svårare att låna kapital, inte minst till rimlig ränta. Ett annat problem som framfördes under expertpanelen är att byggnader i storstäder har ett högt fastighetsvärde vilket ökar möjligheterna att genomföra energieffektiviseringsåtgärder. I delar av landet där fastighetsvärdet är lågt kan de finansiella hindren däremot vara större. Det framkom även att bristande kunskap om finansiella möjligheter kan vara ett. Enligt Energimyndigheten och Boverket (2013) förekommer det även att banker och andra finansiella aktörer saknar kunskap och information om energieffektiviseringsåtgärder, vilket kan ha negativ påverkan på deras benägenhet att låna kapital till sådana investeringar. 162 Detta problem är således kopplat till Asymmetrisk information samt Transaktionskostnader Policyinstabilitet Majoriteten av intervjupersoner anser att otydlighet, ändringar i styrmedelsportföljen samt bristen på politisk stabilitet är ett avgörande då det negativt påverkar företags incitament att arbeta mer aktivt med energieffektiviseringsfrågor. Expertpanelen bedömer dock att Policyinstabilitet är ett mindre. En medlem av expertpanelen menade att skälet kan vara att företag tenderar att se att de bristande åtgärderna orsakas av externa snarare än interna faktorer. Intervjuerna indikerar att företagen framförallt känner en generell känsla av otydlighet från myndigheter angående framtida energieffektiviseringsmål och regleringar. Företagen hävdar att detta gör det svårare för dem att bedöma hur och till vilken grad de bör satsa på energieffektiviseringsåtgärder. Fyra specifika problem har uppkommit. Först finns det en uppfattning att byggregler skärps ad hoc och årsvis. Relaterat till detta problem är osäkerheten som råder kring hur EU:s direktiv om nära-nollenergibyggnader kommer att tolkas. En intervjuperson är rädd för att den svenska tolkningen med största sannolikhet inte kommer vara ambitiöst nog, framförallt då det finns en begränsad tidsram innan direktivet ska vara implementerat. Det efterfrågas därmed en tydligare och mer långsiktig målsättning där staten redovisar hur byggregler kommer att skärpas framöver. En relaterad fråga är tydligheten kring spelregler och hur förändringar kan påverka en investerings lönsamhet. Att ha tydliga spelregler anses vara extra viktigt då investeringar i flerbostadshus är långsiktiga och policyförändringar bör därmed inte förändra förutsättningarna för investeringens lönsamhet över tid. 161 Fastighetsägarna: Så når vi de nationella energimålen bebyggelsens effektivisering, Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader, ET2013:24, december

101 En intervjuperson framförde även kritik mot det kommunala särkravet då det anses skapa varierande standarder i kommuner vilket i sin tur gör det svårare för byggbranschen att pressa priser genom skalfördelar. Slutligen framförs även kritik mot policyinstabiliteten inom svenska styrmedel för solceller. Även om tekniken inte är en direkt energieffektiviseringsteknologi minskar dock byggnadens behov av tillförd energi. Dessutom uppfattar många intervjupersoner att solceller har ett naturligt samband med energieffektivisering Swecos samlade bedömning för flerbostadshus Nedan redovisas Swecos samlade bedömning för storleken/fördelningen av för flerbostadshus. Bedömningen är en sammanvägning av intervjuer, expertpanel, litteratur och Swecos inhouse-kunskap. Fördelningen visas grafiskt i Figur 36 följt av en kort sammanfattning för respektive bedömning i den efterföljande texten. Som Figur 36 visar är fördelningen relativt jämn mellan hindrens storlek. Figur 36: Fördelning av för flerbostadshus 10% 15% 12% 18% Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader Begränsad rationalitet Organisatoriska 15% 14% 16% Finansiella Policyinstabilitet Källa: Sweco, 2014 Asymmetrisk information bedöms totalt till 12 procent och värderas därmed inte vara ett avgörande då det idag vanligtvis är den aktör som har störst möjlighet att påverka energianvändningen även betalar energikostnaden (fastighetsägaren betalar generellt sett värmen, de boende betalar generellt sett el). Det förekommer dock ändå en del former av Asymmetrisk information, speciellt vad gäller Delade incitament mellan den som bygger en fastighet och den aktör som sedan kommer at äga fastigheten under driftskedet. 19 december

102 Energikostnaderna uppkommer under driftskedet vilket innebär att ett företag som bygger, och inte kan ta betalt för högre energiprestanda, inte kommer at ha incitament att bygga energieffektivt. Kunskap och osäkerhet kring ny teknik bedöms totalt till 18 procent och värderas därmed som ett väsentligt. Orsaken till detta är främst långa ledtider och osäkerhet kring byggföretagens ansvar att tekniken ska hålla utlovad prestanda. Transaktionskostnader bedöms totalt till 16 procent och värderas därmed vara ett väsentligt. Intervjupersonerna själva, som kommit långt i sitt energieffektiviseringsarbete och har därmed mindre Transaktionskostnader, anser att hindret är mindre allvarligt. Expertpanelen däremot menar att många fastighetsföretag idag saknar kunskap och resurser att lägga på energieffektiviseringsarbete. Begränsad rationalitet bedöms totalt till 14 procent och anses därmed vara ett betydande, orsakat av bristande engagemang för, samt kunskap om, energieffektiviseringsåtgärder som i sin tur leder till suboptimala beslut. Både expertpanel och intervjupersoner lyfte även att Begränsad rationalitet hos de boende kan ha negativ inverkan på energieffektivitet. Notera dock att det som ibland kan uppfattas som Begränsad rationalitet egentligen handlar om olika preferenser. Organisatoriska bedöms totalt till 15 procent och värderas därmed vara ett stort. De sätt intervjupersoner och expertpanel framhöll att Organisatoriska yttrar sig inom flerbostadshussektorn är framförallt bristande intern kommunikation och kunskap inom organisationer (som delvis uppkommer av geografisk spridning), företags incitamentstruktur, samt företags lönsamhetskrav och kortsiktigt ekonomiskt ägarperspektiv. Finansiella bedöms totalt till 10 procent och anses därmed vara ett mindre. De flesta intervjuade och expertpanelen framhöll att det ofta inte är ett problem att låna till energieffektiviseringsåtgärder, eftersom fastigheter är en god säkerhet och energieffektiviseringar dessutom vanligtvis höjer fastighetens värde. Hinder såsom företags tidshorisont för att räkna av energieffektiviseringsåtgärder, höga diskonteringsräntor samt bristande tillgång till kapital sorteras främst under Organisatoriska. Dock kan brist på kapital och svårigheter att låna till rimlig ränta utgöra faktiska Finansiella, något som framför allt förekommer i avfolkningsorter orter där fastighetsvärden sjunker. Policyinstabilitet bedöms totalt till 15 procent och värderas därmed vara ett viktigt. Den uppfattade policyinstabiliteten orsakas framförallt av uppfattningen att byggregler skärps ad hoc och årsvis samt osäkerheten som råder kring hur EU:s direktiv om näranollenergibyggnader kommer att tolkas. Sweco samt expertpanelen bedömer dock hindret vara avsevärt mindre än intervjupersonernas bedömning då tendensen av företag att se att bristande åtgärder orsakas av externa snarare än interna faktorer har tagits i beaktning. 19 december

103 6.2 Kontorslokaler Representanter ifrån företag som äger (och förvaltar) kontorslokaler har intervjuats, samt företag som bygger kontorslokaler. De flesta som intervjuats har kommit längre i sitt arbete med energieffektviseringar än snittet i branschen. En expertpanel har hållits med fokus på flerbostadshus, denna har gett viss input även till avsnittet om kontorslokaler Asymmetrisk information inklusive Delade incitament Generellt upplever de intervjuade att Asymmetrisk information och Delade incitament är ett påtagligt. De flesta uppger att deras företag har upplägget att hyresgästen betalar för elen och att värmen (och kylan) schablondebiteras. Detta kan sägas vara en bra uppdelning ur ett incitamentsperspektiv, eftersom hyresgästerna i stort kan påverka sin elanvändning och ägaren är den som till störst del har möjlighet att påverka uppvärmningen (genom byte av uppvärmningssystem, isolering etcetera). De som intervjuats är dock främst kontorslokalsägare som arbetat en del med energieffektivisering, och som således valt att ha denna uppdelning i syfte att kunna tillgodogöra sig den besparing som deras energieffektiviseringar ger upphov till. Enligt intervjupersonerna är det även vanligt förekommande att den faktiska värmeförbrukningen debiteras hyresgästen. Detta är sämre ur ett incitamentsperspektiv, eftersom hyresgästen inte nämnvärt kan påverka värmeåtgång, förutsatt att temperaturen styrs automatiskt. Till viss del kan de som upplåter sig i lokalen göra beteendeförändringar som att inte öppna fönster i onödan, men detta är ändå en mindre del i sammanhanget. Andra studier som gjorts på området bekräftar denna bild: Delade incitament vad gäller vem som betalar för energi utgör inte ett avgörande i Sverige, dock medför en viss orealiserad potential på kontorssidan. 163 En av de intervjuade framhåller dock att man inte behöver låta Delade incitament påverka så mycket. Om en energieffektivisering görs får både lokaler och bostäder en lägre energikostnad, vilket alla parter kan nyttiggöra sig om avtalsskrivningen formuleras på rätt sätt. Samtidigt lyfter Energimyndigheten och Boverket (2013) i en av sina rapporter att svårigheter med avtalskonstruktioner, avtalstid, osäkerhet om lokalens framtida användning samt avsaknad av förtroende mellan brukar och ägare gör det utmanade att utforma sådana avtal. 164 En del fastighetsägare arbetar dock idag med så kallade gröna avtal som ett sätt att engagera hyresgästen i energifrågan och få dem att reducera även elanvändningen. Som ytterligare exempel på Delade incitament uttrycker en av intervjupersonerna att man som fastighetsägare inte kan göra vilka energieffektiviseringsåtgärder som helst när som helst detta riskerar att ha negativ påverkan på hyresgästerna. Från litteratur på området framkommer även att hyresgästerna sällan har kunskap eller överblick att undersöka om det går att energieffektivisera i någon annans byggnad Sveriges Kommuner och Landsting: Miljarder skäl att spara! Lönsamma energimål i kommunala fastigheter, 2011; Energimyndigheten och Boverket: Analys av Delade incitament för energieffektivisering Med fokus på energiprestandaförbättrande investeringar, Regeringsuppdrag. Rapport 2013:32; Fastighetsägarna: Så når vi de nationella energimålen bebyggelsens effektivisering, Energimyndigheten och Boverket: Analys av Delade incitament för energieffektivisering Med fokus på energiprestandaförbättrande investeringar, Regeringsuppdrag. Rapport 2013:32, Fastighetsägarna: Så når vi de nationella energimålen bebyggelsens effektivisering, december

104 Vissa fastigheter har även extern teknisk förvaltning, vilket enligt intervjupersonerna ger upphov till Delade incitament och Asymmetrisk information. Fastighetsförvaltaren har främst intresse att hålla ner kostnaden för underhåll, och tar sig därför inte an att uppmärksamma saker och göra åtgärder i förvaltningen som har påverkan på energieffektiviteten det är ändå inte de som betalar energiräkningen. En av intervjupersonerna berättade att de när de tar över fastigheter som tidigare haft en extern fastighetförvaltning så kan de spara procent bara genom att styra driften av fastigheten på rätt sätt (rätt styr- och reglersystem). Flera av de intervjuade påtalar att det råder informationsasymmetrier mellan säljare och köpare av energieffektviserande tekniker. De menar att köpare har ett informationsunderläge, och att det är viktigt att ha beställarkompetens och kunna ställa rätt frågor. En av de intervjuade pekar på att dåliga erfarenheter kan leda till att större försiktighet nästa gång, vilket kan hindra energieffektiviseringar. En annan framhåller dock att om beställare har rätt kompetens och är tydlig råder god transparens. De intervjuade menar även att Asymmetrisk information råder mellan säljare och köpare av en fastighet. Delade incitament finns därmed i byggskedet, där de som bygger med tanke att sälja av fastigheten direkt inte väljer att bygga med energieffektiv teknik som betalar tillbaka sig i lägre energikostnader, eftersom det ändå är i förvaltningsskedet som dessa energibesparingar uppkommer. Detta beror enligt intervjupersonerna på att det är svårt att ta betalt för energieffektivitet, och om det inte går att ta betalt för något vid försäljning vinstmaximerar byggbolaget och satsar istället på sådant som syns. Exempelvis är det lättare att ta betalt för moderna vitvaror än bra isolering. Intervjupersonerna uttrycker att dessa företag ofta är långt ifrån att använda ny teknik, de använder inte ens dagens teknik utan gårdagens teknik. Detta menar de intervjuade är en stor barriär och således ett stort för energieffektivitet i branschen. Överlag går utvecklingen allt mer mot att betrakta fastigheter mer av en handelsvara än ett långsiktigt ägande. De uttrycker även att då de beställer ett bygge av en fastighet och ställer krav är det inte alltid som fastigheten når den energiprestanda som beställts, vilket ytterligare hindrar energieffektivitet. Forskning på området visar upp en samstämmig bild vad gäller Delade incitament i byggskedet av lokaler. Byggprocessen har ett antal olika aktörer: arkitekter, konsulter, entreprenörer och eventuella underentreprenörer, -leverantörer, och installatörer. Dessa olika aktörer prioriterar ofta låga investeringskostnader och inköpspriser i byggskedet, även då detta missgynnar energieffektivitet och ekonomi för aktören som betalar energi i driftskedet. 166 En skillnad mellan kontor och bostäder är att bostäder i princip alltid har varmhyra, vilket gör att fastighetsägaren kan ta del av hela besparingen för en värmeeffektivisering. Detta gör att det finns något mer Delade incitament vad gäller lokaler än fastigheter. Dock har lokaler mer affärsmässiga förhållanden, eftersom bostäder inte har fri hyressättning. Det är därför svårare att ta betalt för de investeringar som görs i fastighetshus. Det finns därför större svårigheter i flerbostadshus att vara innovativ och göra det där lilla extra, än vad det är för lokaler. Intervjupersonerna har värderat hindret Asymmetrisk information och Delade incitament högt. 166 Energimyndigheten och Boverket: Analys av Delade incitament för energieffektivisering Med fokus på energiprestandaförbättrande investeringar. Regeringsuppdrag. Rapport 2013:32, december

105 6.2.2 Kunskap och osäkerhet om ny teknik Kunskap och osäkerhet kring ny teknik är också ett som bedöms påverka. Installerade produkter i en fastighet har lång livslängd vilket ofta medför att lokalägare liksom andra fastighetsägare därför vanligtvis väljer väl beprövad teknik. Hyresgästerna värderar i första hand att allt fungerar som det ska och att de kan bedriva sin verksamhet, därmed driver dessa inte heller på att fastighetsägarna ska använda teknik i framkant. Intervjuade fastighetsägare uppger att inte heller leverantörerna är särskilt drivande i detta, samtidigt som det är dessa som ofta förser fastighetsägare med information om ny teknik. Litteratur på området bekräftar bilden av att fastighetsägare ser ny teknik som en osäkerhet och därmed en risk. Litteraturen beskriver även att de som tidigt satsar på ny teknik genererar information som innebär mindre osäkerhet och risk för efterföljande aktörer, något som minskar incitamenten att som enskild aktör vara den som först provar ny teknik. 167 Flera lyfter upp att positiva aspekter med lyckade demonstrationsprojekt då det är viktigt med referensprojekt för att våga investera i en viss teknik. Demonstrationsprojekten får dessutom gärna får vara genomförda av en oberoende part, exempelvis universitet eller myndighet, då dessa är neutrala och har högre trovärdighet än tillverkare och återförsäljare av en viss teknik. I en studie gjord av Energimyndigheten (2010) uttrycks just detta att aktörerna efterfrågar mer riktad information baserat på genomförda projekt. 168 Det skiljer sig lite åt bland de intervjuade vilka som har erfarenhet av teknikupphandlingar och inte: vissa av de intervjuade har aldrig hört talats om begreppet medan andra aktivt deltagit i teknikupphandlingsprojekt via beställargruppen Belok. Även litteratur på området lyfter upp att förekomst aven ny teknik inte innebär spridning per automatik. 169 Erfarenhet av teknikupphandlingar, deltagande eller tagit del av resultaten är enligt dessa personer något bra, eftersom det främjar ny teknik och är innovationsdrivande. Samtidigt uttrycker de att kravbilden ibland blir något för specifik vilket gör att det är svårt att sedan implementera tekniken i stor skala. En del av hindret med Kunskap och osäkerhet om ny teknik samverkar med andra. Av de intervjuade har de flesta arbetat med energifrågor, och de flesta av intervjupersonerna är således ganska långt fram vad gäller att känna till ny teknik. En av intervjupersonerna uppger sig dock inte ha tid att analysera ny teknik, något som delvis faller in under Transaktionskostnader. En annan menar att det ofta finns ett motstånd internt mot ny teknik, eftersom alla inte är insatta. Detta är delvis Organisatoriska. Intervjupersonerna uttrycker även att generellt i branschen är det inte bara kunskap och osäkerhet mot ny teknik som är ett problem, kunskapen och osäkerheten om den befintliga är ett större. De menar vidare att om branschen bara använde befintlig och välbeprövad teknik på rätt sätt skulle branschen komma långt på det. Tekniken finns, men kunskapsinhämtandet brister. Det handlar ofta om att organisationerna inte är mottagliga för mer kunskap. I dessa fall är det mer Transaktionskostnader som hindrar, snarare än något som fler tester och demonstrationsprojekt kan åtgärda. De flesta har värderat hindret kunskap och osäkerhet om ny information högt. 167 Energimyndigheten: Finansieringsinstrument för energieffektivisering, ER 2010:37, Energimyndigheten: Finansieringsinstrument för energieffektivisering, ER 2010:37, Energimyndigheten: Finansieringsinstrument för energieffektivisering, ER 2010:37, december

106 6.2.3 Transaktionskostnader De flesta av intervjupersonerna uttrycker att Transaktionskostnader inte är ett avgörande, men att det kan vara ett bidragande och att det kan dra ner energieffektiviseringsfarten. De menar att det är en naturlig del av arbetet som fastighetsägare och förvaltare att lägga tid på energieffektiv drift och att se över investeringsmöjligheter som skulle kunna öka energieffektiviteten. Energimyndigheten och Boverket (2013) uttrycker istället att det är ett påtagligt för fastighetsbranschens aktörer att hantera alla aspekter av energieffektivisering. 170 De uppger att de Transaktionskostnader (tid och eventuell ersättning för professionell hjälp) som uppstår för fastighetsägare i att hitta och tillgodogöra sig information om möjliga åtgärder och beräkna lönsamhet är en förklaring till varför energieffektiviseringar som förefaller vara lönsamma inte kommer till stånd. 171 Bilden bekräftar det de personer Sweco har intervjuat som pekar på organisationernas brist på tid och resurser, det vill säga begränsade personella resurser och ont om tid att genomföra allt det de vill. Om möjligheten fanns att genomföra allt skulle det spara lite mer energi, men troligtvis inte så mycket mer att det skulle vara värt att ta in ytterligare resurser. De intervjuade anser även att det ofta är svårt och tidskrävande att avgöra vad som är bäst av nya produkter och vad som ger bäst effekt för satsad peng. En intervjuperson berättar om när de tidigare gjort pilotprojekt med en ny teknik och valt fel typ av aktuell teknik eller fel leverantör, och att detta lett till att hela tekniken sågats internt. Intervjupersonerna uttrycker att Transaktionskostnader för vissa företag kan bli en hög tröskel, och att det därför finns ett värde med enkla verktyg för branschen i arbetar med energi. I intervjuerna nämndes även att hjulen snurrar fort i den här branschen, och att det i byggoch ombyggnadsskeden därför ibland måste fattas snabba beslut. Den tidsåtgång som krävs för att beakta energieffektivitet hinns då inte alltid med. Överlag har dock intervjupersonerna värderat hindret som ganska lågt Begränsad rationalitet Intervjupersonerna anser att Begränsad rationalitet påverkar till viss del, men inte att det är ett avgörande. En intervjuperson nämnde att om fel person sitter på fel plats händer det inte mycket. Samtidigt tror denne intervjuperson att fastighetsbranschen har kommit så pass långt att det är hög medvetenhet om tämligen stora handlingsmöjligheter.. Energimyndigheten (2010) skriver att Begränsad rationalitet yttrar sig i att aktörer inte reagerar så mycket på prisförändringar som de borde om de fullt ut vägt alla alternativ mot varandra. De skriver vidare att det finns en energieffektiviseringspotential som hindras av denna begränsade rationalitet som de främst menar kommer av kunskapsbrist. 172 Från intervjuerna framkom att okunskap kan ta sig uttryck i form av Begränsad rationalitet, och beroende på hur långt olika organisationer kommit med kunskap om energi kan upplevelsen av den begränsade rationaliteten i organisationen skilja sig åt. 170 Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader. ET2013:24, Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader, ET2013:24, Energimyndigheten: Finansieringsinstrument för energieffektivisering, ER 2010:37, december

107 En av de intervjuade berättar om att dennes organisation förr inte orkade sätta sig in i hur energi fungerade, och att de istället prioriterade vinst i närtid. Nu, sedan kunskapsnivån höjts, har det blivit helt annat fokus på energieffektiviseringar. En annan intervjuperson berättar att dennes företag ger energieffektiviseringar en högre ränta eftersom kunskapen om energi är dålig internt och dessa investeringar därför anses ha högre risk. Organisationer med god kunskap säger istället att Begränsad rationalitet inte är ett stort problem; går det att visa på en lönsam kalkyl godkänns i vart fall ett test av denna energieffektiviseringsåtgärd. Ett annat konkret exempel på Begränsad rationalitet som lyfts upp är att en organisation godkände att använda lönsamma energieffektiviseringsinvesteringar för att bära kostnaden av andra åtgärder (såsom komforthöjande), men inte var villiga att göra små extra energieffektiviserande åtgärder (med kort återbetalningstid) i samband med att en annan större renovering gjordes. Begränsad rationalitet har fått en medelhög värdering av intervjupersonerna Organisatoriska De som intervjuats har kommit längre i sitt arbete med energifrågan än branschen totalt sett. I princip svarar de intervjuade uteslutande att Organisatoriska kan vara ett stort problem, och att det är det för många fastighetsägare idag, men att de i stort överkommit dessa. Även litteratur på området bekräftar kunskaps- och resursbrister i organisationer som ett stort problem, och skriver samtidigt att detta är svårt att kvantifiera. 173 En intervjuperson berättar att han träffar många andra företagsrepresentanter och att många av dessa vill göra mer, men att de stöter i ett tak. Intervjupersonerna uttrycker att ledningens engagemang är helt avgörande för hur väl en organisation lyckas vara energieffektiva, och att utan ledningens engagemang faller allt. En av de intervjuade menar att det faktum att ledningen på dennes organisation satt ner foten och satt tuffa energieffektiviseringsmål har lett till att organisationen fått nya tankebanor, arbetssätt och att företaget satt upp kortsiktiga och långsiktiga mål. Flera intervjupersoner uttycker att Organisatoriska förut starkt bromsade energieffektivitet och att ledningens beslut att satsa på energieffektivisering nu skapat engagemang uppifrån och ner i organisationen. En lyfter även frågan om att hur organiseringen ser ut är viktigt: dennes organisation sköter själva allt ifrån förvärv och drift och är noga med att ta in olika nödvändiga kompetenser i olika skeden. Exempelvis tas driftpersonalens kompetens in redan i projekteringsskedet, för att möjligöra att beslut fattas som förbättrar under förvaltningsskedet. En annan intervjuperson säger att samordning ibland kan vara ett problem. Många projekt är igång samtidigt, och en ökad informations- och erfarenhetsöverföring internt vore gynnsamt. Intervjupersonerna anser att intern kommunikation är viktigt. Istället för att ge en hel energikartläggning till en förvaltare är de exempelvis bättre med en kort, översiktlig och tydlig energiplan. Även aktörernas begränsade kunskap vad gäller lönsamhetsberäkningar påverkar. Fastighetsägarna (2010) skriver att många mindre fastighetsägare saknar kunskap om hur lönsamhetsberäkningar gör göras, vilket leder till att energieffektiviseringsinvesteringar ibland avslås fast de kanske inte borde Sveriges Kommuner och Landsting: Miljarder skäl att spara! Lönsamma energimål i kommunala fastigheter, Fastighetsägarna: Så når vi de nationella energimålen bebyggelsens effektivisering, december

108 Intervjupersonerna skiljer sig åt mellan att värdera Organisatoriska som avgörande, medel och marginellt. Detta kan bero på att de som intervjuats generellt är duktigare än snittet, och att de som svarat utifrån sin egen organisation satt lågt och de som bedömt mer utifrån branschen i stort har svarat högt. Sammanvägt får hindret en medelhög värdering av intervjupersonerna Finansiella De intervjuade har värderat hindret Finansiella mycket lågt. De uttrycker att så länge en energieffektiviseringsinvestering visar på lönsamhet är det inte problem att få loss internt kapital eller att få låna pengar. De gånger energieffektiviseringar inte genomförs framhåller intervjupersonerna att det är företagets egna beslut och att detta beror på att företaget har prioriterat någonting annat. Fastighetsägarna (2013) når samma slutsats ifrån sin intervjustudie: kan lönsamhet för en åtgärd påvisas genomförs den, även om det innebär mer upplåning. De skriver dock att vissa små företag, exempelvis bostadsrättsföreningar ofta av principskäl inte vill låna upp mer pengar. Detta är ett psykologiskt motstånd 175, och faller därför delvis in under hindret Begränsad rationalitet. Flera av intervjupersonerna berättar dock att de tror att vissa mindre fastighetsbolag kan ha mer faktiska Finansiella. Om en lokal ligger i ett område där marknadsvärdet är lägre kan detta ytterligare försvåra möjligheten till att få lån till god ränta. En av intervjupersonerna lyfter dock att Finansiella är ett mindre idag, eftersom många företag arbetar med incitamentslösningar. Han menar att vissa företag tror att de inte har finansiella muskler att energieffektivisera, men de kan klara det genom sådana här incitamentsavtal (EPC). Vidare uttrycker han att EPC därför har en roll att spela, eftersom det ökar energieffektiviseringstakten Policyinstabilitet De intervjuade skiljer sig åt i sin uppfattning om huruvida hindret är stort eller litet. En del framhåller att osäkerheten om vad som ska komma regleringsmässigt och kostnadsmässigt påverkar viljan att vilja investera i ny teknik. De nämner ett antal exempel där osäkerhet kring framtida regleringar gjort att beslut om en investering skjutits upp eller inte blivit av. Flera av dessa exempel rör dock mikroproduktion av energi i anslutning till fastigheter, något som inte är en direkt energieffektivisering (även om det ändrar den inköpta energin till fastigheten). Ett par av de intervjuade säger att policys inte påverkar dem i deras inversteringsbeslut. En nämner att eventuella stöd mer blir som en bonus, inte det som avgör om investeringen görs eller inte. Någon annan av de intervjuade anser att hänvisningar till att Policyinstabilitet hindrar främst är ett sätt att skylla ifrån sig. Totalt sett faller hindret ut som ganska stort utifrån intervjupersonernas bedömningar. Mycket lite information om eventuell policyinstabilitets påverkan på kontorslokalers energieffektivisering har påträffats i litteraturen. Energimyndigheten (2010) nämner dock att det är viktigt att modeller för finansiering är kostnadseffektiva, stabila och förutsägbara Fastighetsägarna: Så når vi de nationella energimålen bebyggelsens effektivisering, Energimyndigheten, Finansieringsinstrument för energieffektivisering, ER 2010:37 19 december

109 6.2.8 Swecos samlade bedömning för kontorslokaler Figur 37 visar Swecos sammanvägda bedömning för hur stor del de olika hindren påverkar energieffektiviseringar i kontorslokaler. Figur 37: Fördelning av i kontorslokaler 20% 3% 7% Asymmetrisk information 25% Kunskap, osäkerhet om ny teknik Transaktionskostnader Begränsad rationalitet Organisatoriska 15% 10% 20% Finansiella Policyinstabilitet Källa: Sweco, 2014 Asymmetrisk information bedöms totalt för sektorn till 25 procent. Detta har värderats som högt, eftersom det är även vanligt förekommande att den faktiska värmeförbrukningen debiteras hyresgästen. Förekomsten av extern teknisk förvaltning skapar ytterligare Delade incitament, likaså finns Delade incitament mellan de aktörer som är involverade i byggskedet av en fastighet och den som slutligen ska äga och förvalta fastigheten. I en jämförelse mellan incitament vad gäller kontor och bostäder har bostäder mindre i form av Delade incitament, eftersom bostäder i princip alltid har varmhyra och fastighetsägaren således kan ta del av hela besparingen för en värmeeffektivisering. Kunskap och osäkerhet kring ny teknik bedöms totalt till 20 procent. Eftersom installationer i en fastighet har lång livslängd vill fastighetsägare inte riskera att något går fel, och väljer därför vanligtvis väl beprövad teknik. Denna problematik påverkar även i byggskedet. Hyresgästerna värderar i första hand att allt fungerar som det ska och att de kan bedriva sin verksamhet, därmed driver dessa inte heller på att fastighetsägarna ska använda teknik i framkant. Transaktionskostnader bedöms totalt till 10 procent. De flesta av intervjupersonerna uttrycker att Transaktionskostnader inte är ett avgörande, även om det hindrar en del. De menar att det är en naturlig del av arbetet som fastighetsägare och förvaltare att lägga tid på energieffektiv drift och att se över investeringsmöjligheter som skulle kunna öka 19 december

110 energieffektiviteten. De som intervjuats är dock främst aktörer i framkant vad gäller energieffektiviseringsarbete. Således har hindret höjts något jämfört med intervjupersonernas initiala bedömning. I bygg- och ombyggnadsskeden måste det ibland fattas snabba beslut. Den tidsåtgång som krävs för att beakta energieffektivitet hinns då inte alltid med. Begränsad rationalitet bedöms totalt till 15 procent. Från intervjuerna framkom att Begränsad rationalitet påverkar till viss del, men inte att det är ett avgörande. Okunskap kan ge sig uttryck i form av Begränsad rationalitet, och beroende på hur långt olika organisationer kommit med kunskap om energi kan upplevelsen av den begränsade rationaliteten i organisationen skilja sig åt. Intervjuerna gav dock uttryck för att fastighetsbranschen har kommit relativt långt i sitt kunskapsuppbyggande gällande energieffektivisering. En annan form av Begränsad rationalitet är att marknadens kommersiella värdering av byggnader inte alltid tar hänsyn till energieffektivitet i den mån som ett företagsekonomiskt rationellt beslutsfattande förutsätter. Organisatoriska bedöms totalt till 20 procent. De som deltagit i Swecos intervjustudie har kommit längre i sitt arbete med energifrågan än branschen totalt sett. I princip uteslutande svarar de intervjuade att Organisatoriska kan vara ett stort problem, och att det är det för många fastighetsägare idag, men att deras företag i mycket överkommit dessa. I mycket handlar det om ledningens engagemang och kunskapsuppbyggande. Kommunikation och kunskapsspridning i den egna organisationen är något som lyfts fram som potentiellt förbättringsområde. Finansiella bedöms totalt till 3 procent. Från studien framkommer att så länge en energieffektiviseringsinvestering visar på lönsamhet är det inte problem att få loss internet kapital eller att få låna pengar. I de fall åtgärden inte genomförs beror påt istället på andra prioriteringar. De vi har pratat med är främst företag som har byggnader i tätort. Att få lån till investeringar till fastigheter som ligger på landsbygden i avfolkningsorter kan vara svårare, eftersom fastighetsvärdet är lägre. Detta tros dock vara ett större för flerbostadshus, eftersom de flesta kontorslokaler ligger i tätort. Dessutom bör Finansiella vara ett mindre idag, eftersom många företag erbjuder incitamentslösningar (EPC). Policyinstabilitet bedöms totalt till 7 procent. De intervjuade skiljer sig åt i sin uppfattning om huruvida hindret är stort eller litet. Swecos bedömning är dock att det överlag inte råder så mycket Policyinstabilitet vad gäller energieffektiviseringar i lokaler. Om aktörer ändå upplever det så är detta något som bör bemötas. Det skulle kunna handla om Transaktionskostnader som kan överbyggas med kunskapsspridning. 19 december

111 6.3 Småhus Företrädare för branschorganisationer inom småhus eller företrädare för branschorganisationer inom återförsäljare till småhusägare har intervjuats Asymmetrisk information och Delade incitament Intervjupersonerna anser att Asymmetrisk information och Delade incitament är ett relativt stort inom småhussektorn. Utifrån intervjuerna har fyra exempel av Asymmetrisk information identifierats. Dessa beskrivs nedan. För det första är husens förutsättningar inte identiska, därmed är det inte säkert att en energieffektiviseringsprodukt uppnår utlovad besparing. Husägaren kan hitta schabloninformation på internet men inte rekommendationer skräddarsydda för huset. Då den genomsnittliga småhusägaren inte har stor kunskap om energieffektviseringsåtgärder har säljaren av produkter därmed ett övertag vilket enligt en intervjuperson missbrukas. Exempelvis används olika energipriser för att beräkna olika teknikers lönsamhetskalkyl. För det andra saknar säljaren av ett hus incitament att beställa en bra energideklaration när denne ska flytta. Om köparen istället betalade för energideklarationen skulle det finnas mer incitament att en bra energideklaration genomförs. Ytterliggare ett exempel på Delade incitament är hur fjärrvärmebolagen sätter sina taxor. Fjärrvärmeföretagen sätter taxorna baserat på effekt, i syfte att säkra sina intäkter. Den fasta avgiften minskar dock konsumentens incitament för att genomföra energieffektiviseringsåtgärder, eftersom det även då energieffektiviseringssåtgärder genomförs kan det bli svårt att få igen besparingen eftersom konsumenten endast kan påverka en del av sin energiräkning. Fjärrvärmebolagens taxor missgynnar även byte till värmepump med fjärrvärme som spetslast eftersom konsumenten då måste betala för att ha tillgänglig fjärrvärmeeffektuttag. Fjärrvärmebolagens prissättning är rationell utifrån deras situation och de incitament de har. Dock samstämmer inte deras incitament med de incitament småhusägaren får genom denna prissättning, vilket totalt sett missgynnar energieffektivitet. Slutligen riskerar Asymmetrisk information även uppkomma genom den nya energimärkningen av värmepumpar som införs under Om en konsument ska välja mellan två bergvärmepumpar ger inte märkningen stor vägledning då A eller A+ är de sämsta som får säljas då värmepumpar jämförs med andra uppvärmningssystem. På ett sätt är det bra att produkterna jämförs med andra uppvärmningssystem. Dock ger det bristande vägledning och kan leda till en kontraproduktiv utgång eftersom konsumenten riskerar att inte titta på energiåtgång utan bara energimärkning bland produkter som alla till synes har bra energimärkning. Dessutom påverkar installation och dimensionering mycket, och dessa aspekter framkommer inte i märkningen. Köparen har fortfarande ett informationsunderläge vad gäller dessa aspekter. 19 december

112 Slutligen påvisar även Energimyndigheten och Boverket (2013) hur det förekommer att banker och andra finansiella aktörer saknar information och kunskap om energieffektiviseringsåtgärders förväntade effekter, vilket negativt påverkar deras benägenhet att låna kapital till investeringen Kunskap och osäkerhet om ny teknik Kunskap och osäkerhet kring ny teknik anses av intervjupersonerna vara ett litet problem. De menar att det inte är småhusägares roll att ta till sig och använda sig av ny teknik, privatpersoner är ofta riskaverta och agerar mycket utifrån vad andra i deras situation gör: mun-mot-mun-metoden väger tungt. Enligt intervjupersonerna köper husägare i regel befintlig och beprövad teknik, deras val är till stor del beroende på energipriser och riskminimering. Dock finns exempel på när branschen lyckats få småhusägare att pröva nya tekniker: exempelvis har värmepumpsbranschen aktivt marknadsfört sin produkt. Detta har lett till att produkten anses vara en trygg affär bland husägare. Dock finns det osäkerhet kring passivhusteknologin samt en upplevd osäkerhet angående solcellsteknik Transaktionskostnader Intervjupersonerna anser att Transaktionskostnader är ett avgörande inom småhussektorn. Enligt intervjupersonerna har småhusägare bristande kunskap om energieffektivisering och de lägger begränsat med tid på att söka information. Energimyndigheten och Boverket (2013) speglar detta argument och lyfter komplexititeten och därmed svårigheten i att hantera alla aspekter av energieffektiviseringsåtgärder. 178 Bristen på kunskap över hur ägarna kan påverka sin elräkning är därmed ett. Boverket (2005) anser att Transaktionskostnader kan vara en anledning till att energieffektiviseringsåtgärder som förefaller privatekonomiskt lönsamma, inte genomförs. En orsak kan vara att investeringen måste kunna förväntas ge tillräckligt stora besparingar att de uppväger inte enbart investeringskostnaderna, utan även de ådragna Transaktionskostnaderna. 179 De rådande låga energipriserna gör även att det finns bristande incitament bland husägarna att söka information och agera därefter Begränsad rationalitet Intervjupersonerna anser även att Begränsad rationalitet är ett väsentligt, om än inte avgörande, inom småhussektorn. Under intervjuerna identifierades tre exempel av Begränsad rationalitet inom småhussektorn. En intervjuperson hävdar att förhastade beslut ofta tas angående produktval som har påverkan på energieffektivitet, såsom vid valet av fönster. Småhusägare påverkas även av grannars val av produkt vilket kan ses som ett exempel på Begränsad rationalitet. Dock är detta även ett sätt att minska upplevd risk och Transaktionskostnader. Det förekommer även att småhusägare inte väljer bästa teknik, utan den som anses tillräckligt bra. 177 Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader, ET2013:24, Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader, ET2013:24, Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader, ET2013:24, december

113 Detta fenomen är till viss del kopplat till Transaktionskostnader då småhusägare inte genomför tillräckligt omfattande informationsinsamling. Den tredje barriären angår hur vissa småhusägare är ovilliga att ta lån för kapitalkrävande energieffektivitetsinvesteringar även om värdet på huset ökar. Detta hör ihop med hushållens riskaversion. Hushållen har en genuin osäkerhet om framtida räntor och energipriser vilket gör att de ålägger en riskpremie på investeringen. Detta kan tolkas som en form av Begränsad rationalitet, beroende på hur hög riskpremien är. I sin tur skulle detta kunna innebära att hushållen investerar för lite i energieffektivitetsåtgärder. Dock indikerar Energimyndigheten och Boverket (2013) att det kan vara svårt för bostadsägare att få tillräcklig avkastning för energieffektiviserande åtgärder vid försäljning av småhus. 180 En intervjuperson anser att fler argument behöver framföras angående fördelarna med energieffektiviseringsåtgärder för att öka husägarnas incitament att genomföra sådana åtgärder Finansiella Intervjupersonerna anser att Finansiella är ett relativt stort inom småhussektorn även om en intervjuperson anger att det generellt sett går att få lån för energieffektiviseringsåtgärder för hus som befinner sig storstadsområden och växande kommuner. Dock är det svårt att få lån för energieffektiviseringsåtgärder för hus med lågt taxerings- och marknadsvärde, som vanligtvis finns i glesbygdsområden. De som precis har köpt sitt första hus kan även ha svårt att få lån då de ofta har belånat sig till en hög grad och därmed har mindre möjlighet att ta fler lån för energieffektiviseringsåtgärder. Ett relaterat möjligt som identifierats av Energimyndigheten och Boverket (2013) är att låntagare inte kan beskriva en energieffektiviseringsåtgärds lönsamhet för långivaren, ett som är nära relaterat till Transaktionskostnader och Begränsad rationalitet Policyinstabilitet Policyinstabilitet anses av intervjupersoner vara ett relativt litet problem. Följande två problem har identifierats. Först finns det en osäkerhet över hur framtida politiska målsättningar kommer vara utformade. Det andra problemet är den intermittenta finanseringen och den osäkra regleringen av teknikspecifika styrmedel vilket ökar osäkerheten och risken för de hushåll som överväger att investera i exempelvis solceller. Historiskt finns exempel på start-stopp vad gäller bidrag till energieffektiviserande tekniker till hushåll. Detta får bland annat konsekvensen att småhusägare ibland avvaktar med lönsamma energieffektiviserande åtgärder, vilket leder till en ojämn försäljning av olika energieffektiviserande produkter på marknaden. Det framgick även kritik mot teknikspecifika styrmedel bland de intervjuade, istället förordrades teknikneutrala sådana. 180 Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader, ET2013:24, Energimyndigheten och Boverket: Förslag till nationell strategi för energieffektiviserande renovering av byggnader, ET2013:24, december

114 6.3.7 Swecos samlade bedömning för småhus Nedan redovisas Swecos samlade bedömning för storleken/fördelningen av för småhus. Bedömningen är en sammanvägning av intervjuer, expertpanel, litteratur och Swecos inhousekunskap. Fördelningen visas grafiskt i Figur 38 följt av en kort sammanfattning för respektive bedömning i den efterföljande texten. Figur 38: Fördelning av för småhus 15% 0% 10% 15% 10% Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader Begränsad rationalitet Organisatoriska 20% 30% Finansiella Policyinstabilitet Källa: Sweco, 2014 Asymmetrisk information bedöms totalt till 15 procent och värderas därmed som ett relativt stort. Detta beror främst på att många småhusägare har begränsad kunskap om energifrågan, och således har svårt att värdera information och erbjudanden ifrån försäljare av energieffektiv teknik: säljaren har ett kunskapsövertag gentemot köparen. Kunskap och osäkerhet kring ny teknik bedöms totalt till 10 procent. Swecos bedömning av hindrets storlek är därmed högre än intervjupersonernas uppfattning av hindrets storlek. Intervjupersonerna lyfte att småhusägare i regel köper befintlig och beprövad teknik. Enligt Swecos bedömning finns det dock en upplevd osäkerhet kring beprövad teknik som inte har spridits i tillräcklig grad bland småhusägare. Dessutom är det ett för energieffektiviseringar att småhusägarna inte i högre utsträckning vill prova ny energieffektiv teknik, även om det är förståerlit utifrån deras riskaversion. 19 december

115 Transaktionskostnader bedöms totalt till 30 procent. Swecos bedömning av hindrets storlek är därmed högre än intervjupersonernas uppfattning av hindrets storlek. De intervjuade anser dock att hindret är väsentligt på grund av den bristande kunskap om energieffektivisering bland småhusägare och den otillräckliga tid som spenderas för att söka information om ämnet. Dock har de intervjuade lagt en enligt vår bedömning alltför stor vikt på hindret Begränsad rationalitet i viktningen av. Därmed har vikten av hindret Transaktionskostnader blivit uppvärderad. Begränsad rationalitet bedöms totalt till 20 procent och anses därmed vara ett väsentligt, om än inte avgörande,. Enligt intervjupersonerna tar småhusägare ofta förhastade beslut angående val av energieffektiviseringsprodukt. Det framkommer även att småhusägare tenderar att nöja sig med en teknik som är bra nog, och således indirekt välja bort den mest lämpliga tekniken. Detta är kopplat till undvikande av Transaktionskostnader. Slutligen förekommer det en ovilja att ta lån för kapitalkrävande energieffektiviseringsinvesteringar. Swecos bedömning av hindrets storlek är dock något lägre än intervjupersonernas uppfattning av hindrets storlek på grund av den orsak som nämns ovan i stycken om kunskap och osäkerhet kring ny teknik. Organisatoriska bedöms totalt till 0 procent då Sweco anser att detta inte är relevant att beakta inom sektorn. Finansiella bedöms totalt till 15 procent och värderas därmed vara ett relativt stort. För småhusägare i storstadsområden och växande kommuner anses det dock inte vara ett problem att få lån. Småhusägare vars bostad har ett lågt taxerings- och marknadsvärde har dock svårare att få tillgång till kapital. Även förstagångsköpare av bostad kan även ha svårt att få tillgång till kapital på grund av deras ofta höga belåningsgrad. Policyinstabilitet bedöms totalt till 10 procent och värderas därmed som ett relativt litet problem. Dock finns det en osäkerhet över hur framtida statliga målsättningar kring energieffektivisering kommer vara utformade. Även den intermittenta finansieringen och den osäkra regleringen av teknikspecifika styrmedel ökar osäkerheten och därmed benägenheten att investera i energieffektiviseringsåtgärder. 19 december

116 6.4 Energiintensiv industri Ett antal aktörer inom sektorn energiintensiv industri har intervjuats. Utöver detta har även en expertpanel hållits med ett antal personer som har mer systemövergripande kunskap om sektorn energiintensiv industri Asymmetrisk information inklusive Delade incitament Asymmetrisk information i form av Delade incitament upplevs generellt inte som ett stort inom den energiintensiva industrin. Flera intervjupersoner uppger att Asymmetrisk information inte påverkar ambitionen att energieffektivisera. En förklaring till detta är att den energiintensiva industrin i stor utsträckning äger och sköter sina egna lokaler, infrastruktur, industriområden och liknande. Delade incitament kan dock uppstå i vissa fall där man har outsourcat fastighetsrelaterad drift och underhållsverksamhet där till exempel en entreprenör sköter ventilationen och bara har incitament att hålla nere serviceinsatser och inte energianvändning. Detta berör ofta endast kontorslokaler. Av den totala energianvändningen är endast några få procent i kontoren så även om ventilationen är procent av kontorens energianvändning, syns detta inte i energianvändningen. Delade incitament kan även förekomma mellan företag och andra typer av underentreprenörer. Intervjupersoner uppger att man löser detta genom att ställa rätt krav i inköpsprocessen. Man måste veta vilka krav man ska ställa och ge rätt incitament till entreprenören. En medvetenhet finns så detta är inget stort. Ifrån litteratur inom området framkommer dock att Delade incitament och andra former av Asymmetrisk information kan hindra kostnadseffektiva åtgärder inom industrin. 182 I de fall företagen inte äger sina lokaler saknas incitament för investeringar som sänker företagets energianvändning och driftkostnader. 183 För företag inom den energiintensiva industrin som har en mer systemorienterad samverkan med andra externa aktörer kan Delade incitament vara ett större. Som exempel kan nämnas när ett energibolag äger en produktionsanläggning och både köper och säljer energi till en industri. Energibolaget vill få en bra utnyttjandegrad på sin anläggning vilket kan medföra att restenergier från industriföretaget inte utnyttjas i den utsträckning som skulle kunna vara systemmässigt optimalt. Ett annat exempel är när det finns ett utvecklat samarbete mellan en industri och ett lokalt fjärrvärmebolag. Dessa avtal har ofta baserats på att industriföretaget levererar sin restenergi till ett lågt pris till fjärrvärmebolaget. Fjärrvärmebolaget får sedan ofta ut betydligt mer av sina kunder än inköpspriset från industriföretaget en intervjuperson nämner att det i deras fall rör sig om fem gånger så mycket. Det låga priset gör att industrin inte vill öka denna leverans om de inte kan få bättre betalt. Har fjärrvärmeföretaget dessutom en politisk ägare med mål att ha låga fjärrvärmepriser skapas begränsningar i pris och avtal mellan parterna. När industrin sen energieffektiviserar drabbar det fjärrvärmebolaget genom mindre leveranser av restenergi. Det vägs dock till stor del upp av en förväntad energieffektivisering av fastigheter i området. 182 Thollander, Ottosson: Energy management practices in Swedish energy-intensive industries, IVA: Energieffektivisering av Sveriges industri: Hinder och möjligheter att nå en halverad energianvändning till 2050, Ett arbete inom IVAs projekt Ett energieffektivt samhälle, december

117 Systemsamverkan mellan industriföretag och det omgivande samhället pekas ut som ett område där det finns mycket att göra för att öka energieffektiviteten i ett systemperspektiv Kunskap och osäkerhet om ny teknik Kunskap och osäkerhet om ny teknik uppges i intervjuerna och av expertpanelen som ett stort. Även om det inte är det största hindret är det ändå ett avgörande. Inom industrin vet man alltid vad man har. Produktionen kör timmar om året. En stopptid om 200 timmar om året kostar flera miljoner. Sen tillkommer dessutom risken för vite mot kunder för uteblivna leveranser. Även om man kan spara tiotals miljoner om året genom ny och energieffektivare teknik i delar av tillverkningsprocesserna är det en risk som skapar osäkerhet om ny teknik och om den fungerar som förväntat. Här är demoprojekt och referensinstallationer exempel på åtgärder som efterfrågas för att industriföretag ska våga implementera ny teknik. Ibland är det även ett att företaget som erbjuder produkten är för litet och har för små ekonomiska muskler för att kunna ta ett ekonomiskt ansvar om tekniken inte fungerar. Industrin ställer sig generellt alltid frågan Vad är risken, kan detta ställa till något i min drift? För vissa åtgärder kan man återgå till föregående teknik om det inte fungerar. Exempelvis vad gäller reglerteknik finns möjligheten att gå tillbaka till det gamla sättet att reglera om en ny reglerteknik skulle visa sig bristfällig. I de fall det handlar om åtgärder som riskerar att stoppa produktionen i flera veckor är man mer ovillig att pröva. För att minska risken för produktionsstörningar letar man ibland upp ett ställe i produktionen som är relativt okänsligt och gör en mindre demonstration. Konsekvensen blir då att man provar en teknik någonstans där den inte blir lönsam, eftersom man väljer ställe efter var det finns lägre risk och inte efter var den kan ge en stor energibesparing. Det är därefter svårt att motivera att installera den nya tekniken på andra ställen i produktionen med högre lönsamhet. Vidare finns en viss skepsis för kommersiell teknik som utvecklats inom andra områden då man ändå inte vet om det fungerar i den specifika industriella tillämpningen. Bilden bekräftas av Rohdin et al (2006) och av Brunke et al (2014): industrins aktörer uppfattar teknisk risk som produktionsstörningar, risk för kvalitétsförsämringar och potentiellt dålig prestanda på nya komponenter som mycket stora för att installera nya energieffektiv teknik. 184 En intervjuperson uttryckte lite självkritiskt Branschen är som Moskva 1948, det finns en plan på hur många ton man ska producera. Detta ska man producera oavsett. Spelar ingen roll om man kan kränga det eller inte. Det är den starkaste drivkraften till att minimera risken för stora produktionsproblem. Det är ett stort att ta sig över tröskeln att våga riskera att stoppa produktionen. Här krävs det att det finns något test innan som verifierar att utrustningen fungerar i processen. Hjälp- och stödprocesser kan vara lite enklare, men även här finns en utvecklad riskmedvetenhet. 184 Brunke, Johansson, Thollander: Empirical investigation of barriers and drivers to the adoption of energy conservation measures, energy management practices and energy services in the Swedish iron and steel industry, 2014; Thollander, Ottosson: Energy management practices in Swedish energy-intensive industries, december

118 När det gäller pumpar, motorer, värmeväxlare och liknande komponenter i form av mer standardutrustning är inte osäkerheten ett så stort. Här kommer informationen industrin till del ofta genom leverantörer av utrustning. En intervjuperson uttryckte en önskan om att leverantörerna tog teknikutvecklingskostnaden. Industrin upplever att leverantörerna inte är särskilt drivande i utveckling av ny teknik samtidigt som flera intervjuade uppger att information om ny teknik kommer från leverantörerna. Men det är industrin som finansierar utvecklingen av ny teknik. Teknikleverantörerna har inte så mycket ny teknik att sälja. Den blir bättre, dock med små steg. Konkurrens på leverantörssidan är begränsad och intervjupersonerna uttrycker att det saknas incitament för leverantörerna att utveckla ny teknik. De intervjuade uppger att deras företag håller sig informerade om branschgemensamma forsknings- och utvecklingssamarbeten, dock varierar dessa lite vad gäller inriktning och således tillämpbarheten för den egna verksamheten. Teknikskiften sker inte enkelt eller av sig självt framförallt i mogna industribranscher. Intervjupersonerna uppger att det idag mest handlar om att optimera delar i processen. Vissa industriföretag är unika i Sverige i vad de producerar och hur processen är uppbyggd, vilket gör att det är ganska ensamma i sin produktutveckling i ett svenskt perspektiv. Ett exempel är järn- och stålbranschen där det i princip bara finns ett företag per specialisering Transaktionskostnader Transaktionskostnader bedöms av intervjupersoner och expertpanel vara ett men inte utmärkande högt. Flertalet av de intervjuade företagen uppger att de har relativt sett ganska få personer som jobbar dedikerat/i utpekade roller med energifrågorna. Enligt intervjupersonerna har dock en förändring skett till det bättre de senaste fem åren. De berättar att de tidigare fick arbeta med energifrågan vid sidan av sin huvuduppgift. Om man kan visa på en åtgärd med en kalkyl är lönsamt är det oftast inte svårt att få pengar till denna. Möjligtvis händer det att man skjuter upp investeringar till nästa år på grund av investerings/budgettak, men de görs generellt sett. Det som några intervjupersoner uppger är det svåra, är att få loss pengar och tid till att ens kunna utreda om en viss åtgärd har potential till lönsamhet. Flera intervjupersoner uppger att det finns brist på personer som kan prioritera sin tid till att utreda energieffektiviseringsåtgärder. Detta gör att energieffektiviseringspotentialer ofta skjuts fram eller inte blir av alls. Några intervjupersoner framhåller att Transaktionskostnader är en del i deras arbete med energifrågan att utreda möjliga åtgärder eller att genomföra åtgärder. Intervjupersonerna uppger att Transaktionskostnader är ett mindre för stora företag då man relativt sett har tillgång till mer resurser och mer kunskap. Man vet även var man kan hitta konsulter och andra externa resurser. Att leta upp möjliga leverantörer för att realisera besparingspotentialen kräver resurser. Det är alltid någon internt som anlitar konsulten, skriver avtal med mera. Dessa timmar ska alltid vägas mot något annat som denna person annars kunde ha gjort. Personal är alltid en begränsad resurs inom industrin i att det ständigt sker en prioritering. Det finns ett i 19 december

119 form av en upplevd risk lägga tid på något då man inte vet om man får något för det. Intervjupersonerna uppger att om något kräver för mycket administration kommer det vara jättesvårt att få detta att hända. Som konkret exempel ifrån tidigare studier inom energieffektiv industri på hur Transaktionskostnader kan hindra kan nämnas Rohdin et al som i sin studie påvisar att kostnaden för att skaffa sig information om energianvändning i inköpt utrustning är ett av de största hindren för energieffektivitet i gjuteribranschen. 185 Ledningens engagemang krävs för att få linjechefer att avsätta resurser för utredningar eller annat projektarbete. För att exempelvis kunna titta på ett visst energieffektiviserings-case måste du kanske få loss en operatör som sitter med utrustningen. Intervjupersonerna beskriver svårigheter med att få loss tid från en operatör. Här krävs ett tydligt stöd uppifrån/från linjechefen. Även om det sprids kunskap och information är förmågan hos företag att ta emot informationen begränsad. Även deltagande i nätverk och branschinitiativ påverkas av resursbrist. Ett stort är dock om en åtgärd eller förändring har tillståndsmässiga delar som tillkommer: Om det blir tillståndsfrågorbackar man. Man undviker att gå in i nya tillståndsprocesser om det inte är absolut nödvändigt, delvis på grund av den tidsåtgång en sådan process medför för organisationen Begränsad rationalitet Intervjupersoner anger att Begränsad rationalitet i beslut inom energieffektiviseringsområdet är ett stort. När det gäller stora saker är man duktiga på att jämföra olika alternativ, men vid mindre ersättningsåtgärder blir det mycket att man bara kör på det man alltid gjort. En av orsakerna till vad som kan upplevas som bristande rationalitet är brist på rätt kunskap för sammanhanget. Man löser det på det bekvämaste sättet som man alltid gjort. Backlund et al beskriver att det sätt Begränsad rationalitet kan ta sig uttryck inom industrin är genom att beslut inte alltid fattas på välunderbyggd information, utan istället på tumregler och tradition. De nämner att förklaringar till detta kan vara tidsbrist eller brist på lättillgänglig information. 186 I stora industriföretag finns en rad faktorer som man måste ta hänsyn till. Man ska i första hand skydda människors liv. Därefter ska rätt producerad mängd säkerställas, i rätt tid och till rätt kostnad. Energieffektiviseringar kommer längre ner i prioriteringsordningen. En intervjuperson ger ett exempel på något som skulle kunna vara Begränsad rationalitet; VD:ar på företag och nationalekonomer är bägge kunniga inom ekonomi, men ändå skiljer de sig i sin syn på i vilken grad man ska binda upp sitt kapital. Många företag har som mål att hålla ner kapitalbindningen och detta skapar begränsningar bland annat för större 185 Rohdin, Thollander, Solding: Barriers to and drivers for energy efficiency in the Swedish foundry industry, Backlund, Thollander, Palm, Ottosson: Extending the energy efficiency gap. Department of Management and Engineering, december

120 investeringar i energieffektiviserande åtgärder. Intervjupersonen frågar sig huruvida detta är ekonomiskt rationellt? Ett annat exempel på vad som skulle kunna ses som Begränsad rationalitet är effekterna av PFE. PFE gjorde att många företag valde att prioritera resurser för att arbeta med energieffektivisering. Vinsten av skatteundantaget vid deltagande i PFE har i många fall bara varit en bråkdel av den vinst företaget gjort på energieffektiviseringar som kommit till stånd som en följd av beslutet att prioritera dessa resurser Organisatoriska De personer/företag som intervjuats tillhör den del av branschen som har kommit längre än vissa andra energiintensiva industrier. Både intervjuer och expertpanelen indikerar att Organisatoriska tillhör de största hindren för energieffektivisering. Ledningens engagemang är helt avgörande för hur framgångsrik en organisation är i sitt förhållningssätt till energi och energieffektivisering och vilka potentialer som realiseras. Även i SOU 2008:25 framhålls vikten av ledarskap för att kunna nå gynnsam nivå av energieffektiviseringar. 187 Flertalet av intervjuade företag uppger att energiansvariga eller energisamordnare har ett viss inflytande på beslut och prioriteringar av energieffektiviseringsåtgärder. Exempelvis kan det handla om att ha en plats i företagets inversteringsgrupp eller ett formaliserat forum där produktion och underhåll möts och pratar ihop sig. Den lokala fabrikschefen är en nyckelperson i energieffektiviseringsarbetet. Det spelar stor roll hur denne väljer att prioritera olika insatser för att skapa så mycket nytta/värde som möjligt inom den budget som står till buds och nå sina mål. spelar kunskapsuppbyggnaden och motstridiga budgetintressen in. En intervjuperson beskriver att säkerhet är den främsta prioriteringen, därefter kvalité och sedan leveransförmåga. Kostnader kommer som nummer tre och av dessa kostnader prioriteras ofta energi först. Detta eftersom energi är den största kostnadsposten och dessutom tros stiga med tid. En annan intervjuperson pekar på att man har olika prioriteringar inom företaget. Generellt sett går kapacitetshöjande åtgärder före energirelaterade åtgärder. Rohdin et al (2006) tar upp problemet med brist på budgetfinansiering för energieffektiviseringar och att andra investeringar prioriteras som för energieffektivisering. I gjuteribranschen uppges dessa vara några av de främsta hindren. 188 IVA (2013) lyfter även andra former av Organisatoriska som hindrar energieffektiviseringar, såsom Delade incitament internt vad gäller budgetposter. Detta kan komma av att drift- och underhållsbudget respektive investeringsbudget är olika ansvarsområden, vilket även hör ihop med att ekonomiska kalkyler inte tar hänsyn till att livscykelkostnader och investeringskostnader sorteras i olika delar av ekonomisystemet SOU 2008:25: Ett energieffektivare Sverige, Rohdin, Thollander, Solding: Barriers to and drivers for energy efficiency in the Swedish foundry industry, IVA: Energieffektivisering av Sveriges industri. Hinder och möjligheter att nå en halverad energianvändning till 2050, Ett arbete inom IVAs projekt Ett energieffektivt samhälle, december

121 Thollander & Olsson (2010) framhåller vidare att otillräcklig spridning av kunskap internt i en organisation ytterligare kan hindra energieffektiviseringar kommer till stånd. 190 Organisatoriska finns såsom alltid i företag. Exempel på detta kan yttra sig i hur olika ledare fokuserar på energifrågan och hur medarbetare agerar utifrån vad som efterfrågas av dem. Beteendefrågorna är ofta viktiga, men ibland eftersatta, frågor att arbeta med. Detta kan exempelvis handla om att olika operatörer kör processen på olika sätt och det ger olika energiförbrukning. Tekniklösningarna ses ofta som ett enklare sätt att energieffektivisera. Organisatoriska och Transaktionskostnader hänger ihop. Det kräver att organisationen är beredd att ta transaktionskostnaden för att bygga upp kunskap. Det gäller även att bygga upp struktur så det finns på rätt personer som är trovärdiga på rätt ställe. Exempelvis när någon längre ner i organisationen vet något men informationen saknas på ledningsnivå kan detta leda till att det görs felaktiga investeringar och suboptimeringar. Sättet en organisation väljer att besluta kring budget och investeringar kan utgöra för energieffektiviseringar. Då detta främst är en fråga om ledning och prioriteringar sorteras detta in under Organisatoriska. Majoriteten av intervjuade företag har en separat budget för åtgärder och investeringar för energieffektivisering. I regel har energieffektiviserande investeringar samma krav på ränta och återbetalningstid som andra investeringar. Återbetalningstiderna varierar något mellan de intervjuade företagen men har överlag blivit kortare efter finanskrisen En typisk återbetalningstid ligger på max tre år men ofta ner mot ett år. Någon förde fram att för att få fler energieffektiviseringar att komma till stånd bör man kanske särbehandla energieffektiviseringar och ge dem tillåtelse att ha längre återbetalningstid än andra projekt. Men detta kan ju i sig också ses som Begränsad rationalitet om företaget inte ser andra non energy benefits Finansiella Finansiella anges som det minsta hindret i intervjuer och som det största av expertpanelen. Inom den energiintensiva industrin, som generellt är kapitalintensiv, finns konstant en knapphet av resurser oavsett om de är personella eller finansiella. Större industriföretag kan uppleva en faktisk brist på kapital men många gånger kan det handla om att investeringsbudgeten är slut, vilket inte nödvändigtvis är synonymt med brist på tillgång till kapital för företaget. Denna bild bekräftas av befintlig litteratur på området: den upplevda bristen på kapital till energieffektiviseringar är stor, men många gånger handlar det om att energieffektiviserande investeringar inte prioriteras. 191 Ofta handlar det om att företagsledning och ägare inte vill binda kapital, delvis en effekt av krisen 2008/2009 och man känner av risken för att binda 190 Thollander, Ottosson: Energy management practices in Swedish energy-intensive industries, Backlund, Thollander, Palm, Ottosson: Extending the energy efficiency gap. Department of Management and Engineering, 2012; Rohdin, Thollander, Solding: Barriers to and drivers for energy efficiency in the Swedish foundry industry, december

122 upp kapital och inte bli av med avskrivningar. Att hålla nere kapitalbindningen är en del av företagets risk management och inte specifikt kopplat till energieffektiviserande investeringar. Det händer även att man bantar investeringsbudgeten, så att man inte ens kan göra lönsamma investeringar i huvudverksamheten. Ibland beror detta på faktiska Finansiella. Sviker marknaden och priserna pressas sjunker intjäningen vilket ger att investeringar begränsas och prioriteras hårdare. Från intervjuerna framgår att det finns en skillnad i företagens typ av ägare börsnoterat, privat ägare eller statlig ägare, men det som påverkar tillgång till kapital/finansiering för lönsamma energieffektiviseringar är i första hand hur företaget går rent ekonomiskt och dess samlade finansiella ställning. I vissa fall är det nog så att begränsningar i budgetar och liknande mer handlar om en organisatorisk styrning än en faktisk brist på kapital Policyinstabilitet Både intervjupersoner och expertpanelen har värderat hindret Policyinstabilitet som relativt högt. I vissa fall exemplifieras det med osäkerhet om energiskatter på olika bränslen. I andra fall med skatter och osäkerheter som inte har en direkt koppling till energieffektivisering som elcertifikat och energipriser men som bidrar till att skapa en totalupplevelse av policyinstabilitet. En intervjuperson beskriver det som att i det lilla dagliga energieffektiviseringsarbetet hindrar inte Policyinstabilitet så mycket, men de större greppen hindras. Från beslut till drift är det kanske två år och då kan det hinna ändras i regering och riksdag speciellt om ett valår infaller under tiden. En sak som beskrivs av flera intervjupersoner och kan hindra energieffektiviseringsåtgärder är miljötillståndfrågan. Man genomför inte gärna energieffektiviseringar som inte ryms inom miljötillståndet. Detta eftersom miljötillståndsprocesser tar mycket tid och resurser i anspråk, samtidigt som utfallet upplevs som osäkert. Det krävs en stor investering (ofta i produktion) för att motivera att en miljöprövningsprocess dras igång. Flera personer och expertpanelen framför att den upplevda osäkerheten ibland är större än den faktiska. Det som rör energi blir lätt politiskt och känslomässigt. Några intervjupersoner lyfter att det mesta vad gäller policier faktiskt är rätt långsiktigt och stabilt. Beslutsfattande kan dock påverkas av den upplevda risken för policyinstabilitet. Någon uttryckte det som att det vanligaste beslutet när det gäller större investeringar är att inte göra något alls om man är osäker på policier och prisers utveckling framöver. Utsläppshandelns framtid och elcertifikatens utformning lyfts fram av flera. Dessa påverkar elpriset, och har således en indirekt koppling till energieffektiviseringar. För vissa branscher, såsom pappers-massa kan även elcertifikatets utformning påverka företagets totala energieffektivitet. 19 december

123 6.4.8 Swecos samlade bedömning för den energiintensiva industrin Nedan redovisas Swecos samlade bedömning för storleken/fördelningen av för den energiintensiva industrin. Bedömningen är en sammanvägning av intervjuer, expertpanel, litteratur och Swecos inhousekunskap. Fördelningen visas grafiskt i Figur 39 följt av en kort sammanfattning för respektive bedömning i den efterföljande texten. Figur 39: Fördelning av i den energiintensiva industrin 15% 5% 20% Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader 15% Begränsad rationalitet 10% Organisatoriska Finansiella 20% 15% Policyinstabilitet Källa: Sweco, 2014 Asymmetrisk information bedöms totalt för sektorn till 5 procent. Hindret är inte stort då industriföretagen oftast äger sina egna lokaler. Delade incitament förekommer i viss utsträckning med leverantörer och entreprenörer samt vid samarbeten med andra aktörer vid till exempel restenergiförsäljning. Detta är delvis även Transaktionskostnader. Kunskap och osäkerhet kring ny teknik bedöms totalt till 20 procent. Huvudargumentet för den höga värderingen relaterar till hur högt industrin värderar risk för produktionsstopp. Det rör sig ofta också om investeringar med lång livslängd så man vill verkligen veta att ny teknik fungerar. Från expertpanelen framkom att industrin inte efterlyser grundforskning utan ny teknik som är verifierad att den fungerar. Transaktionskostnader bedöms totalt till 10 procent. Det stora flertalet av företag jobbar med energieffektivisering men inom hela sektorn varierar det både mellan olika företag och olika personer i ett företag. Det är ett visst mått av personberoende och ofta är Transaktionskostnader ett i praktiken. Stora företag är medvetna om 19 december

124 Transaktionskostnader och har varit tvungna att överkomma dem i viss utsträckning. Tillsättandet av energisamordnare och energiansvariga som kan jobba med energieffektiviseringsfrågor på heltid minskar Transaktionskostnader. Begränsad rationalitet bedöms totalt till 15 procent. En koppling kan göras till hur mycket som tillåts bli personberoende eller hur mycket som finns säkrat i ett energiledningssystem. En stor andel (kan vi ange mer exakt?) av företagen inom energiintensiv industri har infört energiledningssystem i samband med deltagandet i PFE. Organisatoriska bedöms totalt till 20 procent. Organisatoriska minskar genom att stora energiintensiva industrier har resurser att lägga på energifrågan. Dock motverkas det av att stora organisationer ofta har större svårigheter med informationsöverföring och mer Delade incitament internt, Att många större företag har krav på kvartalsrapportering påverkar också. Finansiella bedöms totalt till 15 procent. Delar av Organisatoriska, såsom motstridiga budgetposter, kan ha sorterats in här av intervjupersoner och expertpanel. Finansiella kan vara ett problem på grund av dyra investeringar, brist på pengar, dålig lönsamhet etcetera. Samtidigt ska man hålla i minnet att alla energieffektiviseringar inte behöver kräva stora investeringar utan man kan komma långt med beteendeförändringar och utvecklad styr- och reglerimplementering. Policyinstabilitet bedöms totalt till 15 procent. När större investeringar görs handlar det ofta om livslängder/avskrivningstider på minst 20 år och man vill vara säker på att räkna hem dem. En kritisk parameter i dessa investeringskalkyler är energipriset och eventuella tillkommande skatter, vilket kopplar till policyåtgärder som kan påverka energipriserna. Många stora industriföretag har lobbyister/personal på heltid i Bryssel för att de upplever att detta behövs. Flera är del av internationella koncerner, varför även utländsk Policyinstabilitet kan öka den svenska verksamhetens upplevelse av Policyinstabilitet i sina värderingar. För mindre företag är Policyinstabilitet ett något mindre då de ofta är mer flexibla och snabbare kan anpassa verksamheten till nya förutsättningar. 19 december

125 6.5 Övrig tillverkande industri Representanter ifrån både stora och små företag inom övrig tillverkande industri har intervjuats. Två representanter för energieffektiviseringsföretag har även intervjuats, i syfte att fånga dessas uppfattning om energieffektiviseringar i branschen. Utöver detta har även en expertpanel hållits där bedömningar gjorts Asymmetrisk information inklusive Delade incitament De flesta intervjupersoner uppger att de själva äger sina lokaler, och att de därför betalar för energi samtidigt som de har möjlighet att påverka energiåtgången. Eftersom de själva har incitament att göra energieffektiviseringar i byggnaderna (och givetvis även i processerna) menar de att Delade incitament och Asymmetrisk information inte råder, och har därför värderat hindret som mycket lågt. Ett fåtal undantag där lokaler hyrs finns dock bland intervjupersonerna. Även intervjupersonerna ifrån energieffektiviseringsföretagen säger att det förekommer att industrilokaler hyrs. Ingen statistik har hittats rörande hur fördelningen av att äga respektive hyra lokaler inom industrin ser ut, dock kan sägas att det är något mer vanligt förekommande att hyra inom övrig tillverkande industri än inom energiintensiv industri. 192 Något företag lyfte även upp att det är en totalt avskild del av koncernen som äger industrilokalerna, och att detta skapar Delade incitament mellan företagets olika delar. Detta sorteras i denna studie dock in under Organisatoriska, eftersom det handlar om Delade incitament internt. Intervjupersonerna lyfter att då industrilokaler hyrs saknas incitament att ta tillvara på överskottsvärme genom värmeåtervinning, att optimera ventilationssystemet samt att se till att styr- och regler fungerar på ett energieffektivt sätt. De menar vidare att det är svårt att utforma affärsmodeller för att komma åt detta. Även IVA (2013) framhåller att när industriföretag hyr saknar fastighetsägaren incitament för investeringar som sänker företagets energianvändning och driftkostnader. 193 De flesta intervjupersonerna uppger att Delade incitament är att faktiskt för de som hyr, men att det ändå har begränsad påverkan jämfört med andra. Totalt sett har intervjupersonerna värderat hindret som mycket lågt, de allra flesta har värderat det som det minsta hindret av alla. En representant ifrån ett energieffektiviseringsföretag anser att företag ofta skyller på Delade incitament när det egentligen handlar om Organisatoriska. Samtidigt finns det anledning att misstänka att det ibland kan finnas en tendens att undervärdera betydelsen av Delade incitament: Av de som uppger att de hyr lokaler svarar ett par (små aktörer) att de inte tror att detta leder till Delade incitament, men att de inte tänkt på saken. Deltagarna på expertpanelen har värderat hindret Asymmetrisk information och Delade incitament högre än vad intervjupersonerna gjort. Expertpanelen har inte enbart sett till kontorslokalerna och huruvida de hyrs eller inte. Istället lyfter de även problematik såsom Asymmetrisk information mellan industriföretag och energieffektiviseringsföretag och att bristande systemsyn och samarbete mellan aktörer hindrar framtagandet av mer energieffektiv teknik. 192 Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten IVA: Energieffektivisering av Sveriges industri. Hinder och möjligheter att nå en halverad energianvändning till 2050, Ett arbete inom IVAs projekt Ett energieffektivt samhälle, december

126 De menar att energieffektiviseringsföretag har ett kunskapsövertag gentemot köparen av energitjänsten vad gäller åtgärder, medan företaget som köper tjänsten samtidigt har ett kunskapsöverta vad gäller processer och beteende. Det innebär även en principal-agentsituation, där energieffektiviseringsföretaget har svårt att studera beteendet hos industriföretaget. Tillsammans med ytterligare försvårande omständigheter som osäkerhet över framtida utomhustemperatur och produktionsmängder så leder detta till dålig transparens och bristande tillit. Detta är således något som hindrar att fler energieffektiviseringar kommer till stånd. Expertpanelen anser att detta är ett än större för små industriföretag, eftersom stora företag har bättre beställarkompetens och större volymer vilket ger ett bättre förhandlingsläge gentemot alla leverantörer. Expertpanelen lyfter även att framtagandet av ny teknik, processer och samverkansmodeller behövs, men att det krävs systemsyn och samarbete mellan aktörer för detta. Asymmetrisk information (i form av ojämnlik kunskapsfördelning och dålig transparens) mellan aktörer, Delade incitament och svårigheter att skriva kontrakt gör att detta inte sker i önskvärd utsträckning. Det kan även bero på Transaktionskostnader: i vissa fall vet aktörerna vad som skulle kunna göras men dessa orkar inte med allt arbete en sådan samverkan skulle kräva Kunskap och osäkerhet om ny teknik De flesta av intervjupersonerna har värderat hindret Kunskap och osäkerhet om ny teknik som lågt eller medel. De menar på att det har ganska bra koll på ny teknik, och att i de fall denna inte används beror det främst på andra. Samtidigt lyfter en intervjuperson att det ligger i sakens natur att man inte vet vad man inte vet. Den information om ny teknik som företagen nås av kommer främst ifrån leverantörer och andra företag i branschen, flera intervjupersoner trycker på vikten av att ha leverantörs- och branschföretagskontakter som de kan lita på och ha utbyte med. Några intervjupersoner uttrycker dock att företagen är ovilliga att ändra på processer som fungerar, och att den upplevda risken för produktionsstopp eller försämrad kvalitet gör att branschen satsar på säkra kort. Således är företagen mer villiga att energieffektivisera delar som inte rör huvudprocessen. Vad gäller icke-energiintensiv industri finns dock stora delar av energianvändningen i stödprocesser, något som gör att en mindre del av den procentuella energieffektiviseringspotentialen hindras av riskaversion än vad det gör för den energieffektiva industrin. Från litteratur på området framkommer att kunskap för övrig tillverkande industri vad gäller energieffektiviseringar och dess fördelar ibland är låg, vilket kan göra att den upplevda risken blir stor. 194 Av de intervjupersoner som är familjära med begreppet teknikupphandling uttrycker sig de flesta positivt och anser att det är ett förhållandevis enkelt sätt att få marknaden att ta fram bättre produkter. En majoritet av intervjupersonerna uttrycker sig även positivt till demonstrationsprojekt som ett sätt att minska upplevd risk och att öka företags vilja att själva satsa på en viss teknik. Ett företag lyfter vikten av att ha mätning av energianvändning före och efter en installation (för att kunna verifiera) och betonar på värdet av konkreta kvantifierade exempel. 194 IVA: Energieffektivisering av Sveriges industri. Hinder och möjligheter att nå en halverad energianvändning till 2050, Ett arbete inom IVAs projekt Ett energieffektivt samhälle, december

127 Samtidigt säger några av intervjupersonerna att även med demonstrationsprojekt finns en upplevd risk om tekniken kommer fungera för mig och min specifika fabrik och att det krävs testning inom det egna företaget och helst inne i den egna fabriken för att företagen ska vilja installera en ny teknik. En representant ifrån ett energieffektiviseringsföretag lyfter att det vore bra att göra demonstrationsprojekt även om sådant som inte är rent teknisk, såsom energiledningssystem. Många av de intervjuade företagen säger sig dock inte vara rädda för ny teknik, något som delvis kan förklaras av att de som intervjuats tenderar att ha arbetat mer med energifrågan än snittet. En annan förklaring är att många av de intervjuade företagen tillverkar produkter på en produktmarknad där det krävs ständig produktutveckling och innovation för att vara konkurrenskraftig. Dessa företag är således vana vid att förändras och vara innovativa, något som troligtvis avspeglas även i deras arbete med energieffektivitet. Ingen större skillnad har upptäckts vad gäller små respektive stora företags uppfattning av kunskap och osäkerhet kring ny teknik, möjligtvis att de små upplever det som ett något mindre än de stora. Detta skulle kunna bero på att de inte känner till lika mycket obeprövad teknik eller att de har något mindre komplexa processer som de är väl insatta i. En representant ifrån ett energieffektiviseringsföretag menar att kunskap och osäkerhet för ny energieffektiviserande teknik även finns hos andra berörda aktörer, såsom hos banker och andra finansieringsorgan. Detta har karaktären av en kollektiv vara, enskilda aktörer skulle inte kunna räkna hem att utbilda finansiärer, men branschen i stort skulle kunna tjäna på det. Expertpanelen värderar hindret Kunskap och osäkerhet om ny teknik som betydligt större än vad intervjupersonerna gör. De menar att risken för produktionsstörning och förändrad produktionskvalité, tillsammans med en osäkerhet om tekniken verkligen går att räkna hem under den tid som förutspås, hindrar Transaktionskostnader De flesta intervjupersoner har värderat hindret Transaktionskostnader som lågt eller medelhögt. De flesta intervjupersoner säger dock att även om det hindrar är det ett mindre än de flesta andra. En representant ifrån ett energieffektiviseringsföretag uttrycker att Transaktionskostnaderna inte är betydelsefulla jämfört med totala investeringskostnaden, men att de som energieffektiviseringsföretag ändå ständigt arbetar med att försöka sänka trösklarna för kundföretagen. Från intervjuerna framkommer det att de större företagen generellt har personer som har tid och kompetens att arbeta med energifrågan, medan mindre företag blir mer beroende av huruvida enskilda individer i organisationer är eldsjälar inom energi och väljer att prioritera frågan. De flesta intervjuade säger att Transaktionskostnader är en reell tidsåtgång, men att de är beredda att lägga den tiden för de åtgärder som de tror har god besparingspotential. Jämfört med energiintensiv industri är besparingspotentialerna mindre, vilket gör att Transaktionskostnaderna kan sägas vara ett något större för tillverkande industri som inte är energiintensiv än för den industri som är energiintensiv. 19 december

128 De uttryck för Transaktionskostnader som under intervjuerna nämns för sektorn handlar bland annat om att internt lyckas kommunicera nyttan med energieffektiviseringsförslag, administrativt motstånd mot att söka pengar ifrån myndigheter och en tendens att agera mer reaktivt när det handlar om exempelvis att bygga om/byta ut komponenter. Genom att i förväg planera exempelvis vilken elmotor en befintlig elmotor ska ersättas med då denna går sönder kan energieffektiva komponenter väljas utan att det blir tidsfördröjningar och produktionsstopp. Intervjupersonerna lyfter även att många organisationer är slimmade och att alla extra bördor ger upphov till motstånd. De menar dock att de organisationer som arbetat med energifrågan ett tag har byggt upp kunskap och rutiner internt och har således sänkt sina Transaktionskostnader. Expertpanelen har en likartad bild av hindret som intervjupersonerna, även om dessa har tillskrivit hindret något högre betydelse än vad intervjupersonerna gjort. De framför att stora företag har egen anställd personal till att arbeta med energieffektiviseringsfrågan medan mindre företag är beroende av att anlita konsulter. Arvodet för dessa konsulter kan ibland äta upp nyttan med energieffektivisering, i vart fall vad gäller mindre företag och mindre åtgärder. Expertpanelerna uttrycker även att det faktum att personer på företagen inte vet vilken tidsåtgång och administrativa kostnader som kommer att krävas för ett energieffektiviseringsarbete och om det kommer att ge någon utdelning är något som hindrar ytterligare Begränsad rationalitet Intervjupersonerna har värderat hindret Begränsad rationalitet som medelhögt eller som högt. Intervjupersonerna framhåller att det alltid är individer involverade i allt beslutsfattande, och att det därför är naturligt att ett visst mått av Begränsad rationalitet kommer in i alla beslut. De olika personerna som fattar beslut har olika förutsättningar att kunna ta till sig information: flera intervjupersoner belyser vikten av att kommunicera på ett välanpassat sätt med tekniker, ekonom, controller etcetera. Vissa beslut måste tas under tidspress, vilket ytterligare leder till användandet av förenklingar och tumregler. Detta går igen i den bild Backlund et al ger av Begränsad rationalitet inom industrin. De framhåller att beslut inte alltid fattas på välunderbyggd information, utan istället på tumregler och tradition. Förklaringar till detta kan vara tidsbrist eller brist på lättillgänglig information. 195 Från intervjuerna framkom även att många individer har förutfattade meningar inom området och att det är lätt att hamna i tunnelseende och vända sig till samma leverantörer varje gång. Organisationer gör så för att de alltid gjort så, utan en rationell förklaring. Det är lite av good enought -tänket, att något gick bra senast och att man därför inte vill störa andra personer i organisationen genom att ta in flera alternativ. En annan intervjuperson lyfter även konkreta exempel där ägarna till ett mindre företag stoppat lovande energieffektiviseringinvesteringar eftersom magkänslan var fel. Det framkom även från intervjuerna att Begränsad rationalitet har minst lika stor påverkan vad det gäller de beslut som inte fattas, det vill säga att möjligheten till energieffektivitet inte ens undersöks. 195 Backlund, Thollander, Palm, Ottosson: Extending the energy efficiency gap. Department of Management and Engineering, december

129 Här lyfter intervjupersonerna resonemang som de gamla fungerar ju, varför ska vi köpa nya? och att företagen måste klara av vardagen och därför inte bemödar sig med att utreda nya saker. Ingen uppenbar skillnad föreligger vad gäller hur mycket Begränsad rationalitet hindrar i stora respektive små företag. Möjligtvis att stora företag har fler upparbetade rutiner som gör att beslut om energieffektiviseringar inte faller på enskilda personer. Samtidigt finns anledning att tro att individer i större företag drar sig mer för att ifrågasätta vissa invanda mönster och komplicera till processer. Expertpanelerna har värderat hindret Begränsad rationalitet något lägre än vad intervjupersonerna gjort. En anledning till dessa skulle kunna vara att de som intervjuats främst är energiansvarige/energikunniga inom sin organisation, och att dessa hänför en del av de energieffektviserande åtgärder de föreslår men som ändå inte kommer till stånd till Begränsad rationalitet hos övriga organisationen. Expertpanelen lyfter även de ett antal exempel på hur Begränsad rationalitet tar sig uttryck inom övrig tillverkande industrin: orimligt hög riskaversion, personer vänder sig enbart till de leverantörer dessa redan har i sitt nätverk, avvaktande med att göra lönsamma energieffektiviseringar eftersom det kanske kommer något bättre om ett tag och bortprioritering av lönsamma energieffektiviseringar till förmån för mindre lönsamma marknadsinvesteringar. Dock bör nämnas att sistnämnda, satsningar på produktutvecklingar, kan vara rationellt riktigt för att företaget ska överleva på en marknad Organisatoriska Intervjupersonerna har generellt värderat Organisatoriska högt, många har satt det som det allra främsta hindret. Ifrån intervjuerna framkom det att ledningens engagemang i frågan är mycket viktigt för att främja energieffektivitet. Genom en engagerad ledning som sätter upp exempelvis mål och färdplan gällande energiarbetet, utformar energieffektiviseringsrelaterade nyckeltal, satsar resurser och arbetar strategiskt med frågan kan organisationen nå högre (och långsiktigt hållbar) energieffektivisering. Intervjupersonerna menar att om ledningens engagemang saknas faller allt, då kan enskilda personer göra bra saker ute i enskilda produktionsenheter men utan att arbetet får spridning. En intervjuperson uttrycker att alla vill vara bra inför chefen, och att de anställda gör det som de mäts på. Befintlig litteratur på området bekräftar denna bild. I exempelvis SOU 2008:25 framhålls vikten av ledarskap för att kunna nå gynnsam nivå av energieffektiviseringar. 196 Intervjupersonerna uttrycker att det är viktigt att ha en ägare till energifrågan internt, annars prioriteras inte frågan. En intervjuperson exemplifierar med att som produktionschef är ens främsta uppgift att producera en viss mängd produkt, inte att spara energi. En av de intervjuade uttrycker att för att en organisation ska kunna arbeta strategiskt och långsiktigt med energifrågan krävs det resurser som kan hålla i det övergripande arbetet, dra igång projekt, hålla i mötet, göra budget etcetera, annars blir det bara punktinsatser och 196 SOU 2008:25: Ett energieffektivare Sverige, december

130 suboptimering. Större organisationer har oftare anställda som arbetar uteslutande med energifrågan, medan mindre företag antingen har personer som är ansvariga för energi plus andra saker (exempelvis är teknisk chef) alternativt inte har någon energiansvarig alls. Utan energiansvarige måste organisationen förlita sig på eldsjälar. Flera intervjupersoner uttrycker att deras arbete med energifrågan startat genom en eldsjäl, men om frågan inte får ett fäste i organisationen som helhet sprider sig inte energiarbetet och arbetet riskerar att upphöra då eldsjälen slutar. En intervjuperson berättar att det går att se på statistiken hur energianvändningen på en viss anläggning långsamt börjat stiga och fortsatt uppåt ifrån exakt den dagen då en eldsjäl slutat. Flera intervjupersoner lyfter även att det är viktigt att fabrikschefen känner ett ägandeskap över energifrågan. En intervjuperson nämner att de fabriker där fabrikschefen har ett intresse för energieffektiviseringar har kommit betydligt längre en företagets andra fabriker. Ett par intervjupersoner framhåller vikten av att det är just fabrikschefen som är ansvarig för att rapportera in data och information om energi, eftersom denne annars inte kommer att prioritera frågan och vara beredd att avsätta de resurser som krävs för energieffektiviseringsarbetet. En intervjuperson berättar att fabrikschefer idag har krav på sig om tillverkningsmängd, leverenssäkerhet och kvalité, men att det krävs att status på energieffektivitets-nyckelvärden höjs för att energieffektiviseringsarbete ska ökas. En av de intervjuade berättar att nyckelvärdet för energianvändning följs av ledningen på månadsbasis, precis som de finansiella nyckeltalen, vilket ger energieffektiviseringsfrågan ett fokus. Intervjupersonerna uttrycker att de anställdas beteende påverkar energianvändningen, och att det även i organisationer där ledningen satt upp energieffektiviseringsmål behövs göras ett arbete med att skapa kunskap och intresse för energifrågan ute i organisationen. En intervjuperson exemplifierar med att beteende som kan spara energi är att köra maskinerna på bästa sätt, stänga av maskiner då de inte används, släcka lampor med mera. Från intervjuerna framkom att det varierar i vilken utsträckning de anställda har en medvetenhet kring energi och energieffektivitet. Några av de intervjuade säger sig ha kört energieffektiviseringskampanjer för att stärka medvetandet hos de anställda. En intervjuperson anser att det bör finnas ett ekonomiskt incitament, exempelvis en rörlig del av lönen, för att opera maskiner och processer på bästa sätt. Även andra incitament för energieffektivitet vore eftersträvansvärt. Exempelvis utrycker en av de intervjuade, som kan beskrivas som en eldsjäl, att det hade varit roligt med mer uppföljning och återkoppling kring energieffektiviseringsarbetet och vad det sparar, annars pratas det bara om vad allt kostar. Ifrån intervjuerna framkom att det skiljer sig åt vilken kunskap och resurser ett företag har, samt hur denna information är fördelad internt. Generellt kan sägas att mindre företag har mindre kunskap om energi och färre resurser avsatta att arbeta med frågan, dock fungerar informationsspridningen internt ofta bra eftersom personer inom organisationen vanligtvis har relativt nära kontakt. På ett stort företag finns ofta bättre kompetens och resurser, men intervjupersonerna uttrycker att organisationerna ibland är komplexa och att det är svårt att veta hur energifrågan ska hanteras. 19 december

131 Thollander & Olsson (2010) visar i sin forskning att otillräcklig spridning av kunskap internt i en organisation ytterligare kan hindra energieffektiviseringar kommer till stånd. 197 Ofta finns det bra kunskap på olika nivåer i företaget, men vissa organisationsstrukturer gör det svårt att fånga upp och tillvarata denna kunskap. En intervjuperson lyfter även ett konkret exempel hur bristande kompetens kan hämma energieffektiviseringar: produktionschefen på dennes företag har bytts ut många gånger och när en person är ny på en roll har denna ofta begränsad kunskap. Detta har lett till att denne nye produktionschef inte alltid förstår energieffektiviseringsförslaget som presenteras, vilket har hämmat energieffektivitet. Ytterligare något som intervjupersonerna lyfter som ett organisatoriskt för ökad energieffektivitet är förekomsten av Delade incitament internt i företaget. En intervjuperson berättar att varje enhet själv måste bekosta alla investeringar oavsett storlek, något som hindrar stora energieffektiviseringsinvesteringar. En annan berättar att de har en del av koncernen som äger lokalerna och en annan som hyr dem. Då budgetposterna är helt skilda åt saknas incitament i byggnaden som ger ökad energieffektivitet. Ytterligare något som framkom ifrån intervjuerna är att många projekt görs under hög tidspress och kräver snabba beslut. Projektet ansvarar för att hålla den budget som är uppsatt för projektet, och prioriterar då ofta bort energieffektivitet. De kostnader som senare uppkommer för driftenergi kommer på en annan budget. Även IVA (2013) lyfter problematiken med Delade incitament internt och skilda att drift- och underhållsbudget respektive investeringsbudget ofta är skilda budgetposter. 198 Rohdin et al (2006) tar upp problemet med brist på budgetfinansiering för energieffektiviseringar och att andra investeringar prioriteras som för energieffektivisering. I gjuteribranschen uppges dessa vara några av de främsta hindren. 199 Många av de intervjuade framhåller också ägandefrågan och tidshorisonten som potentiella för energieffektivitet: i många företag ligger fokus på kortsiktig vinst och kvartalsekonomi styr. De intervjuade menar på att familjeföretag har en längre tidshorisont och därmed är öppna för att göra lönsamma energieffektiviseringar med längre återbetalningstid. Hos många tillverkningsföretag ligger kravet på återbetalningstid mellan 0,5-2 år. Intervjupersonerna framhåller att tilldelning av resurser är den stora haken, både vad gäller att få loss personer som ska driva utvecklingen och vad gäller tilldelning av resurser för förbättringsprocesser. Även litteratur på området beskriver konkurrens om begränsade resurser inom företaget. IVA (2013) uttrycker att tid och pengar till energieffektiviseringar ofta bortprioriteras till förmån för kärnverksamhet och det som upplevs som mest relevant för företagets position på marknaden. 200 Beskrivningen av Organisatoriska som framkommer under intervjuerna återkommer till stor del i expertpanelens beskrivning. Dock har expertpanelen tillskrivit Organisatoriska en betydligt lägre värdering än vad intervjupersonerna gjort. Detta kan bero på att 197 Thollander, Ottosson: Energy management practices in Swedish energy-intensive industries, IVA: Energieffektivisering av Sveriges industri: Hinder och möjligheter att nå en halverad energianvändning till 2050, Ett arbete inom IVAs projekt Ett energieffektivt samhälle, Rohdin, Thollander, Solding: Barriers to and drivers for energy efficiency in the Swedish foundry industry, IVA: Energieffektivisering av Sveriges industri: Hinder och möjligheter att nå en halverad energianvändning till 2050, Ett arbete inom IVAs projekt Ett energieffektivt samhälle, december

132 intervjupersonerna är mer inne i företaget och har en bättre inblick i de organisatoriska hindren, alternativt att de upplever andra (exempelvis Asymmetrisk information, Transaktionskostnader, Policyinstabilitet och Finansiella ) som Organisatoriska. Expertpanelen lyfter Organisatoriska som ägarförhållanden, tidshorisont, motstridiga budgetintressen och Asymmetrisk information internt i företaget. De framhåller även brist på mätdata och kunskapsbrist vad gäller att räkna på energieffektiviseringsinvesteringar. Expertpanelen menar vidare att många små och medelstora företag inte är medvetna om vilken kunskap de saknar internt i organisationen, vilket kan sägas vara ett organisatoriskt. Precis som intervjupersonerna framhåller de dock att informationsöverföringen fungerar bättre i små företag än i stora. Expertpanelen lyfter även fram att det finns en stor potential i att arbete med beteendefrågor och med de anställdas beteende Finansiella De flesta intervjupersoner värderar hindret som lågt eller medel, även om enstaka har värderat det som allra högst. De som har värderat hindret allra högst har ekonomiska problem, och menar att detta då överskuggar alla de andra. De flesta intervjupersoner framhåller dock att det inte är brist på kapital, utan att det snarare handlar om vilka prioriteringar företaget väljer att göra. Denna bild bekräftas av befintlig litteratur på området: den upplevda bristen på kapital till energieffektiviseringar är stor, men många gånger handlar det om att energieffektiviserande investeringar inte prioriteras. 201 De menar att argumentet brist på medel ofta förs fram, men att detta egentligen handlar om Organisatoriska. Några av de intervjuade, speciellt representanter ifrån energieffektiviseringsföretag, framhåller att banker och låneinstitut ibland är ovana vid att värdera energieffektiviseringsinvesteringar, delvis eftersom energieffektiviseringsinvesteringar inte ger upphov till ett kassaflöde utan istället en lägre kostnad. De menar att den bristande kunskapen försvårar möjligheterna något till att låna pengar till energieffektiviseringar till bra ränta. En representant ifrån ett energieffektiviseringsföretag lyfter att de stora företagen ofta har bra bankkontakter och relativt lätt att få lån, medan små- och medelstora företag ofta har något svårare. Expertpanelen värderar Finansiella i paritet med intervjupersonerna. Även expertpanelen framhåller att för de företag där den finansiella situationen är ett stort problem hindrar detta energieffektiviseringar mycket. En deltagare i expertpanelen påpekar att När man riskerar att gå i konkurs inom tre år är det inte längre relevant att titta på energieffektiviseringsinvesteringar. Expertpanelen framhåller att när energieffektiviseringar är kapitalintensiva är Finansiella ofta stora, men att en stor del av energieffektiviseringspotentialen snarare ligger sådant som inte kräver stora investeringar: i förändrat beteende och i förbättrat styr- och regler. 201 Backlund, Thollander, Palm, Ottosson: Extending the energy efficiency gap. Department of Management and Engineering, 2012; Rohdin, Thollander, Solding: Barriers to and drivers for energy efficiency in the Swedish foundry industry, december

133 6.5.7 Policyinstabilitet Intervjupersonerna är eniga om att Policyinstabilitet inte är ett stort, samtliga har värderat hindret lågt eller i mitten. Av de mindre företag som intervjuats uttrycker flera att de inte känner till så mycket angående policyfrågor, och att detta inte påverkar dem i deras arbete med energieffektiviseringar. De större företagen uttrycker bland annat att policier om energi påverkar energieffektiva företag mer än vad det påverkar dem, att det påverkar deras produktutveckling (produkternas energieffektivitet) men inte deras egna energianvändning och att deras återbetalningstid ändå är så kort att andra hinner hindra innan Policyinstabilitet gör det. Några nämner att de ser regleringsläget som relativt stabilit i Sverige. Expertpanelerna har gjort en likartad bedömning som intervjupersonerna. Även dessa lyfter att återbetalningstiderna ofta är korta inom den tillverkande industrin, vilket gör att Policyinstabilitet (förändring över tid) får en mindre påverkan. De nämner åter igen att mycket av energieffektiviseringspotentialen ligger i förändringar som kräver små eller inga investeringar, och att dessa inte påverkas av policyinstabilitet. Någon lyfter även att mindre företag är än mindre påverkade av Policyinstabilitet än stora, eftersom dessa är mer flexibla och har lättare att ställa om och anpassa sig till förändrade omvärldsfaktorer Swecos samlade bedömning för den övriga tillverkande industrin Figur 40 visar Swecos sammanvägda bedömning för hur stor del de olika hindren påverkar energieffektiviseringar i övrig tillverkande industri. Figur 40: Fördelning av i den övriga tillverkande industri 15% 7% 8% Asymmetrisk information 12% Kunskap, osäkerhet om ny teknik Transaktionskostnader Begränsad rationalitet 18% Organisatoriska 25% Finansiella 15% Policyinstabilitet Källa: Sweco, december

134 Asymmetrisk information bedöms totalt för sektorn till 8 procent. Hindret är inte stort då industriföretagen oftast äger sina egna lokaler, dock hyr de i något större utsträckning än vad den energiintensiva industrin gör. Viss problematik med Asymmetrisk information förekommer även mellan industriföretag och energieffektiviseringsföretag. Dessutom kan bristande systemsyn och samarbete mellan aktörer hindra framtagandet av mer energieffektiv teknik. Kunskap och osäkerhet kring ny teknik bedöms totalt till 12 procent. Detta är lägre än för den energiintensiva industrin, eftersom den övriga tillverkande industrin i större utsträckning kan energieffektivisera genom stödprocesser (som är mer lika mellan företag) och dessutom har mindre komplicerade huvudprocesser. Från intervjuerna framkom att kan vara stort för vissa företag, medan andra inte alls upplever det så. Företagen inom den tillverkande sektorn är dock i högre grad än den i den energieffektiva vana vid att förändras och vara innovativa, något som troligtvis avspeglas även i deras arbete med energieffektivitet. Transaktionskostnader bedöms totalt till 15 procent. Från intervjuerna framkom att Transaktionskostnader är en reell tidsåtgång, men att de är beredda att lägga den tiden för de åtgärder som de tror har god besparingspotential. Expertpanelen lyfte att besparingspotentialen för övrig tillverkande industri är mindre än för energiintensiv industri, vilket gör att Transaktionskostnaderna kan sägas vara ett något större för övrig tillverkande industri som inte är energiintensiv än för den industri som är energiintensiv. Det finns även fler små företag inom den övriga tillverkande industrin, och Transaktionskostnader kan generellt sägas vara ett större för mindre företag än för större. Begränsad rationalitet bedöms totalt till 15 procent. Från intervjuer och expertpaneler framom att det alltid är individer involverade i allt beslutsfattande, och att det därför är naturligt att ett visst mått av Begränsad rationalitet kommer in i alla beslut. Stora företag har generellt fler upparbetade rutiner som gör att beslut om energieffektiviseringar inte faller på enskilda personer. Samtidigt finns anledning att tro att individer i större företag drar sig mer för att ifrågasätta vissa invanda mönster och komplicera till processer. Organisatoriska bedöms totalt till 25 procent. Från intervjuer och expertpaneler framkom även att många Organisatoriska kunde hindra energieffektiviseringsarbete: ledningens engagemang, huruvida det finns en ägare till energifrågan, Delade incitament internt, kunskap och informationsspridning internt, hur väl engagemanget sprid i organisationen och bristande mätning och uppföljning. Eftersom övrig tillverkande industri inte är energiintensiv läggs överlag något mindre resurser på energieffektiviseringsarbete än för energiintensiv industri. Små företag har kortare beslutsvägar, dock har de har inte lika mycket resurser att arbeta med energifrågan. Stora företag har mer resurser men är samtidigt mer komplexa. Finansiella bedöms totalt till 15 procent. Från expertpaneler och intervjuer framkommer att det överlag inte råder brist på kapital, utan att det snarare handlar om vilka prioriteringar företaget väljer att göra. Dock kan vissa företag ha ekonomiska problem, och 19 december

135 då kan det vara ett avgörande. Generellt sett är energieffektiviseringsinvesteringar i den övriga tillverkande industrin inte lika kapitalkrävande som för den energieffektiva industrin. Dock kan det finnas fler mindre företag i den övriga tillverkande industrin som har finansiella problem och svårt att få lån. Ibland är övrig tillverkande industri dessutom underleverantörer till ett fåtal stora kunder och om man tappar en stor kund kan det vara avgörande för företagets ekonomi. Policyinstabilitet bedöms totalt till 7 procent. Ofta är den krävda återbetalningstiden kort för energieffektiviseringsinvesteringar i den övriga tillverkande industrin, och policies hinner oftast inte ändras på kort sikt. Av de mindre företag som intervjuats uttrycker flera att de inte känner till så mycket angående policyfrågor, och att detta därför inte påverkar dem i deras arbete med energieffektiviseringar. Övrig tillverkande industri har även fler små företag än den energiintensiva industrin, och generellt kan sägas att mindre företag är mer flexibla och har lättare att anpassa sig till omvärldsförändringar. 19 december

136 6.6 Persontransporter Ett antal företrädare för branschorganisationer som företräder privatbilism och personbiltillverkning har intervjuats, tillsammans med aktörer inom sektorn persontransporter på spår Asymmetrisk information inklusive Delade incitament Vad gäller bilar råder inte Delade incitament, eftersom ägaren till bilen betalar energianvändningen och även är den som har möjlighet att påverka energianvändningen. Delade incitament kan dock förekomma vid köp av företagsbil i de fall där företaget inte vill köpa in en för dyr bil, fast brukaren skulle spara på lägre energikostnader. Oftast är dock billigare (och mindre) bilar relativt energieffektiva, och intervjupersonerna menar inte på att detta är ett särskilt stort. Vissa aktörer pekar på att privatpersoner kan ha ett kunskapsunderläge gentemot säljare. Dock finns teknisk data för alla bilmodeller samlat i bilhallen, i annonser samt tillgängligt i applikationer (vilket kan vara värdefullt om man exempelvis köper en begagnad bil). De flesta menar därför på att om man som privatperson vill ha reda på information om en bils energieffektivitet kan man relativt enkelt få det. Dock menar intervjupersonerna på att både köpare och säljare nischar sig in mot olika marknader, vilket innebär att det bara är när det är en energieffektiv bil som dessa data frontas, annars läggs tonvikt vid andra funktioner. Miljöbilsmarkanden är inte den primära, även om det är en tydlig trend i nybilsförsäljningen. Som köpare får man reda på bränsleförbrukningen i en bil man ska köpa. Denna uppskattning av bränsleförbrukning är gjord i labbmiljö och baserad på en körcykel som är snäll. Intervjupersonerna skiljer sig här åt: vissa menar på att informationen om drivmedelsförbrukning skapar jämförbarhet mellan olika fordon, medan någon intervjuperson menar att informationen missgynnar energieffektivare val. Detta eftersom vissa personer kanske nöjer sig med en snål diesel, fast dessa personer kanske egentligen annars hade vågat sig på en laddhybrid eller elbil om dessa vetat att bränsleåtgången leverantören tillhandahöll inte stämde. Samme intervjuperson pekar på att informationen om bränsleåtgång i annonser brukar vara i minimalt typsnitt, och att återförsäljaren har stora möjligheter att påverka vilken bil kunden köper i slutändad. Vad gäller persontransporter på spår framhåller intervjupersonerna att det faktum att många tåg ännu har schablondebiterad el skapar Delade incitament, då detta påverkar incitamenten att hålla nere energianvändningen. SJ nämnder i rapporten Ecodriving på SJ att det faktum att de tåg som provat ekodriving för debiteras för sin exakta elmätning är något som främjar inctamenten att satsa på ecodriving. 202 Det finns en utveckling mot att allt fler tåg har separat elmätning. Trafikverket får dock inte ställa krav på separat mätning av el i befintliga tåg. Detta i samband med att en övergång till separat elmätning ofta endast sker i samband med nyförvärv eller större ombyggnationer gör att övergången till separat elmätning tar tid. Samtidigt är ledtiderna för att byta ut persontransporttåg kortare än för godståg, eftersom det finns en efterfråga på nyare (och således mer komfortabla tåg) vad gäller persontransporter. Sammanvägt menar dock intervjupersonerna att Asymmetrisk information och Delade incitament inte är ett stort vare sig för bilar eller för tåg. 202 Guirgis, Georg Abadir, VTI: Ecodriving på SJ Förarperspektiv på tekniska hjälpmedel för beslutsfattande och utbildning i Ecodriving, december

137 VTI har gjort en studie där mål- och intressekonflikter på kommunal och regional nivå och dess påverkan på möjligheten att skapa miljövänligare transportsystem (vilket i detta fall är intimt förknippat med energieffektivare transportsystem). Fallen som tas upp handlar om utbyggnad av handelsområden som kan medföra ökat bilresande samt utveckling av kollektivtrafik. I denna påvisas således hur Delade incitament mellan aktörer kan få betydelse för energieffektivitet i persontransport. 203 De intervjuade har främst svarat utifrån enskilda personer och organisationers asymmetriska information och Delade incitament inom energieffektivitet, och således inte vägt in förhållandet mellan olika samhällerliga aktörer Kunskap och osäkerhet om ny teknik Vad gäller personbilar tenderar intervjupersonerna att värdera Kunskap och osäkerhet om ny teknik som en stor tröskel att ta sig över. Som exempel nämns kunskap och osäkerhet kring elbilar. Privatpersoner hör av sig till branschorganisationer med frågor om exempelvis var elbilar kan laddas, andrahandsvärdet, hur länge ett batteri håller, samt vad ett batteribyte kosta. Dessa frågor handlar således mycket om marknadens utveckling, samt statens vilja att satsa på elbilar. Bilbranschen försöker att adressera detta genom att ta fram olika koncept, såsom att man kan leasa batterier. Samhällets roll vad gäller laddinfrastruktur spelar också in. En av de intervjuerna framhåller att skepsis kan uppstå när ny teknik introduceras, men att branschen och köparna sedan efter ett tag vet att det fungerar. Således är det viktigt med demonstrationsanläggningar. IVA framhåller i sin rapport Energieffektivisering av Sveriges transportsektor att höga kostnader, begränsad batteriprestanda, begränsad infrastruktur och människors uppfattning om hur detta kommer att utvecklas är för en ökad elektrifiering av vägtrafiken. 204 Vad gäller tåg menar de intervjuade på att Kunskap och osäkerhet om ny teknik är ett ganska stort, eftersom osäkerheten kring om den nya tekniken verkligen kommer att fungera som tänkt är hämmande. Säkerhet, drift och komfort värderas högre än energieffektivitet, vilket kan hindra energieffektiviserande åtgärder. Som konkret exempel nämns att signalsystem och dylikt måste vara mycket väl beprövat för att Trafikverket eller andra aktörer ska vilja sjösätta det i stor skala. Intervjupersonerna lyfter även fram att en stor vinst finns i att flytta transporter från andra transportslag till spår, varför det är viktigt att säkerställa en attraktiv järnväg. Om en energieffektivisering görs i ett tåg som innebär att någon väljer bort tågalternativet medför detta en försämrad energieffektivitet. I SOU 2013:84 lyfts även den osäkerhet och okunskap som kan finnas i organisationer gällande resfria möten. De menar att de fall organisationen inte är beredd att anpassa arbetssättet och möteskulturen finns risk för att resfria möten inte får något genomslag 205 Totalt sett värderar intervjupersonerna att kunskap och osäkerhet kring ny teknik är ett stort för ökad energieffektivitet i sektor. 203 Hrelja, Robert, VTI: Miljövänliga transporter? Mål- och intressekonflikter i kommunala och regionala besluts- och planeringsprocesser, IVA: Energieffektivisering av Sveriges transportsektor, 2013; SOU 2013:84: Fossilfrihet på väg, SOU 2013:84: Fossilfrihet på väg, december

138 6.6.3 Transaktionskostnader De intervjuade tycker att det är svårt att göra uppskattningar om hur mycket tid privatpersoner lägger ner på att sätta sig in i olika faktorer, såsom energieffektivitet, inför ett bilköp. Flera av de intervjuade anser att internet har gjort att det är enkelt för privatpersoner att hitta den information de behöver, vilket sänkt Transaktionskostnaderna. En av de intervjuade menade att när något väl är etablerat är inte Transaktionskostnaderna längre stora. En annan av de intervjuade framhåller dock att internet ger en tusentals träffar då man söker på något, och att det är svårt att lita på alla de uträkningar som finns på internet verkligen stämmer. Denna intervjuperson menar även att man som konsument måste vara väldigt kunnig för att kunna göra ett bra val. Samtliga av de intervjuade inom personbilssektorn värderar dock detta som lågt. Även vad gäller tåg värderas Transaktionskostnaderna lågt. Dock lyfter intervjupersonerna att många av de som arbetar operativt i tågoperatörorganisationer saknar kunskap om energi, och att ta sig över kunskapsbristen innebär Transaktionskostnader. De menar speciellt på att Transaktionskostnader kan vara ett hos mindre tågoperatörer. Sammanvägt värderar intervjupersonerna Transaktionskostnader som ett litet inom persontransportsektorn. Transaktionskostnader tas inte upp i svensk litteratur rörande energieffektivitet i persontransportsektorn de senaste åren. En tolkning kan således vara att detta inte är något stort. En annan anledning kan även vara att transportsektorn vanligtvis inte använder denna benämning, och att det kan finnas drag av Transaktionskostnader inom den befintliga litteraturen men som benämns på annat vis. Att personer värderar sin tid och således ibland väljer att satsa på ett snabbare färdsätt läggs i denna studie in under preferenser och Begränsad rationalitet Begränsad rationalitet Det är svårt att skilja på vad som är Begränsad rationalitet och vad som skapar ett värde på grund av en preferens. Litteratur inom området lyfter upp att människors preferenser, attityder, värderingar och acceptans för olika transportslag kan påverka energieffektiviteten inom transportsektorn. 206 Ifrån intervjuerna framkommer det att bekvämlighet väger oerhört tungt, och att beteende är en av de stora utmaningarna. Exempelvis när det handlar om överflytt mellan olika transportslag, som att välja tåg istället för bil, framkommer olika aspekter. I somliga kretsar kan det vara status att ha en bil och i andra att välja att åka kommunalt. Bilen är laddad med identitet och har andra värden än rent ekonomiska. Bekvämligheten spelar en stor roll vid val av färdmedel: krävs det för många byten när man åker kollektivt kommer många välja att inte göra det. Samtidigt kan det finnas andra fall där man snarare väljer bilen av vana. När en person i storstäder väljer att åka bil tänker man kanske inte alltid på att detta ofta innebär bilköer, trängselavgift, parkeringsavgifter och sökande efter parkeringsplats. 206 IVA: Energieffektivisering av Sveriges transportsektor, 2013; SOU 2013:84: Fossilfrihet på väg, 2013; Trafikanalys: Arbetspendling i storstadsregioner- en nulägesanalys, december

139 Komforten denne person upplevde i början av resan är i detta fall borta. Detta tas upp i litteraturen som att stigberoendet inom sektorn hindrar ökad energieffektivitet. 207 Även vad gäller val av bil att köpa exemplifierar intervjupersonerna med fall av Begränsad rationalitet som kan finnas. Exempelvis kanske en viss person knappt tittar på drivmedelsförbrukning vid val av bil, men sedan älskar att få en rabatt på några öre per liter vid tankning. Detta trots att besparingen är liten i sammanhanget. En intervjuperson lyfter även exemplet med att det inte är helt rationellt att köpa en stor bil med höga drivmedelskostnader enbart för att man en vecka om året har behov av en stor bil, exempelvis vid semester. En annan intervjuperson nämner att köparna av bil tenderar att titta kostnaden, men med större vikt vid prislappen än kostnaden över tid. Utredningen Fossilfrihet på väg hänvisar till ett antal studier som gjorts i Europa och USA som visar på just denna tendens att värdera inköpskostnaden högre än de löpande kostnaderna. 208 I viss utsträckning är dock detta rationellt, eftersom man ofta äger bilen för kort för att hinna räkna hem den högre inköpskostnaden och andrahandsvärdet kan vara osäkert. Vad gäller tåg menar intervjupersonerna på att större förståelse för energi ibland skulle behövas. Energi är inte intuitivt enkelt att förstå, och som exempel nämns att de anställda hos en tågoperatör kan låta ventilationen vara på i en avställd vagn, medan man är noga med att släcka lampor eftersom dessa syns. Detta trots att lampor drar mycket mindre energi än ventilationssystemet. Ett till exempel är att man prioriterar säker drift framför ekonomi, vilket ofta kan vara rationellt men ibland görs i för stor utsträckning: risken övervärderas till irrationellt hög. Ytterligare ett exempel kan vara att en tågoperatör inte tycker sig ha råd med något fast det snabbt skulle vara lönsamt. Separat elmätning i lok nämns i en intervju som ett exempel på detta. De flesta skulle enligt intervjupersonen kunna spara in installation i separat elmätare på ett år, genom att man följde upp energianvändningen organisationen började arbeta med frågan. Det framkom i intervjuerna att uppföljning är av värde. Som exempel nämndes att bara det att lokföraren vet att någon följer ens sätt att köra tåget på påverkar beteendet. De allra flesta intervjupersoner värderar hindret Begränsad rationalitet högt Organisatoriska Vad gäller persontransporter sett utifrån privatpersoners perspektiv är Organisatoriska inte särskilt intressanta att beakta. Organisatoriska kan dock spela in vid köp av företagsbil (förmånsbil). I en intervju lyfts fram att företagets policy påverkar. Denna intervjuperson menar att det många gånger är det bara priset som styr, vilket inte alltid innebär att man styr mot energieffektivitet. Ifrån intervjuerna rörande tåg framhålls att Organisatoriska i form av Delade incitament ofta finns internt hos tågoperatörer. Det handlar exempelvis om att en viss energieffektiviserande åtgärd bekostas av en del av företaget, medan en annan del av företaget kan tillgodogöra sig besparingen. 207 Trafikanalys: Arbetspendling i storstadsregioner- en nulägesanalys, SOU 2013:84: Fossilfrihet på väg, december

140 En annan form av Delade incitament internt är att de som kör tågen har möjlighet att påverka energiåtgången (genom ekodriving), men dessa personer inte direkt har incitament att hålla nere energianvändningen. Detta interna Delade incitament kan reduceras genom mätning och uppföljning. SJ har tagit fram en mjukvara för ekodriving för att kunna planera körningen (så att tåget ändå kommer fram i tid), visualisera och ge information till föraren om energiåtgång i realtid. Generellt kan även sägas att, likt i alla organisationer, Organisatoriska för energieffektivisering minskas när företaget väljer att satsa resurser på att arbeta med energi och skapa en förståelse för frågan internt. I den studie som SJ gjort för VTI framhåller de betydelsen av att överbygga sådana Organisatoriska och att kommunicera ut energieffektvitet i organisationen (till lokförarna). 209 Organisatoriska inom tågtransporter värderas av intervjupersonerna som medelhögt. För personbilar är värderingen att hindret, av naturliga skäl, har liten påverkan Finansiella Intervjupersonerna inom personbilar anser olika vad gäller om Finansiella är av betydelse eller inte. Några lyfter fram att ekonomin har en ganska stor vikt vid valet av bil, och om man inte har kapital och måste låna är det avgörande för vilken bil man väljer. De menar att alla inte har råd att köpa en ny bil med bra miljöprestanda. En av intervjupersonerna uttrycker istället att det främst är andra faktorer som styr val av bil, och att de billiga bilarna ofta dessutom är energieffektiva (delvis eftersom de ofta är mindre). Litteratur inom området framhåller att Finansiella ibland kan påverka energieffektiviteten, speciellt när det gäller inköp av energieffektiv teknik i framkant såsom elbilar (vilket tenderar att vara påtagligt dyrare än andra bilar). 210 Vad gäller tåg anser inte intervjupersonerna att de finansiella hindren är stora, även om vissa mindre tågoperatörer kan uppleva dessa. Totalt sett rankas hindret ganska lågt inom persontransporter, även om det kan vara av betydelse för vissa personer och organisationer Policyinstabilitet De intervjuade anser att Policyinstabilitet påverkar mycket, och menar att avsaknaden av långsiktiga spelregler gör det svårt för aktörer (inklusive privatpersoner) att veta vad de ska satsa på. Intervjupersonerna uttrycker att man inte vet vilken tillgänglighet det kommer att vara på drivmedel och elladdinfrastruktur 211 framöver eller hur olika skatter och bidrag kommer att ändras. Ett exempel på detta som berörs i litteraturen är att utredningen Fossilfrihet på väg nämner att en nybilsköpare i sitt val av bil måste kunna lita på att skatten inte förändras under bilens livslängd och att den påverkar bilens restvärde också efter ett stort antal år. Detta riskerar annars att leda till mindre energieffektiva val vid köp av ny bil. Intervjupersonerna framhåller att styrmedel inom transportsektorn är politiska, och det finns ett antal tidigare fall där politikerna ändrat riktning på ett sätt som fått ekonomiska konsekvenser för aktörerna i sektorn. 209 Guirgis, Georg Abadir, VTI: Ecodriving på SJ Förarperspektiv på tekniska hjälpmedel för beslutsfattande och utbildning i Ecodriving, IVA: Energieffektivisering av Sveriges transportsektor, 2013; SOU 2013:84: Fossilfrihet på väg, Infrastruktur i form av laddstationer för att ladda elbilar. 19 december

141 Exempel på detta som intervjupersonerna berättar om är förändringar som gjorts vad gäller dieselskatten, samt etanolsatsningen som i slutändan inte blev mycket av. Specifikt för tåg framhålls osäkerheten kring infrastrukturutbyggnad och banavgiftens framtida prisutveckling. Att politikerna tidigare bytt riktning vad gäller transportsektorn och dess styrmedel gör att både tillverkare, leverantörer och privatpersoner (som ska köpa bilar) ibland avvaktar med eller avstår från att fatta vissa typer av beslut som skulle kunna ge högre energieffektivitet. Sammanvägt värderar de intervjuade detta som stort Swecos samlade bedömning för persontransporter Figur 41 visar Swecos sammanvägda bedömning för hur stor del de olika hindren påverkar energieffektiviseringar i persontransporter. Figur 41: Fördelning av i persontransporter 20% 10% 15% Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader 12% 10% Begränsad rationalitet Organisatoriska 8% Finansiella 25% Policyinstabilitet Källa: Sweco, 2014 Asymmetrisk information bedöms totalt för sektorn till 10 procent. För personbilar är Delade incitament generellt inte ett, eftersom ägaren till bilen är den som har möjlighet att påverka drivmedelåtgången. För företagsbilar kan Delade incitament ibland vara ett. Viss Asymmetrisk information kan förekomma mellan privatpersoner och säljare av bilar, även om de flesta av de intervjuade menar att informationen till slutkunder om energieffektivitet i olika bilar är god. Vad gäller persontransporter på spår framhåller intervjupersonerna att det faktum att många tåg ännu har schablondebiterad el skapar Delade incitament, då detta påverkar incitamenten att hålla nere energianvändningen. Kunskap och osäkerhet kring ny teknik bedöms totalt till 15 procent, vilket är ganska högt. Gällande personbilar är många privatpersoner osäkra på att köpa en teknik i framkant, 19 december

142 elbilar och osäkerhet kring denna teknik nämns exempelvis ett flertal gånger. Vad gäller tåg menar de intervjuade på att Kunskap och osäkerhet om ny teknik är ett ganska stort. Säkerhet, drift och komfort värderas högre än energieffektivitet. Osäkerheten kring om den nya tekniken verkligen kommer att fungera som tänkt är såldes hämmande. Transaktionskostnader bedöms totalt till 10 procent. De flesta intervjupersoner bedömer att privatpersoner vid val av bil lägger ner relativt mycket tid på att undersöka olika alternativ, eftersom detta är ett av de större köpen som görs som privatperson. De framhåller att internet reducerar Transaktionskostnader, även om en av de intervjuade dock framhåller att internet ger en tusentals träffar då man söker på något och att det är svårt för privatpersoner att värdera resultaten. Även vad gäller tåg värderas Transaktionskostnaderna lågt, men uttrycker att Transaktionskostnader kan vara ett hos mindre tågoperatörer. Begränsad rationalitet bedöms totalt till 25 procent. Från intervjuerna framkommer att bekvämlighet, identitet, vanor och andra värden än rent ekonomisk nytta spelar in och kan hämma energieffektiviteten. Detta missgynnar ibland även överflytt mellan transportslag som skulle kunna leda till högre energieffektivitet om det gjordes (hämmas på grund av exempelvis vanor). Det är svårt att skilja på vad som är Begränsad rationalitet och vad som skapar ett värde på grund av en preferens. Vad gäller tåg menar intervjupersonerna på att större förståelse för energi bland de anställda hos tågoperatörerna ibland skulle behövas. Organisatoriska bedöms totalt till 8 procent. Vad gäller persontransporter sett utifrån privatpersoners perspektiv är Organisatoriska inte särskilt intressanta att beakta. Organisatoriska kan dock spela in vid köp av företagsbil, då företagets policy kan påverka valet av bil. Ifrån intervjuerna rörande tåg framhålls att Organisatoriska i form av Delade incitament ofta finns internt hos tågoperatörer, i form av olika budgetintressen eller låga incitament hos chaufförerna för ecodriving. Finansiella bedöms totalt till 10 procent. Några intervjupersoner lyfter fram att ekonomin har en ganska stor vikt vid valet av bil, och om man inte har kapital och måste låna är det avgörande för vilken bil man väljer. En av intervjupersonerna uttrycker istället att det främst är andra faktorer som styr val av bil, och att de billiga bilarna ofta dessutom är energieffektiva (delvis eftersom de ofta är mindre). Vad gäller tåg anser inte intervjupersonerna att de finansiella hindren är stora, även om vissa mindre tågoperatörer kan uppleva dessa. Policyinstabilitet bedöms totalt till 20 procent. De intervjuade anser att Policyinstabilitet påverkar mycket, och menar att avsaknaden av långsiktiga spelregler gör det svårt för aktörer (inklusive privatpersoner) att veta vad de ska satsa på. Intervjupersonerna uttrycker att man inte vet vilken tillgänglighet det kommer att vara på drivmedel och elladdinfrastruktur framöver eller hur olika skatter och bidrag kommer att ändras. Specifikt för tåg framhålls osäkerheten kring infrastrukturutbyggnad och banavgiftens framtida prisutveckling. 19 december

143 6.7 Godstransporter Ett antal aktörer inom sektorn godstransporter har intervjuats inom åkeribranschen och godståg. De intervjuade företagen har varit medelstora eller stora. Utöver detta har även en expertpanel hållits med ett antal personer som har mer systemövergripande kunskap om sektorn godstransporter Asymmetrisk information inklusive Delade incitament Av de intervjuade inom godstransport på väg säger sig de flesta inte ha upplevt Delade incitament och andra former av Asymmetrisk information som ett. Motiveringen de ger till detta är att de betalar för sitt eget drivmedel, och därför både har möjlighet och incitament att hålla nere energianvändningen. Av de intervjuade som har mer systemöverblick, samt av på expertpanelen, tillmätts Asymmetrisk information en större betydelse. De pekar på att det finns flera aktörer inblandade i en godstransport. Exempelvis vid beställning av en lastbilskörning finns beställaren, speditören (som förmedlar transporten) och åkerier. Sedan indirekt finns det än fler aktörer inblandade: slutkunden till varan (om annan än beställare), stadsplanerare (som har möjlighet att optimera respektive suboptimera distribution), politiker och beslutsfattare. Vissa av de intervjuade pekar på att transparensen mellan slutkund och åkeri är dålig, vilket ibland kan få effekter att kunderna inte förstår vad de beställer, något som bland annat innefattar hur energieffektiv transporten är. Det finns ekonomiska intressen i den gamla lösningen och aktörer som aktivt motarbetar viss förändring. Aktörerna agerar i detta fall rationellt utifrån sin egen situation, men det blir en suboptimering totalt sett. Någon pekar även på att lastfyllnadsgraden är viktig ur energieffektivitetssynpunkt. Som det ser ut idag kör många bilar inte fulla. Om man hade haft en bättre samordning mellan företag och körningar hade färre, mer välfyllda, bilar kunnat köra motsvarande last. Transportköparen vill inte blanda sina varor med varor från andra företag, vilket leder till dålig samordning. Detta är delvis ett exempel på Delade incitament, eftersom de är konkurrenter och Delade incitament mellan konkurrenter är ganska naturligt, men det kan även bero på traditionalism. Viktigt att notera är dock att full fyllnadsgrad i alla former av transporter givetvis aldrig är möjlig att uppnå. I utredningen Fossilfrihet på väg (SOU 2013:84) nämns det att det även kan finnas svårigheter med att få till samordnade transporter sett utifrån konkurrenslagstiftningen, tillsammans med osäkerheterna som råder om kostnader på kort och lång sikt. 212 En ytterligare sak som expertpanelen och de intervjuade med lite mer systemöverblick tar upp är att kontrakt ibland kan vara utformade så att transportföretag kan föra över bränslekostnader direkt på speditörer eller logistikföretag. Detta ger upphov till Delade incitament, då den som betalar för energin inte har direkt möjlighet att påverka energianvändningen. Några av de svenska studier som gjorts på senaste lyfter att detta kan vara ett problem, dock hänvisar de främst till internationella studier som gjorts. 213 I en studie som gjorts med åtta åkeriföretag framkom att samtliga arbetade med någon form av bränsleklausuler eller indexjusteringar, vilket överför eventuella bränsleprishöjningar på transportköparen. Även detta är ett exempel på Delade incitament. 212 SOU 2013:84: Fossilfrihet på väg, VTI: Landbaserade godstransporter, klimat och styrmedel, 2014; SOU 2013:84: Fossilfrihet på väg, december

144 Viktigt att notera är dock att även då bränsleklausul tillämpas är det fortfarande gynnsamt för åkaren att reducera energianvändningen, däremot verkar inte förändrade prissignaler såsom höjd koldioxidskatt (i vart fall inte på kort sikt). 214 Det är dock inte säkert att denna problematik bör kategoriseras in som Delade incitament. Bränsleklausulen är ett sätt att dela på en risk. På lång sikt tvingar konkurrens åkerier att bli effektivare, i synnerhet om energipriserna är höga. Vad det gäller godstransporter på tåg framhåller både aktörer och expertpanelen att det faktum att majoriteten av tåg idag saknar separat elmätning minskar incitamenten att satsa på att reducera elanvändningen, då man som tågoperatör ändå inte kan tillgodogöra sig denna nytta. Det finns en trend att allt fler skaffar separat elmätning, Trafikverket tillhandahåller ett system för automatisk elavläsning som de delvis finansierar. Dock bedömer intervjupersoner att det tar lång tid innan detta är implementerat fullt ut Kunskap och osäkerhet om ny teknik Både de intervjuade aktörerna och expertpanelen framhåller att den politiska osäkerheten hindrar mer än den tekniska. Åkerierna framhåller att de inte är särskilt osäkra på ny teknik, något som delvis kan bero på att de som intervjuats ligger förhållandevis långt fram vad gäller energieffektiviseringsarbete. Aktörerna har dock olika uppfattning om hur väl information och kunskap idag når ut till branschens aktörer, både vad gäller spår och väg. Av de med mer övergripande syn menar vissa på att branschen inte är osäker och att man inte saknar kunskap, medan andra menar på kunskapsspridning är svårt att få till och det ofta är samma fåtal företag som engagerar sig i demoprojekt. En aktör uttrycker att man måste över en viss kritisk massa i antalet användare för att andra ska våga satsa. De flesta verkar dock eniga om att demonstrationsprojekt är en bra sak, även om Kunskap och osäkerhet om ny teknik inte är ett av de större hindren i branschen. Det är inte alltid enskilda aktörer har resurserna att satsa på testning internt. Således finns även viss risk till att samma organisationer inte heller har resurser till att delta i demonstrationsprojekt, eller att sätta sig in i resultaten ifrån dem. Även ifrån litteratur inom området finns stöd för resonemanget att det ofta inte är tekniken i sig utan snarare marknadens framtida utveckling som hindrar. 215 VTI lyfter i sin rapport att även när tekniken är kommersiellt tillgänglig kan det finnas osäkerhet om utvecklingen på marknaden som hindrar, exempelvis utveckling av bränslepriser. 216 SOU 2013:84 hänvisar dock till internationella studier om att det kan finnas en misstro mot obeprövad teknik, men och går inte in djupare på detta Vierth, Inge (VTI): Why do CO2 emissions from heavy road freight transports increase in spite of higher fuel prices?, VTI: Landbaserade godstransporter, klimat och styrmedel, 2014; SOU 2013:84: Betänkande av Utredningen om fossilfri fordonstrafik, VTI: Landbaserade godstransporter, klimat och styrmedel, SOU 2013:84: Fossilfrihet på väg, december

145 6.7.3 Transaktionskostnader I godstransportbranschen är många företag små. Det som både intervjupersoner och expertpanelen framhåller är att dessa ofta har fullt upp med det operativa, och orkar inte ta sig förbi Transaktionskostnaderna, skaffa sig en nulägesbild över sin energianvändning och ta sig över tröskeln till att arbeta mer systematiskt med energi. VTI hänvisar i sin rapport till att Transaktionskostnader som beskrivits för energieffektiviseringar generellt i tidigare litteratur även är aktuella för transportsektorn. De skriver att Transaktionskostnader kan vara höga och att det kan finnas dolda kostnader. Vidare skriver de att Transaktionskostnaderna speciellt kan utgöra ett för mindre företag. 218 Deltagarna på expertpanelen menar vidare att vilket transportslag som ska användas vanligtvis väljs efter andra kriterier än energi, exempelvis snabbhet och flexibilitet. Som beställare finns inte tid och möjlighet att sätta sig in i alla transportmöjligheter. Lasten måste fram snabbt och med bibehållen kvalité. Detta får även stöd i litteraturen, där exempelvis SOU 2013:84 beskriver att kostnader och risker förknippade med att byta från ett etablerat transportupplägg hindrar att detta görs. 219 Både intervjupersonerna och expertpanelen pekar på värdet av att en organisation (såsom exempelvis ett åkeri) har en operativ drift som har kapacitet att ta emot information och förändra sitt arbetssätt. Som det ser ut idag är ofta mottagarkapaciteten ganska låg vad gäller exempelvis forskningsresultat Begränsad rationalitet På frågan om Begränsad rationalitet skiljer sig de intervjuades åsikter ganska mycket ifrån varandra. Vissa menar att människor i godstransportbranschen gärna kör på som man alltid gjort, det man vet fungerar, medan andra pekar på att om man inte agerar och är rationell så överlever man inte i en bransch med så små marginaler som godstransportbranschen. De flesta värderar hindret som litet, och i den totala sammanvägningen från intervjuerna faller Begränsad rationalitet ut som ett av de som påverkar minst. Expertpanelen värderar Begränsad rationalitet något högre, vilket kan bero på att intervjupersonerna i högre grad motsvarar aktörer och att varje aktör tenderar att i högre grad tillskriva sig själv ett rationellt förhållningssätt. I den svenska litteraturen rörande energieffektivisering i transportsektorn de senaste åren talas inte explicit om begreppet Begränsad rationalitet, dock nämns en del faktorer som kan härledas till detta begrepp. Bland annat i IVA-rapporten Energieffektivisering av Sveriges transportsektor nämns att inslag av stigberoende gör att de strukturer som byggs kring logistik och stadsplanering inte enkelt låter sig brytas. Rapporten menar vidare att människors preferenser och acceptans påverkar möjligheterna till ytterligare energieffektivitet i transportsektorn. 220 Koucky & Partners anger i sin rapport till Energimyndigheten att invanda rutiner och bristen på helhetssyn hos de aktörer som är inblandade i en godstransport är exempel på skäl till varför intermodala transportlösningar inte sker i högre utsträckning VTI: Landbaserade godstransporter, klimat och styrmedel, 2014; SOU 2013:84: Betänkande av Utredningen om fossilfri fordonstrafik, SOU 2013:84: Betänkande av Utredningen om fossilfri fordonstrafik, IVA: Energieffektivisering av Sveriges transportsektor, 2013; SOU 2013:84: Fossilfrihet på väg, Koucky & Partners, på uppdrag av Energimyndigheten, Energianvändning inom transportsektorn, december

146 6.7.5 Organisatoriska Även vad gäller frågan om Organisatoriska är intervjupersonernas bild splittrad: intervjupersonerna varierar mellan att värdera hindret som marginellt eller avgörande. Det som framkom ur intervjuerna är dock att eftersom åkerier (och många tåggodsföretag) vanligtvis är små fungerar informationsöverföringen internt vanligtvis bra, och incitamentsstrukturerna är inte så hämmande som på större företag. Företagen är överlag inte så hierarkiska; det är en kort väg mellan exempelvis ägare och lastbilschaufför. De som värderar Organisatoriska högt menar att det är avgörande att ledningen är drivande i energifrågan och följer upp energianvändningen. En internationell studie om principal agentproblem i åkerier som gjorts av Vernon & Meier pekar på att Delade incitament kan vara ett stort problem i de fall då föraren inte betalar för drivmedelsåtgången, då föraren såldes inte har incitament att hushålla med drivmedlet. 222 Det framkom dock i intervjuerna att många åkerier arbetar med detta, exempelvis genom att försöka skapa incitament för ecodriving. Ytterligare ett organisatoriskt som framhålls ifrån aktörer med mer systemöversikt är att eftersom organisationerna är så pass små kan det ibland kan vara svårt att få loss resurser till att delta i demonstrationsprojektprojekt Finansiella Godstransportbranschen är en bransch med små marginaler och bränslebesparande teknik har ofta höga kapitalkostnader. VTI hänvisar i sin rapport till internationella studier som påvisar att ekonomiska kan ha negativ påverkan på införandet av bränslebesparande teknik. 223 Trots detta framkom av intervjuer och expertpanelen att Finansiella i Sverige kan sägas vara ett litet i godstransportbranschen, eftersom lastbilshandlarna och till viss del även tågtillverkarna erbjuder finansieringslösningar vad gäller lastbilar, tåg, kreditrisk, servicepaket, livförsäkring med mera. De tillhandahåller således kapital för det mesta som påverkar energiåtgången (inköp av bil, service etcetera). Både intervjupersoner och expertpanelen menar istället på att det är en prioriteringsfråga, och att många åtgärder kan göras med snabb återbetalningstid. Därmed kan det sägas finnas små i form av brist på kapital. Dock lyfter intervjupersonerna fram problematiken med att godstransportbranschen är beroende av tåg- och lastbilshandeln. Trots ett utbud av finansieringslösningar framkom på enskilda intervjuer företag som säger sig ha Finansiella och att detta överskuggar allt. Därmed är intervjupersonernas värdering av Finansiella något högre än värderingen som gjordes under expertpanelen Policyinstabilitet I intervjuerna framkom det att brist på Policyinstabilitet upplevs som ett stort problem inom godstransporter. Intervjupersonerna pekar på svårigheten att förutse hur skatter och styrmedel kommer att utvecklas över tid, samt att besked om ändringar ofta kommer med kort framförhållning. Detta ger dålig utväxling på beslutet, eftersom branschen inte är förberedd. 222 Meier, Alan & Vernon, David: Identification and quantification of principal agent problems affecting energy efficiency investments and use decisions in the trucking industry, VTI: Landbaserade godstransporter, klimat och styrmedel, december

147 Som nämndes tidigare i kapitel lyfter VTI att det ofta är osäkerheten över marknadsutvecklingen (som till stor del policys styr över vad gäller transportsektorn) som påverkar, snarare än osäkerheten vad gäller själva tekniken. 224 I intervjuerna framkom även att många aktörer är brända sedan tidigare vad gäller policyförändringar. Ett konkret exempel på policyinstabilitetens påverkan som lyfts fram är att ett antal åkare sett över möjligheten att installera en egen RME-tankanläggning, men att indikationer om potentiella skattehöjningar på RME gör att man avvaktar. Intressant är att utfallet på expertpanelen var att Policyinstabilitet inte alls var ett så betydande som intervjupersonerna bedömt det. Expertpanelen menade att detta kan bero på att aktörerna ser en möjlighet att skylla på något externt. Samtidigt ansåg även expertpanelen på att långsiktighet inom policies är viktigt. En annan möjlig förklaring till skillnaderna i utfall kan vara att deltagarna i expertpanelerna i större utsträckning följer med i debatter om styrmedelsändringar än enskilda aktörer, och att ändringsförslag i vissa fall därmed inte är lika överraskande för dem. Den upplevda policyinstabiliteten kan vara högre än den faktiska, och även den upplevda påverkar beslut och åtgärder om energieffektiviseringar. Ytterligare något som både intervjupersoner och expertpanelen framhöll som hindrande för ökad energieffektivitet var att regler och lagar kring karbotage inte följs, exempelvis tar utländska åkare ofta in mycket mer drivmedel i Sverige än vad som är tillåtet. Detta skapar en prispress som tar transporter både ifrån tåg och ifrån andra lastbilstransporter, och då ofta ifrån mer energieffektiva lastbilstransporter (exempelvis har svenska åkerier i högre utsträckning nyare och mer energieffektiva motorer). Det är dock inte givet att denna problematik bör sorteras in under policyinstabilitet. I SOU 2013:84 hänvisas till en studie från 2012 (Lindholm, 2012) som menar att aktörer, inklusive politiker, har dålig kunskap och intresse om transportfrågor. 225 Detta riskerar att ge upphov till policyinstabilitet. Ett flertal studier framhåller också att den begränsade infrastrukturen vad gäller både väg och spår, samt osäkerheten kring hur denna kommer att utvecklas framöver, påverkar satsningar på transportöverflytt och viss annan typ av energieffektivisering inom transporter negativt VTI: Landbaserade godstransporter, klimat och styrmedel, 2014; SOU 2013:84: Betänkande av Utredningen om fossilfri fordonstrafik, SOU 2013:84: Betänkande av Utredningen om fossilfri fordonstrafik, IVA: Energieffektivisering av Sveriges transportsektor, 2013; Koucky & Partners, på uppdrag av Energimyndigheten, Energianvändning inom transportsektorn, 2014; SOU 2013:84: Betänkande av Utredningen om fossilfri fordonstrafik, december

148 6.7.8 Swecos samlade bedömning för godstransporter Figur 42 visar Swecos sammanvägda bedömning för hur stor del de olika hindren påverkar energieffektiviseringar i godstransporter. Figur 42: Fördelning av i godstransporter 20% 20% Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader 5% 10% Begränsad rationalitet Organisatoriska 15% 14% 16% Finansiella Policyinstabilitet Källa: Sweco, 2014 Asymmetrisk information bedöms totalt för sektorn till 20 procent. Denna har justerats upp jämfört med intervjupersonernas bedömning. De intervjuade aktörerna inom lastbilstransporter hade generellt inte bedömt detta som ett stort, eftersom de menar att de själva betalar sitt drivmedel och såldes har incitament att hålla nere åtgången. Intervjupersonerna har främst svarat utifrån sig själva, medan expertpanelen dock identifierar ett antal exempel på Asymmetrisk information sett ur ett systemperspektiv. I den bedömning expertpanelens gör framhålls att det är ett flertal aktörer involverade i en lastbilstransport och att det ofta finns Delade incitament och att det råder brist på transparens. Detta har enligt deltagarna på expertpanelen negativ påverkan på samordning, överflytt, lastfyllnadsgrader, ruttoptimering och ibland även förändringskraft i branschen. Vad gäller tåg framkom både från intervjuer och från expertpanel att avsaknaden av separat elmätning skapar Delade incitament och reducerar incitament att hålla nere elanvändningen i tåg. Kunskap och osäkerhet kring ny teknik bedöms totalt till 10 procent. Detta ligger i linje med vad både intervjupersoner och expertpanel bedömer. De som intervjuats uppger att de inte är särskilt osäkra på ny teknik, något som kan bero på att de generellt sett ligger något längre fram än branschen i snitt. De med mer systemöverblick, främst deltagarna i expertpanelen, ger uttryck för att det ibland är svårt att nå ut med ny teknik till alla aktörer i 19 december

149 branschen: ofta är de främst de i framkant som deltar i demonstrationsprojekt och som nås av resultaten från dessa. Både intervjupersoner och expertpanel framhåller dock att den politiska osäkerheten hindrar mer än den tekniska. Transaktionskostnader bedöms totalt till 16 procent, vilket är ungefär den bedömning som både intervjupersoner och expertpanel gör. Hindret är ganska stort, vilket till viss del förklaras av att många aktörer inom godstransportbranschen är små och har fullt upp med det operativa. Detta gör att en del inte kommer över tröskeln till att arbeta mer strukturerat med energieffektivitet. Expertpanelen framhåller även att beställarna också upplever Transaktionskostnader vad gäller val av transportslag. Att last vanligtvis måste fram snabbt och med bibehållen kvalité gör att aktörer inte väljer att lägga tid på att även ta hänsyn till energieffektivitet. Begränsad rationalitet bedöms totalt till 14 procent. Detta ligger mellan expertpanelens och intervjupersonernas bedömning: intervjupersonerna hade värderat det ett par procent lägre och expertpanelen ett par procent högre. Från intervjuer och expertpanel framhålls från vissa att det kan finnas en negativ inställning mot förändring, samtidigt som andra menar att om man inte agerar och är rationell överlever man inte i en bransch med så små marginaler som godstransportbranschen. Organisatoriska bedöms totalt till 15 procent. Expertpanelen värderar hindret några procent högre. Dock framkom att flera deltagare under expertpanelen väger in problem med samordning mellan aktörer i sin värdering av Organisatoriska, något som Sweco sorterar in under Asymmetrisk information. Att många företag i branschen är små reducerar de organisatoriska hindren genom att god informationsöverföring internt finns. Dock kan Organisatoriska finnas vad gäller möjlighet att avsätta resurser för energiarbete. Deltagarna i intervjuer och expertpanel framhåller även att ledningens engagemang för frågan är avgörande, något som tycks återkomma oavsett storlek på företag. Finansiella bedöms totalt till 5 procent. Godstransportbranschen är en bransch med små marginaler. Trots detta framkom av intervjuer och expertpanelen att Finansiella i Sverige kan sägas vara ett litet i godstransportbranschen, eftersom lastbilshandlarna och till viss del även tågtillverkarna erbjuder olika former av finansieringslösningar. Trots ett utbud av finansieringslösningar framkom på enskilda intervjuer företag som säger sig ha Finansiella och att detta överskuggar allt. Därmed är intervjupersonernas värdering av Finansiella något högre än värderingen som gjordes under expertpanelen Policyinstabilitet bedöms totalt till 20 procent. I intervjuerna framkom det att brist på Policyinstabilitet upplevs som ett stort problem inom godstransporter. Intervjupersonerna pekar på svårigheten att förutse hur skatter och styrmedel kommer att utvecklas över tid, samt att besked om ändringar ofta kommer med kort framförhållning. Expertpanelens bedömning är dock väsentligt lägre än intervjupersonernas. Den upplevda policyinstabiliteten kan vara högre än den faktiska, och en möjlighet är att intervjupersonerna (delvis på grund av Transaktionskostnader) inte följer med i debatten om ändrade policys och således ofta upplever att policyförändringar kommer plötsligt. Både expertpanelen och intervjupersonerna ger dock uttryck för att långsiktighet inom policys är viktigt. 19 december

150 7 Storlek på respektive En av huvudfrågorna för denna rapport är att belysa hur stora identifierade marknadsmisslyckanden och bedöms vara. I detta kapitel presenteras Swecos samlade bedömning av storleken på respektive inom sektorerna flerbostadshus, kontorslokaler, småhus, energiintensiv industri, övrig tillverkande industri, godstransporter samt persontransporter. Underlag för bedömningarna har utgjorts av intervjuer, expertpaneler, litteratur och Swecos samlade kompetens. 7.1 Externa effekter Negativa externa effekter är ett marknadsmisslyckande och kan då internaliseringsgraden är för låg sägas hindra att energi används på en samhällsekonomiskt lämplig nivå, Givet dess karaktär hanteras dock denna på ett annat sätt än de övriga hindren i denna utredning. Storleken på de negativa externa effekterna har inte kvantifierats per sektor och i TWh. Istället har storleken på de negativa externa effekterna sammanfattats utifrån befintlig litteratur. Detta har gjorts för elanvändning, värmeproduktion och för transportsektorn. Förutom storleken på de negativa externaliteterna har även internaliseringsgraden bedömts. Den ansats som gjorts är att alla skatter och avgifter som påverkar det pris som slutkunden möter (på marginalen) har tagits med i beräkningen. De externa effekterna är av betydelse, samtidigt som internaliseringsgraden är lägre än 100 procent för de flesta energislag och aktörer. Internaliseringsgraden syftar till att ge korrekta prissignaler, vilket generellt sätt är av vikt. Dock är prissignalen som möter slutkunderna något som enbart indirekt adresserar de negativa externa effekterna. Detta gäller exempelvis vad gäller elproduktion: skatten på el, elcertfikat och utsläppsrätter skapar incitament att sänka elanvändningen generellt (vilken kan innebära att fossilbaserad produktion på marginalen faller bort), men skapar egentligen inte incitament att justera exempelvis elmix. Ett annat exempel är att en högre kärnkraftsskatt inte påverkar elpriset om inte denna ligger på marginalen, eller ifall den högre skatten gör så att det inte blir lönsamt med kärnkraftsproducerad el och sådan produktion faller bort. I bedömningen av storlek fokuserar därför denna studie på de mer direkta hindren för energieffektivisering. Generellt sätt bör dock eftersträvas att negativa externa effekter återspeglas i prissignalen som möter aktörerna på marginalen 227. I kapitel 7.4 beskrivs samverkan mellan externa effekter och de övriga sju hindren. 7.2 Hindrens storlek Procentsatsen relaterar till andelen av ingenjörspotentialen som tidigare beskrivits i kapitel 5. Storleken på de olika hindren kan beskrivas dels utifrån ett sektorperspektiv och dels utifrån hur stort hindret är totalt över alla studerade sektorer. I Figur 43 visas hur den sammanlagda hindrade energin (för alla studerade sektorer) fördelar sig på respektive. Som kan ses i bilden är Begränsad rationalitet, Kunskap och osäkerhet om ny teknik samt Organisatoriska de tre största hindren totalt sett. Noterbart är även att det inte är en stor skillnad i storlek mellan hindren. 227 Dock behövs då tas hänsyn till internaliseringsgrad i andra konkurrerande länder. Detta i syfte att inte snedvrida marknader och riskera carbon leakage. 19 december

151 Exempelvis förhindrar det största hindret (Begränsad rationalitet) 17 procent av energieffektiviseringspotentialen, medan det minsta hindret (Asymmetrisk information) förhindrar 10 procent. Utifrån detta kan sägas att alla är av betydelse, samt att det ofta handlar om en samverkan mellan. Figur 43: Fördelningen av den energi [TWh] totalt i de studerade sektorerna som hindras av respektive Policyinstabilitet; 10,4 Asymmetrisk information; 7,2 Kunskap, osäkerhet om ny teknik; 11,2 Finansiella ; 8,8 Organisatoriska ; 10,6 Transaktionskostnader; 10,1 Källa: Sweco Begränsad rationalitet; 12,0 Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader Begränsad rationalitet Organisatoriska Finansiella Policyinstabilitet 19 december

152 I Figur 44 nedan visar den bedömda storleken på respektive, uppdelat efter hur mycket som härrör till respektive sektor. Som nämndes ovan är det Begränsad rationalitet som sammantaget för de sju sektorerna utgör det största hindret, cirka 12 TWh på årsbasis. Som kan ses i Figur 44 är Begränsad rationalitet ett medelstort eller stort hindren för alla sektorer var för sig, vilket gör att den sammanvägd faller ut som störst. Eftersom det alltid på något sätt är människor som fattar beslut, och Begränsad rationalitet alltid förekommer inom ramen för mänskligt beslutsfattande, är det förståeligt att detta återkommer som ett förekommande i de olika sektorerna. Figur 44: Bedömd storlek per Policyinstabilitet Finansiella Organisatoriska Begränsad rationalitet Transaktionskostnader Kunskap, osäkerhet om ny teknik Asymmetrisk information TWh Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa Sweco 19 december

153 Figur 45 nedan visar en samlad bild över den bedömda storleken på respektive i TWh för de sju sektorerna. Figur 45: Hinder per sektor Lokaler - kontor Godstransport Övrig industri Flerbostadshus Småhus Persontransport Energiintensiv industri Källa Sweco, TWh Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader Begränsad rationalitet Organisatoriska Finansiella Policyinstabilitet De största totala hindren uttryckt i TWh per år återfinns inom sektorn energiintensiv industri, drivet av sektorns höga totala energianvändning och storleken på ingenjörspotentialen i denna sektor. Om vi tittar på hur hindren fördelar sig procentuellt i respektive sektor kan vi se i Figur 46 att även om sektorenas summa av Begränsad rationalitet är det största hindret så är det endast inom persontransporter och småhus som Begränsad rationalitet är ett av de största hindren i relation till övriga inom sektorn. 19 december

154 Figur 46: Hindrens procentuella fördelning per sektor 100% 90% 80% 70% 60% 50% 40% 30% 20% 10% 0% Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa Sweco, 2014 Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader Begränsad rationalitet Organisatoriska Finansiella Policyinstabilitet 19 december

155 TWh Kvantitativ utvärdering av marknadsmisslyckanden och 7.3 Hindrens karaktär Hindren kan grupperas i tre olika grupper utifrån deras karaktär; rena marknadsmisslyckanden, verksamhetsrelaterade samt omvärldsrelaterade. Hinder i form av rena marknadsmisslyckanden utgörs av Asymmetrisk information och kunskap och osäkeret om ny teknik. Den bedömda storleken på dessa visas Figur 47 nedan. Asymmetrisk information uppgår till cirka 7 TWh och Kunskap och osäkerhet om ny teknik till cirka 11 TWh. Totalt cirka 18 TWh. Figur 47: Marknadsmisslyckandens storlek per sektor Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa: Sweco, 2014 Asymmetrisk information Kunskap, osäkerhet om ny teknik 19 december

156 TWh Kvantitativ utvärdering av marknadsmisslyckanden och De mer verksamhetsrelaterade hindren Transaktionskostnader, Begränsad rationalitet och Organisatoriska uppgår totalt till cirka 10 TWh, 12 TWh respektive 10 TWh totalt för alla sektorer. Fördelningen inom respektive sektor visas i Figur 48 nedan. Hindret Organisatoriska är som synes försumbart för småhussektorn/privatpersoner. Figur 48: Verksamhetsrelaterade s storlek per sektor Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Transaktionskostnader Begränsad rationalitet Organisatoriska Källa Sweco, 2014 För den energiintensiva industrin är Organisatoriska det största hindret. 19 december

157 TWh Kvantitativ utvärdering av marknadsmisslyckanden och De mer externa hindren ur verksamhetsdrivarens perspektiv Finansiella och Policyinstabilitet uppgår till cirka 9 TWh respektive 10 TWh totalt för alla sektorer, visas i Figur 49. Andelsmässigt är Finansiella störst i industrisektorerna (15 procent) samt småhussektorn (15 procent). Policyinstabilitet är procentuellt störst i Transportsektorerna med 20 procent i vardera sektorn. Figur 49: Omvärldsrelaterade/externa s storlek per sektor Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa Sweco, 2014 Finansiella Policyinstabilitet 19 december

158 En jämförelse mellan de tre olika kategorierna visar att för nästan alla sektorer är den största gruppen de verksamhetsinterna hindren, se även Figur 50. De verksamhetsinterna hindren kan vara svårt att från statens håll överbrygga på ett kostnadseffektivt sätt. Detta beror både på att det är svårt för staten att ha rådighet över företags interna beslutsprocess, dels på att det riskerar att störa marknaden och snedvrida konkurrens om staten aktivt går in och hjälper vissa företag med deras verksamhetsinterna utmaningar. För kontorslokaler är gruppen marknadsmisslyckande lika stor som verksamhetsinterna. Detta beror främst på att Asymmetrisk information är sektorns största. Figur 50: Fördelning av marknadsmisslyckanden, verksamhetsinterna respektive externt relaterade 100% 90% 80% 70% 60% 50% 40% 30% 20% 10% 0% Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa: Sweco, 2014 Marknadsmisslyckanden summa Verksamhetsrelaterat summa Externt relaterat summa 19 december

159 7.4 Samverkan med externa effekter I detta kapitel görs en ansats att koppla ihop marknadsmisslyckandet externa effekter till andra identifierade. Detta görs genom att återkoppla till internaliseringsgrad (se kapitel 4), samt att beakta prissignalens styrka och priselasticiteten i respektive sektor. Trots eventuell överinternalisering kan priset ändå uppfattas som lågt av aktörerna i en sektor. Därför bedöms huruvida det finns i de olika sektorerna som gör att prissignalen inte når fram. Ett exempel på detta kan vara att Asymmetrisk information föreligger, vilket leder till att prissignalen inte uppfattas av den aktör som har möjlighet att påverka energiåtgången. Det kan även bero på andra externa faktorer. Exempelvis är elpriset idag lågt vilket gör att kostnaden för elanvändningen är låg i förhållande till disponibel inkomst, trots en stor skattedel i elpriset. Om målgruppen har låg total energianvändning eller är mycket prisokänslig kan detta också påverka. En låg energianvändning och en totalt sett låg kostnad för elanvändning i förhållande till disponibel inkomst kan göra att personen i fråga inte finner det värt att lägga tankemöda på. Detta benämns ibland rational inattention och handlar om begränsningar i förmågan att processa information, vilket gör att även då all information finns tillgänglig tar varje enskild person bara en begränsad del av denna i beaktning vid beslutsfattandet. 228 Detta är även kopplat till hindret begränsad rationalitet, som bland annat handlar om att beslutsfattandet inte sker med hänsyn till alla parametrar. Om målgruppen istället är mycket prisokänslig kan det istället handla om att målgruppen värderar nyttan energin ger väldigt högt; så högt att det känns värt att betala en kännbar summa pengar för denna nytta Flerbostadshus Flerbostadshus köper främst in energi i form av el och fjärrvärme, även om gas, biobränslen och fossila bränslepannor för värmeproduktion även förekommer. Det konstaterades i kapitel 4 att de externa kostnaderna för elproduktion är överinternaliserade för hushållskunder. Vad gäller värmeproduktionen indikerade resultaten att de externa kostnaderna är internaliserade till cirka 65 procent. Trots hög internaliseringsgrad på el är dock incitamenten för en person som bor i ett flerbostadshus inte särskilt höga att aktivt arbeta för att hålla nere energianvändningen: elräkningen är ändå överlag liten i absoluta tal och liten i förhållande till disponibel inkomst. De potentiella vinsterna av minskad energianvändning är därmed också små, vilket innebär bland annat innebär att även små Transaktionskostnader (exempelvis tidsanvändning eller ansträngning för att engagera sig i frågan) kan göra att det inte upplevs som motiverat att vidta energieffektiviserande åtgärder. Kostnaden för värmen faller i de allra flesta fallen på flerbostadshusägaren. Detta är en ganska stor post totalt (värmen för hela huset/husen). Således finns incitament för flerbostadsägaren att arbeta med energikostnaderna. En del åtgärder är idag inte lönsamma med dagens värmekostnad. Om internaliseringsgraden för värme höjdes skulle fler åtgärder vara lönsamma. Eftersom flerbostadsägare generellt arbetar med energifrågan (i någon mån) idag skulle troligtvis en högre energieffektivitet nås om priset för värme ökade. Notera dock att en del flerbostadshus värms med el, och att elens externa kostnader redan är 228 Economist s view: Rational inattention, hämtat från den 9 december december

160 överinternaliserade. Om skatten på el skulle höjas ytterligare skulle detta inte vara motiverbart utifrån ett internaliseringsperspektiv, utan snarare i syfte att förstärka prissignalen än mer ( överstärka den) alternativt få mer skatteintäkter till staten. För flerbostadshusägare samspelar prissignalen med hindret Kunskap och osäkerhet om ny teknik: om det anses osäkert om en teknik kommer att fungera och den potentiella ekonomiska vinningen är låg är det troligt att man inte väljer att genomföra åtgärden. Ett för lågt pris (som kan komma av en låg internaliseringsgrad, men även andra faktorer) kan även göra att organisationen inte väljer att lägga resurser på energifrågan, vilket innebär Organisatoriska och ökade Transaktionskostnader Kontorslokaler Likt för flerbostadshus köper lokaler främst in el i form av el och fjärrvärme, även om gas, biobränslen och fossila bränslepannor även förekommer. De företag som uppehåller sig i kontorslokaler har en större elräkning än enskilda lägenhetskunder. Samtidigt är kontorsel en mycket liten kostnadspost, relativt sett, för dessa typer av företag. Detta trots att de externa effekterna som möter aktörer i kontorslokaler är internaliserade. Här påverkar hindret Transaktionskostnader: besparingen är liten jämfört med ansträngningen och tiden att engagera sig i frågan. Det blir heller inte lönsamt för de flesta företag i kontorslokaler att avsätta resurser till att arbeta med elanvändningen, enbart för stora företag kan det vara motiverat ur ett kostnadsperspektiv. Dock finns idag en trend mot att företag som upphåller sig i kontorslokaler vill arbeta med sin energianvändning av miljöskäl och för att använda detta i sin marknadsföring. Det varierar huruvida det är ägaren till kontorslokalhuset eller de som upphåller sig i lokalerna som betalar värmeräkningen. I de fall det är de som uppehåller sig i lokalerna som betalar kan ett liknande resonemang som för elen föras: kostnadsposten är generellt för liten för att engagera. Detta skulle gälla även om värmeproduktionens externa kostnader internaliserades fullt ut. Även om prissignalen till viss del finns där hindras den av Asymmetrisk information mellan den som äger lokalen och den som uppehåller sig där. I de fall hyresvärden betalar värmeräkningen är dock incitamentet tydligare. Med ett högre pris på värme skulle prissignalen stärkas och troligtvis fler energieffektiviseringsåtgärder komma till stånd. För hyresvärden kan prissignalen samspela med hindret Kunskap och osäkerhet om ny teknik: om en teknik anses osäker om den kommer fungera och den potentiella ekonomiska vinningen är begränsad är det troligt att åtgärden inte väljer att utföras. Ett för lågt pris (som kan komma av en låg internaliseringsgrad, men även andra faktorer) kan även göra att organisationen inte väljer att lägga resurser på energifrågan, vilket innebär Organisatoriska och ökade Transaktionskostnader. 19 december

161 7.4.3 Småhus Småhusägare köper in energi i form av el, fjärrvärme, gas, biobränslen och fossila bränslen. Den hushållsel som används står för ungefär 30 procent av den totala energiåtgången. Det finns vissa incitament för småhusägare att energieffektivisera, men det hindras ofta av Transaktionskostnader. För uppvärmning inom sektorn är el dominerande (cirka 43 procent), biobränslen näst störst (cirka 37 procent), fjärrvärme tredje störst (cirka 18 procent) och olja därefter (knappt 3 procent). 229 Utöver detta tillkommer hushållselen. Det konstaterades i kapitel 4 att de externa kostnaderna för elproduktion är överinternaliserade för hushållskunder. Vad gäller värmeproduktionen indikerade resultaten att dessa är internaliserad till cirka 65 procent. Energikostnaderna för en småhusägare, speciellt uppvärmningsdelen, är ofta betydande i förhållande till disponibel inkomst. Därmed finns vissa incitament för småhusägarna att arbeta med energieffektivitet. Om internaliseringsgraden höjdes ytterligare för de olika underinternaliserade energislagen finns anledning att tro att detta skulle leda till ökad energieffektivitet. Samtidigt skulle troligtvis fler gå över till elvärme (värmepump i de flesta fall), vilket trots överinternalisering i många fall ändå är ett prisvärt alternativ. Transaktionskostnader och Begränsad rationalitet kan medföra att prissignalen inte uppfattas av målgruppen: man har inte tid/ork/lust att sätta sig in i hur energi och energieffektiviseringar fungerar. Se kapitel 6 för beskrivning av övriga för energieffektivisering i småhussektorn Energiintensiv industri Energiintensiv industri köper främst in energi i form av el och bränslen (både fossila och förnybara). El till energiintensiv industri har en lägre skattesats än för övrig elanvändning. De betalar inte heller elcertifikat. I kapitel 4 görs bedömningen att med dagens prisnivåer på utsläppsrätter energiintensiv industri inte bär sina externa kostnader. Inte heller den energi industrin använder till värmeframställning till processer bär enligt dessa bedömningar sina externa kostnader. Detta innebär att prissignalen möjligtvis skulle kunna vara något starkare. Givet vilken stor kostnadspost energi är för den energiintensiva industrin finns anledning att tro att en högre internaliseringsgrad (genom skatt eller ett högre pris på utsläppsrätter) skulle leda till fler energieffektiviseringsåtgärder i den energiintensiva industrin. Samtidigt skulle även andra bieffekter kunna uppstå, såsom att viss produktion riskerar att minska i Sverige (speciellt på sikt) och att Sveriges konkurrenskraft riskerar att försämras. Organisatoriska som Delade incitament internt till följd av skilda budgetposter för investeringar och för driftskostnader, incitamentssystem samt stort fokus på kvartalsrapporter kan leda till att även dagens prissignal inte når fram fullt ut till de energiintensiva industriföretagen. Om risken för produktionsstopp (vilket i viss utsträckning kan relatera till hindret Kunskap och osäkerhet om ny teknik) bedöms vara större än den ekonomiska vinningen givet dagens elpris kan även det hindra energieffektiviseringar. Med ett högre elpris hade incitamenten att ta risken varit större. 229 Energimyndigheten: Energiläget 2013, december

162 7.4.5 Övrig tillverkande industri Övrig tillverkande industri köper främst in energi i form av el och bränslen (både fossila och förnybara). Övrig tillverkande industri betalar samma energiskatt som elintensivindustri, 0,5 öre/kwh. Trots att de, till skillnad från den energiintensiva industrin, betalar elcertifikat innebär den låga skattesatsen att övrig tillverkande industri inte bär sina externa kostnader vad gäller elanvändningen. Vad gäller den energi industrin använder till värmeframställning till processerkan visar bedömningarna på att de inte heller här bär sina externa kostnader. Organisatoriska internt såsom Delade incitament internt som kommer av skilda budgetposter för investeringar och driftskostnader, incitamentssystem samt stort fokus på kvartalsrapporter, kan leda till att prissignalen inte når fram fullt ut. För övrig tillverkande industri är energi ofta inte en betydande kostnadspost, beroende på storleken på den samlade elanvändningen. Transaktionskostnaderna för energieffektiviseringar kan därför ofta upplevas som större än den potentiella vinningen. Detta kan även leda till Organisatoriska i form av att företaget inte avsätter resurser för att arbeta med frågan Persontransporter I kapitel 4 redovisas de externa effekterna per transportslag. Varken för personbilar (bensinbilar och dieselbilar) eller persontåg bedöms de externa effekterna vara internaliserade. Viktigt att notera är dock att persontåg har betydligt lägre externa effekter än personbilar. Dessutom har tåg den högsta bedömda internaliseringsgraden, 92 procent, medan bensinbilar har 88 procent och dieseldrivna bilar 63 procent. Om internaliseringsgraden höjdes för personbilar skulle troligtvis bilar användas något mindre (överflytt till andra transportslag samt undvikande av transporter). Dock är bilåkande redan idag en betydande kostnadspost för privatpersoner och priselasticiteten har visat sig vara låg. Den marginella effekten av ökad internaliseringsgrad kan därför vara låg. Drivmedelskostnaden (som till stor del kommer att skatterna på dessa) är dock också ett incitament för fordonsindustrin att ta fram och marknadsföra energieffektiva bilar. Högre pris på bensin och diesel kan således komma att öka marknadsandelen för bränslesnåla bilar och bilar som kör på alternativa drivmedel (exempelvis elbilar). Dagens prissignal är som nämnt tidigare av betydande storlek för många, trots detta påverkar preferenser, vanor med mera så att prissignalen inte alltid får den verkan som beslutsfattare anser önskvärt. Även Transaktionskostnader kan hindra att privatpersonerna orkar ta hänsyn till kostnaden för bilkörande. Vad gäller persontåg är de externa kostnaderna nästan fullt ut internaliserade. Sett ifrån klassisk nationalekonomiskt synsätt bör alla aktörer bära sina externa kostnader fullt ut. Med tanke på att flera andra transportslag har en ännu lägre internaliseringsgrad är det inte självklart att en högre internaliseringsgrad för persontåg isolerat sett skulle vara positivt. Det skulle kunna medföra att relativpriserna mellan exempelvis tåg och bil snedvrids ytterligare. En stor energieffektivisering kan uppnås genom att överföra mer persontransporter från bilism till tåg och en högre internaliseringsgrad för tåg, isolerat sett, skulle ha motsatt effekt. 19 december

163 7.4.7 Godstransporter I kapitel 4 redovisas de externa effekterna per transportslag. Varken för lätt lastbil, tung lastbil utan släp, tung lastbil med släp eller godståg bedöms de externa effekterna vara internaliserade. Internaliseringsgraden är lägst för godståg (30 procent) följt av tung lastbil utan släp (35 procent) och högst för lätt lastbil (74 procent). Tung lastbil med släp har en internaliseringsgrad på 45 procent. Det skiljer sig åt mycket rörande storleken på de externa effekterna, där tung lastbil utan släp har högst externa effekter och godståg lägst. Kostnaden för transport är en liten del av en varas värde. Det skulle vara lönsamt att transportera varan även om priset för transport skulle stiga mycket. En högre internaliseringsgrad skulle således inte minska antalet transporter. Godstransportköpare beaktar dock kostnaden för transporter, så om internaliseringsgraden höjdes för ett av transportslagen finns anledning att tro att ett skifte skulle ske mot andra transportslag. Om internaliseringsgraden för fjärrtransporter på väg höjdes skulle incitamenten att flytta en del godstransporter till tåg stärkas. Mycket viktigt att notera är även att det finns många andra faktorer som är viktiga vid val av transportslag: flexibilitet, tidsåtgång med mera. Att varan kommer fram i tid och med bibehållen kvalité är i många fall viktigare än själva transportkostnaden. Lastbilar har dessutom en betydligt större räckvidd än tåg (och sjöfart). I tillägg är kapacitetsutnyttjandet på järnvägen hög på många sträckor, vilket begränsar möjligheterna till överflyttning av transporter. Således är det mycket av transportarbetet som skulle fortsätta att gå på väg även om vägtransporternas externa kostnader internaliserades i högre utsträckning och prissignalen därmed förstärktes. Asymmetrisk information mellan aktörer kan ibland även göra att prissignalen förvrängs (kan bli både högre och lägre än den faktiska ) genom mellanhänder och begränsad transparens mellan slutlig transportbeställare och den aktör som faktiskt utför transporten. 19 december

164 8 Vilka kan anses viktiga att åtgärda? I syfte att få en prioritering och viss värdering av vilka som anses viktiga att åtgärda, genomfördes bedömningar av dessa under de expertpaneler Sweco höll. Expertpaneler genomfördes för i huvudsak tre sektorer; flerbostadshus, godstransporter och industri. Panelerna ombads ge sin bedömning hur angeläget det är att åtgärda definierade ur bland annat ett samhällsekonomiskt perspektiv. Swecos projektgrupp genomförde sedan en separat bedömning av hur angeläget det är att åtgärda respektive i sektorerna ur ett samhällsekonomsikt perspektiv. Projektgruppens och expertpanelens bedömning av angelägenhetsgraderna vägdes därefter ihop 230. Resultaten från bedömningar redovisas i det följande med kommentarer kring tolkningar av resultaten. Marknadsmisslyckandet negativa externa effekter har inte kvantifierats på samma sätt som de övriga hindren och dess angelägenhetsgrad att åtgärdas har inte heller bedömts på expertpanelerna. Istället konstaterar studien enbart att det generellt är eftersträvansvärt att negativa externa effekter internaliseras i så stor utsträckning som möjligt. Dock behöver hänsyn tas till andra negativa följdeffekter detta kan få, som exempelvis försämrad konkurrenskraft och carbon leakage om Sverige internaliserar de negativa externa effekterna i högre utsträckning än vad andra länder gör. Det samhällsekonomiska perspektivet för bedömning av hur angeläget det är att åtgärda de olika hindren är i princip synonymt med definitioner i den neoklassiska modellen och förekomsten av marknadsmisslyckanden. Dock kan vissa motivera ett statligt ingripande även om det inte ses som ett renodlat marknadsmisslyckande. Ett exempel på detta är höga Transaktionskostnader. Med Transaktionskostnader avses sökkostnader för att hitta rätt produkt och rätt företag samt eventuella kostnader för att förhandla fram avtal och genomföra en affär. Läroboken underlättar analysen av marknader genom att anta att det inte finns några Transaktionskostnader samt att alla aktörer har all information de behöver. I verkligheten kostar alla transaktioner tid och ibland pengar och det kostar att informera sig. Ibland är dessa kostnader relativt små medan de andra gånger är mycket höga, t.ex. vid husköp. Dessa kostnader är verkliga kostnader som måste beaktas av rationella aktörer. Transaktionskostnader är i sig inget marknadsmisslyckande utan har som all annan resursanvändning en alternativkostnad. Staten kan dock ibland genom skalfördelar överbrygga detta mer effektivt än om alla enskilda aktörer ska göra detta själva. I denna studie har angelägenheten att åtgärda (inklusive marknadsmisslyckanden) gjorts med hänsyn tagen till dessa faktorer: Rådighet Potentiell energibesparing Mest värde för pengarna Konkurrenskraft (Sveriges konkurrenskraft i världen kan försämras om Sverige internaliserar externa effekter medan andra länder inte gör det) Snedvridning av konkurrensen mellan branscher Snedvridning av konkurrensen inom en viss bransch 230 För sektorerna småhus, lokaler och persontrafik genomfördes en bedömning endast av Sweco. 19 december

165 8.1 Bedömning av angelägenhetsgrad Resultaten av de sammanvägda bedömningarna finns samanställda i Tabell 10. De mörkare gröna fälten indikerar vilket som kan anses mest angeläget att åtgärda. De rödmarkerade fälten indikerar vilka som inte ska åtgärdas och i vissa fall vara nästan skadligt att åtgärda. Siffrorna i matrisen representerar ett medelvärde av de bedömningar som expertpaneler och Sweco gjort med en skala från -3 till +3 utan nollvärde. Då antalet deltagare varierat i expertpanelerna har summorna normerats på antal deltagare. Tabell 10: Sammanvägd bedömning av hur angeläget det är att åtgärda respektive i olika sektorer Asymmetrisk information Kunskap & osäkerhet om ny teknik Transaktions kostnader Begränsad rationalitet Organisatoriska Finansiella Policy instabilitet Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa: Sweco, 2014 Generellt för merparten av sektorer konstateras att hindren Kunskap och osäkerhet om ny teknik samt Policyinstabilitet är angelägna att åtgärda. En fördjupning för dessa i alla sju sektorer görs i det följande. I Figur 51 och Figur 52 visas matriser med den bedömda angelägenheten i förhållande till storleken på hindret Kunskap och osäkerhet om ny teknik dels i procent och dels i bedömda TWh, för alla sektorer. Som framgår av matriserna är det inte bara den absoluta storleken på hindret som gör det angeläget att åtgärda. För den energiintensiva industrin är storleken på hindret mer än dubbelt så stort i TWh som för de andra sektorerna, men hindret anses mer angeläget att åtgärda för persontransporter. 19 december

166 Storlek på TWh Storlek på Kvantitativ utvärdering av marknadsmisslyckanden och Figur 51: Angelägenhet vs i procent 25% Kunskap & osäkerhet om ny teknik 20% 15% 10% 5% Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor 0% Angeläget att åtgärda Källa: Sweco, 2014 Figur 52: Angelägenhet vs i TWh 6 Kunskap & osäkerhet om ny teknik Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Angeläget att åtgärda Källa: Sweco, 2014 Policyinstabilitet är också ett som bedöms angeläget att åtgärda. Figur 53 och Figur 54 visar matriser med den bedömda angelägenheten i förhållande till storleken på hindret Policyinstabilitet dels i procent och dels i bedömda TWh, för alla sektorer. Även här faller 19 december

167 Storlek på Storlek på Kvantitativ utvärdering av marknadsmisslyckanden och persontransporter ut som mest angeläget att åtgärda. Även småhus kommer högt upp på angelägenhetsgraden för åtgärder. Figur 53: Angelägenhet vs i procent 25% Policyinstabilitet 20% 15% 10% 5% Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor 0% Angeläget att åtgärda Källa: Sweco, 2014 Figur 54: Angelägenhet vs i TWh 5 Policyinstabilitet Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Angeläget att åtgärda Källa: Sweco, december

168 8.1.1 Specifikt för kontorslokaler För sektorn kontorslokaler får Asymmetrisk information höga poäng för angelägenhet att åtgärda. Asymmetrisk information utgör det enskilt största hindret inom sektorn och uppgår till 25 procent vilket motsvararar 0,4 TWh Specifikt för småhus För sektorn småhus får även Transaktionskostnader höga poäng för angelägenhet att åtgärda. Hindret Transaktionskostnader utgör det enskilt största hindret inom sektorn och uppgår till 30 procent vilket motsvarar 2,4 TWh per år Specifikt för godstransporter För sektorn godstransporter får Asymmetrisk information höga poäng för angelägenhet att åtgärda. Asymmetrisk information utgör tillsammans med Policyinstabilitet de två största hindren inom sektorn och uppgår till 20 procent vilket motsvarar 1,5 TWh per år. 19 december

169 9 Insatser och åtgärder I detta kapitel beskrivs dagens insatser, behov av att förändra detta samt aspekter som då bör tas i beaktning. Ett antal styrmedelsförslag ges även. 9.1 Hinder och marknadsmisslyckanden som nuvarande styrmedelsportfölj adresserar Sweco genomförde hösten 2013 en utvärdering av 24 styrmedel för energieffektivitet på uppdrag av Näringsdepartementet. Från utvärderingen kan konstateras att en delmängd av de utvärderade styrmedlen avser att avhjälpa i huvudsak två olika typer av marknadsmisslyckanden: Kunskap och positiva externa effekter och Asymmetrisk information. För de styrmedel som inte adresserar ett marknadsmisslyckande är uppgiften att avhjälpa ett, främst i form av att minska målgruppens sökkostnader för information och sprida kunskap. I tabell 1 nedan finns en sammanställning över respektive styrmedels syfte/uppgift med avseende på marknadsmisslyckande och, men nu mer uppdelat på de som denna rapport omfattar För varje styrmedel som är av relevans för denna rapport bedöms i vilken grad respektive styrmedel riktar sig till de olika sektorerna. Siffrorna anger i vilken grad respektive styrmedel riktar sig till olika sektorer. Inte alls 0 I viss grad 1 I stor grad 2 Uteslutande 3 I kolumnen längst till vänster redovisas hur stora effekter respektive styrmedel bedömdes genererat i respektive målgrupp i den utvärdering som Sweco genomförde hösten Tabell 11-Tabell 18 visar en sammanställning av nuvarande styrmedelsportfölj med vilken typ av styrmedel för de sju sektorena. 231 Sweco: Utvärdering av 24 styrmedel för energieffektivisering, december

170 Tabell 11: Nuvarande styrmedelsportfölj sektorer och Effekter utv 2013 Källa: Sweco, 2014 Styrmedel Flerbostads hus Lokaler-Kontor Småhus Teknikupphandling och marknadsintroduktion (nätverk) Energiintensiv industri Tillverkande industri Gods transporter Person transporter Energiaktiv.se Energieffektiva produkter Regionala energikontor Energitjänster Energistatistik Tillsynsvägledning Energi- och klimatrådgivning Uthållig kommun Regionalt energi- och klimatarbete Programmet för mycket låg energianvändning i byggnader LÅGAN Beställargrupper formerade för att driva utvecklingen Projektstöd för marknadsintroduktion och teknikupphandling (Fastigheter) Asymmetrisk information Asymmetrisk information Asymmetrisk information Delade incitament Delade incitament Kunskap & osäkerhet om ny teknik Positiva externa effekter Transaktionskostnader Minska sökkostnader Minska sökkostnader/ Informationsspridning Informationsspridning Minska sökkostnader/ Informationsspridning Minska sökkostnader Positiva externa effekter Minska sökkostnader Vägleda utförare av miljötillsyn Positiva externa Minska sökkostnader/ effekter Informationsspridning Positiva externa effekter Minska sökkostnader Positiva externa effekter Minska sökkostnader Positiva externa effekter Positiva externa effekter Positiva externa effekter Minska sökkostnader/ Informationsspridning Energikartläggningsstöd Minska sökkostnader Energieffektiva transporter - program Energieffektiviseringsstöd till kommuner och landsting Energideklarationer Energieffektiva myndigheter Informationsspridning - testresultat Asymmetrisk information Dealde incitament Asymmetrisk information Positiva externa effekter Minska sökkostnader hos målgruppen Minska sökkostnader/ Informationsspridning Begränsad rationalitet Barn och ungdomar Informationsspridning Begränsad rationalitet Organisatoriska organisatoriska Synliggöra information (energianvändni ng i byggnader) Finansiella Finansiella Policy instabilitet 19 december

171 9.2 Verkan och samverkan i nuvarande styrmedelsportfölj Styrmedlen i dagens styrmedelsportfölj riktar sig mot olika sektorer, även om majoriteten av dem riktar sig mot mer än en sektor. Styrmedlen kan kategoriseras som administrativa, informativa, ekonomiska respektive FoU Översikt dagens styrmedel För flerbostadshus finns i dagsläget de styrmedel som redovisas i Tabell 12. Tabell 12: De styrmedel som riktar idag riktar sig mot flerbostadshus TYP AV STYRMEDEL Administrativa styrmedel Informativa styrmedel Ekonomiska styrmedel FoU Källa: Sweco, 2013 STYRMEDEL Boverkets byggregler Energieffektiva produkter ekodesign Energitjänster Energideklarationer Energi- och klimatrådgivning Energieffektiva produkter energimärkning Informationsspridning testresultat Energiskatt Koldioxidskatt Energieffektiviseringsstöd kommuner och landsting Subventioner av solceller Beställargrupper formerade för att driva utvecklingen, Bebo För kontorslokaler finns i dagsläget de styrmedel som redovisas i Tabell 13. Tabell 13: De styrmedel som riktar idag riktar sig mot lokaler TYP AV STYRMEDEL Administrativa styrmedel Informativa styrmedel Ekonomiska styrmedel FoU Källa: Sweco, 2013 Boverkets byggregler Energieffektiva myndigheter Energitjänster Energideklarationer Energiskatt Koldioxidskatt Subventioner av solceller STYRMEDEL Beställargrupper formerade för att driva utvecklingen BeLok och HyLok Projektstöd för marknadsintroduktion och teknikupphandling 19 december

172 För småhus finns i dagsläget de styrmedel som redovisas i Tabell 14. Tabell 14: De styrmedel som riktar idag riktar sig mot småhus TYP AV STYRMEDEL Administrativa styrmedel Informativa styrmedel Ekonomiska styrmedel FoU STYRMEDEL Energieffektiva produkter ekodesign Energideklarationer Energi- och klimatrådgivning Energieffektiva produkter energimärkning Informationsspridning testresultat Energiaktiv.se Energiskatt Koldioxidskatt Subventioner av solceller LÅGAN Källa: Sweco, 2013 För den energiintensiva industrin finns i dagsläget de styrmedel som redovisas i Tabell 15. Tabell 15: De styrmedel som riktar idag riktar sig mot energiintensiv industri TYP AV STYRMEDEL Administrativa styrmedel Informativa styrmedel Ekonomiska styrmedel FoU Källa: Sweco, 2013 Miljöbalken STYRMEDEL Industrinätverken (Teknikupphandling och marknadsintroduktion) Energiskatt Koldioxidskatt För övrig tillverkande industri finns i dagsläget de styrmedel som redovisas i Tabell 16. Tabell 16: De styrmedel som riktar idag riktar sig mot övrig tillverkande industri TYP AV STYRMEDEL Administrativa styrmedel Informativa styrmedel Ekonomiska styrmedel Miljöbalken STYRMEDEL Energitjänster Energiaktiv.se Industrinätverken (Teknikupphandling och marknadsintroduktion) Regionala energikontor Energiskatt Koldioxidskatt 19 december

173 FoU Källa: Sweco, 2013 Energikartläggningsstöd För sektorn godstransporter finns i dagsläget de styrmedel som redovisas i Tabell 17. Tabell 17: De styrmedel som riktar idag riktar sig mot godstransporter TYP AV STYRMEDEL Administrativa styrmedel Informativa styrmedel Ekonomiska styrmedel FoU Energiaktiv.se Energiskatt Koldioxidskatt STYRMEDEL Energieffektiva transporter-program Källa: Sweco, 2013 För sektorn persontransporter finns i dagsläget de styrmedel som redovisas i Tabell 18. Tabell 18: De styrmedel som riktar idag riktar sig mot persontransporter TYP AV STYRMEDEL Administrativa styrmedel Informativa styrmedel Ekonomiska styrmedel FoU Källa: Sweco, 2013 Energiaktiv.se Energiskatt Koldioxidskatt Supermiljöbilspremien STYRMEDEL Energieffektiva transporter-program 19 december

174 Miljoner kronor Kvantitativ utvärdering av marknadsmisslyckanden och Befintliga styrmedels kostnader i förhållande till nytta I den utvärdering av styrmedel för energieffektivisering som Sweco genomförde hösten 2013 kartlades styrmedelsägarens kostnader för olika styrmedel med en uppdelning i förvaltningsanslag och sakanslag för perioden Kostnadsfördelningen visas i Figur 55. Figur 55: Styrmedelsägarens kostnader för styrmedel Sakanslag Förvaltningsanslag Källa: Sweco, 2014 Totalt uppgick kostnaden för perioden till drygt 1,6 miljarder kronor och cirka 400 miljoner kronor per år. Som ett räkneexempel kan vi beräkna vilket ekonomiskt värde de rena marknadsmisslyckandena representerar. Asymmetrisk information står för en hindrad effektivisering av 7,2 TWh och Kunskap och osäkerhet om ny teknik för 11,2 TWh, det vill säga 18,4 TWh årligen. Om 1 kwh ansätts ett värde av 0,5 kr i snitt motsvarar 18,4 TWh cirka 9 miljarder kr/år. 19 december

175 9.2.3 Kommentarer kring befintlig styrmedelsportfölj Baserat på den utvärdering av styrmedel inom energieffektivisering som Sweco genomförde hösten 2013 kan inte rekommendationen göras att några styrmedel ska avvecklas. Dock fann studien att energieffektiviseringsstödet till landstingen bör omformas och ersättas med ett mer riktat styrmedel. Det finns några styrmedel som Sweco vill lyfta som speciellt angelägna att behålla och vidareutveckla. Detta innebär dock inte att de andra insatserna är oviktiga. De insatser som Sweco vill framhålla speciellt är beställargrupper formerade för att driva utvecklingen (bebyggelse), projektstöd för marknadsintroduktion och teknikupphandling (bebyggelse) samt resurseffektiva produkter och kommunikationsarbetet kring denna (främst hushåll). Dessa insatser har enligt utvärderingen påvisbara effekter i målgrupperna. Dock bör dessa insatser vidareutvecklas i enlighet med de förslag som utvärderingen gav. Exempelvis bör informationsspridningen av resultaten ifrån nätverksarbetet och beställargrupperna inom bebyggelsen utökas till fler aktörer i sektorn. Industrin är en svår målgrupp att nå ut till. Med bakgrund av att Kunskap och osäkerhet kring ny teknik faller ut som ett betydande som anses angeläget att åtgärdas vill Sweco därför framhålla industrinätverken (som ligger under Teknikupphandling och marknadsintroduktion) som ytterligare styrmedel som är angelägna att behålla. För den energiintensiva industrin är industrinätverken i princip det enda styrmedel som adresserar hindret Kunskap och osäkerhet om ny teknik. I sin nuvarande form omfattar styrmedlet ett antal olika nätverk med en stark branschkoppling. Det är önskvärt att nätverken efter en period kan drivas självständigt av branschen. Ett av nätverken ENETSTEEL som startades upp av Energimyndigheten och Jernkontoret 2005 har sedan tre år tillbaka övergått helt i branschens egen regi. Det bedöms att denna insats har potential att nå ut till industriföretagen och reducera hindret med kunskap och osäkerhet kring ny teknik. För den del av industrin som inte är energiintensiv omfattas både större tillverkande teknikföretag och små- och medelstora industriverksamheter. Styrmedlet som adresserar Kunskap och osäkerhet om ny teknik är även här Teknikupphandling och marknadsintroduktion (nätverk). mförallt små och medelstora företag syftar inte primärt till att Fler och effektivare styrmedel behövs för att överkomma framförallt hindret Kunskap och osäkerhet om ny teknik i den energiintensiva industrin och i övrig tillverkande industri. Några förslag på styrmedel lämnas i kapitel december

176 9.3 Finns behov att förändra styrmedelskatalogen? Den nuvarande styrmedelsportföljen adresserar inte hindren i tillräckligt stor utsträckning. Som kan ses i Tabell 11 finns det idag få styrmedel som riktar sig mot energiintensiv industri och godstransporter, medan flera adresserar bebyggelsen. Speciellt sektorn energiintensiv industri har en stor energieffektiviseringspotential som borde kunna realiseras i högre utsträckning än idag, om styrmedel gentemot denna sektor utformas på rätt sätt. I figuren ses även att de flesta av styrmedlen inte gett tillräckliga påvisbara effekter. Dessa bedömningar är hämtade ifrån den utvärdering som Sweco genomförde på uppdrag av Näringsdepartementet hösten För ett antal av dessa styrmedel handlar det om att det inte har gått tillräckligt lång tid sedan styrmedlet implementerades för att kunna mäta effekter. Att de intervjupersoner och medverkande i expertpaneler som deltagit i Swecos studie (hösten 2014) bedömt att för energieffektivisering förligger, och att Sweco genom befintlig litteratur kunnat påvisa att icke-realiserad potential finns för lönsamma energieffektiviseringar, talar även detta för att det finns behov att förändra och vidareutveckla styrmedelskatalogen. Detta förutsatt att hindren går att överbrygga på ett kostnadseffektivt sätt. Analysen tyder på att den samhällsekonomiska potentialen överstiger nuvarande energieffektiviseringsåtgärder. Kostnaden för styrmedel bedöms även vara liten i jämförelse med den samhällsekonomiska potentialen. Därmed finns både utrymme och behov av att komplettera nuvarande styrmedelsportfölj. Dessa beskrivs i kapitel Som beskrivs i inledningen till kapitel 8 tog expertpanelerna och projektgruppen fram bedömningar av hur angeläget det är att åtgärda de olika hindren inom respektive sektor. Tillsammans med den sammanvägda bedömning som tagits fram av hindrens storlek används dessa för att ta fram rekommendationer kring styrmedelsutformning inom respektive sektor. Styrmedel bedöms behövas framför allt för de som värderats som angelägna att åtgärda, dock kan även styrmedel som riktar sig mot ett stort i sektorn vara av intresse att beakta. Ofta, dock inte alltid, sammanföll de som bedömts som stora med de som bedömts som angelägna att åtgärda. Expertpanelerna har inte tillfrågats att bedöma angelägenhetsgraden att åtgärda negativa externa effekter. Detta är dock något som projektgruppen bedömer är angeläget att i så stor utsträckning som möjligt internalisera. Dock måste hänsyn tas till huruvida detta kan få betydande konsekvenser för Sveriges konkurrenskraft, i de fall då andra länders internaliseringsgrad inte är lika hög. Samtidigt kan konstateras, se kapitel 7.4, att det inte alltid handlar om att förstärka prissignalen för att fler energieffektiviseringar ska komma till stånd: ofta samverkar olika så att prissignalen inte når fram. Det kan då istället handla om att verka för att överbrygga andra, såsom exempelvis asymmetrisk information. Observera vidare att för vissa målgrupper och användningsområden är priselasticiteten mycket låg: även om negativa externa effekter skulle överinternaliseras skulle detta ändå troligen inte öka energieffektiviseringen i målgruppen. Förutom att överinternaliseringen då skulle ha liten önskvärd effekt kan dessutom ifrågasättas huruvida det är rätt att dessa aktörer bär en högre kostnad än de negativa externa effekterna ger upphov till. 19 december

177 I detta kapitel beskrivs de aspekter som Sweco identifierat vara av särskild betydelse att beakta vid utformning av styrmedel inom respektive sektor. Dessa relaterar till de som visat sig vara stora inom respektive sektor, samt till hur angelägna att åtgärda dessa bedömts vara. Dessutom föreslås ett antal konkreta styrmedelsförslag som bedöms ha potential att kunna överbrygga dessa. Eftersom flera av aspekterna för styrmedelsutformning och styrmedelsförslagen är återkommande mellan flera delsektorer (exempelvis för flerbostadshus, kontorslokaler och småhus inom bebyggelsen) har sektorerna grupperats som bebyggelse, industri och transporter. Dessutom listas ett antal önskvärda initiativ för energieffektivisering där Sweco inte ser att staten har en tydlig roll att fylla Generellt Några aspekter som Sweco vill lyfta som viktiga att ta i beaktning generellt är att: Icke-internaliserade externa effekter bör i högre grad internaliseras. Dock behövs då tas hänsyn till internaliseringsgrad i andra konkurrerande länder. Detta i syfte att inte snedvrida marknader och riskera carbon leakage. Risk för snedvridning av konkurrens bör beaktas vid all form av styrmedelsutformning. Detta gäller konkurrens inom branscher, mellan branscher och för Sveriges konkurrenskraft gentemot övriga världen. Bedömningar bör göras huruvida en prissignal inte påverkar målgruppen eftersom prissignaler inte når fram (exempelvis på grund av Asymmetrisk information) eller ifall detta beror på att målgruppen inte är priskänslig (exempelvis eftersom energikostnaderna ändå är en liten del av totala kostnader). Om sistnämnda är fallet bör andra former av insatser än prissignaler användas, om det bedöms finnas samhällsekonomiskt värde i att dessa målgrupper energieffektiviserar. Fokus för styrmedelsutformning inom respektive målgrupp bör ligga på att lägga krut på de som anses angelägna att åtgärda, vilket även kopplar till hindrens storlek. Dock är en annan viktig iakttagelse ifrån studien att hindren samspelar med varandra, och att olika typer av styrmedel således behövs för att nå resultat. En flexibilitet i utformningen av styrmedlen bör således finnas, där styrmedlen kan utvärderas och förbättras kontinuerligt. Detta måste dock göras på ett sätt som inte ger upphov till ytterligare upplevd Policyinstabilitet hos aktörerna. Policyinstabilitet åtgärdas inte genom styrmedel som riktar sig mot att överbrygga hindret policyinstabilitet, utan snarare genom att i de styrmedelsutformningar som görs ha en medvetenhet om att Policyinstabilitet bör undvikas. Aktörernas ägandeform varierar, och ofta behövs olika kommunikationssätt för att styrmedel ska få avsedd verkan för de olika aktörerna inom en målgrupp. 19 december

178 9.3.2 Styrmedelsrekommendationer Bebyggelse För bebyggelsen som en helhet kan Kunskap och osäkerhet om ny teknik, Policyinstabilitet samt Transaktionskostnader sägas vara av störst värde att åtgärda. För kontorslokaler faller även Asymmetrisk information ut som betydelsefullt. De styrmedel som idag riktar sig mot bebyggelsen syftar många gånger till att överbrygga Transaktionskostnader och Kunskap och osäkerhet om ny teknik. Ett par riktar sig även mot Asymmetrisk information. En sammanställning av de som är störst respektive mest angelägna att åtgärda för de respektive sektorerna inom bebyggelse visas i Tabell 19. Tabell 19: En sammanställning av de som är störst respektive mest angelägna att åtgärda för de respektive sektorerna inom bebyggelse Största hindren Flerbostadshus Kunskap och osäkerhet om ny teknik Transaktionskostnader Kontorslokaler Asymmetrisk information Kunskap och osäkerhet om ny teknik Småhus Transaktionskostnader Källa: Sweco, 2014 Begränsad rationalitet Mest angelägna att åtgärda Kunskap och osäkerhet om ny teknik Policyinstabilitet Asymmetrisk information Kunskap och osäkerhet om ny teknik Transaktionskostnader Policyinstabilitet Swecos bedömning är att ett flertal etablerade styrmedel finns inom bebyggelse, och att flera av dessa har påvisat resultat. Således, inte minst i syfte att undvika policyinstabilitet, bör en stor del av det framtida arbetet med styrmedelsutformning gentemot bebyggelsen ta sin utgångspunkt i dagens styrmedelskatalog. Ägarstrukturer spelar roll. Från studien har Sweco noterat att många offentliga och kommersiella fastighetsägare idag arbetar med energifrågan på ett strukturerat sätt. Speciellt för småhusägare och bostadsrättsföreningar behövs dock informationsinsatser för att minska Transaktionskostnader och Kunskap och osäkerhet om ny teknik. Dock finns en svårighet att nå ut till dessa, främst givet målgruppens stora spridning och antal. En prioritering kan behöva göras i vilka som kan nås på ett kostnadseffektivt sätt. Informationsinsatser kan även behövas för att prissignalen ska nå fram i de fall Asymmetrisk information föreligger, något som speciellt gäller för lokaler. En mer välutvecklad energitjänstemarknad kan också delvis överbrygga detta. Eftersom de installationer som görs i fastigheter har lång livslängd är det naturligt att aktörer är riskaversa och att hindret Kunskap och osäkerhet om ny teknik såldes kan hindra att en högre energieffektivitet nås. De gånger staten kan överbrygga detta på ett kostnadseffektivt sätt kan detta minskas genom exempelvis demonstrationer av teknik. För att höja lägsta nivån och minska Policyinstabilitet är förbättrad uppföljning av befintliga lagkrav att föredra. Asymmetrisk information mellan det företag som bygger en fastighet och den som sedan äger huset gör att utlovad energieffektivitet inte alltid uppnås. I syfte att komma till rätta med detta föreslås att dagens lagkrav bättre följs upp. 19 december

179 Utifrån denna bakgrund har Sweco tagit fram ett antal konkreta idéer på styrmedel, som skulle kunna ha potential att nå önskvärda effekter inom bebyggelsen: Förbättrad uppföljning av Boverkets byggregler Flerbostadshus, Lokaler, Småhus Boverkets Byggregler (BBR) ställer krav på energiberäkning av byggnader för att de ska få bygglov. Energiberäkningen ska sedan följas upp inom två år efter uppförandet genom energideklaration av byggnaden. Det är kommunernas byggnadsnämnder som tar del av energiberäkningen. Hur beräkningen utformas finns dock ingen vägledning för och erfarenheten från ett flertal konsulter inom branschen är att det skiljer mycket mellan olika kommuner mellan vilka frågor som ställs kring innehållet i energiberäkningen. Uppföljningen av BBR måste bli bättre för att säkerställa att de lagstadgade kraven följs. Den primära målgruppen för denna insats skulle vara de företag som bygger fastigheter. Boverket har idag inte tillsynsansvar, dock föreslås att de tilldelas detta. Det bör utredas hur detta skulle utformas och ifall ytterligare resurser behövs skjutas till. Ett alternativ skulle kunna vara att energiprestanda för nybyggda hus måste rapporteras in de fem första åren. Det finns idag en gråzon gällande vad som kan betraktas som normalt brukande av en fastighet. För att utveckla Boverkets byggregler kunde krav på vad som ska redovisas i en energiberäkning tas fram som riktlinjer. Det kunde i dessa finnas krav på att redovisa sådan energianvändning som förväntas uppkomma men som inte räknas in i kravvärdet enligt BBR. Även tillgodogjord intern värmeavgivning borde anges i beräkningen. Till riktlinjerna borde även en checklista för byggnadskontoren kunna utvecklas med riktvärden på vad som kan betraktas som normala värden på värmeavgivning. Ökade krav på helhetssyn och transparens i beräkningen kunde ge ökat fokus på energianvändning i flera processer utan att det innebär att gränsdragningen gällande vad som omfattas av boverkets riktlinjer behöver ändras. Ägaren av huset föreslås som ansvarig för inrapportering, dock är det byggföretaget som står till svars för om byggnaden inte uppfyller BBR:s krav. Att inte leva upp till kraven i BBR bör vara förenat med vite. Detta kopplar till viss del till hindret Policyinstabilitet (genom att säkerställa att lagar följs) samt höjer fokus på att uppfylla kraven internt i byggföretagen, vilket påverkar Organisatoriska. Eftersom framtida fastighetsägare inte på ett enkelt sätt kan observera det som levereras motverkar insatsen även Asymmetrisk information. Förbättrad informationsspridning av resultat ifrån Energimyndighetens nätverkssatsningar Flerbostadshus, Lokaler Beställargrupperna och nätverken inom bebyggelse (Bebo, Hylok och Belok) har tagit fram ett antal användbara resultat som målgruppen kunnat använda sig av. Dessa når dock ut till för få i målgruppen. Informationsspridningen bör således förbättras. Detta är ett arbete som Energimyndigheten redan påbörjat. Det är viktigt att anpassa informationsspridningen så att kommunikationen sker på olika sätt med de olika aktörerna i målgruppen; bostadsrättsföreningar, privata mindre ägare, offentliga och stora kommersiella ägare. Detta motverkar hindren Transaktionskostnader och kunskap och osäkerhet kring ny teknik. På grund av svårigheten att nå ut till målgrupperna bostadsrättsföreningar och privata mindre ägare har dessa historiskt betraktats som sekundära målgrupper för spridningsinsatserna. Här föreslår vi att Energi- och Klimatrådgivningen får en större roll till dessa målgrupper. 19 december

180 Främja energitjänstemarknaden - Flerbostadshus, Lokaler Energimyndigheten arbetar idag med att främja energitjänstemarknaden. Detta arbete bör fortsätta och utvecklas ytterligare. Målgruppen för denna insats skulle dels vara energitjänsteföretag, dels fastighetsägare och förvaltare som upphandlar energitjänster. En affärsmodell som skulle kunna vara av intresse att titta vidare på är att fastighetsägare kan prenumerera på uppföljning av mätdata, och få detta tillsammans med beslutsunderlag. Mycket i detta kan branschen göra själva, men Energimyndighetens roll blir att, liksom idag, verka tillsammans med branschorganisationer och andra kanaler till aktörer för att höja beställarkompetensen och förtroendet för energitjänstemarknaden. Om energitjänstemarknaden blev mer välfungerande skulle det minska med Asymmetrisk information (Delade incitament mellan energitjänsteföretag och flerbostadshusägare), Finansiella (Energy Performance Contracting-företag bekostar investeringen) samt Transaktionskostnader (fastighetsägarna behöver inte själva bygga upp all kunskap om energieffektiviseringar internt). Mer konkret skulle Energimyndigheten kunna initiera och finansiera, tillsammans med branschorganisationer för köpare och säljare, teknikupphandling och demonstration för nya energitjänster. Energi- och klimatrådgivningen stärks Flerbostadshus, Småhus Kunskapen hos energi- och klimatrådgivare är idag ojämn och bör stärkas upp ytterligare i syfte att höja kvalitén. Energi- och klimatrådgivarna bör även i högre utsträckning än idag vara teknikneutrala i sina rekommendationer. Det bör även satsas mer på beteendeförändrande insatser snarare än bara information. Detta eftersom det krävs flera steg för att en energieffektiviserande åtgärd ska komma till stånd: medvetenhet, kunskap, attityd, intentioner. Det bedöms även finnas en stor energieffektiviseringspotential i att agera energimedvetet i det dagliga arbetet. Energi- och klimatrådgivare bör där så är möjligt arbeta tillsammans genom branschens kanaler (branschorganisationer och dylikt). Det bedöms viktigt att spridningsinsatserna görs på olika sätt för de olika kategorierna. Energi- och klimatrådgivarna bör aktivt söka upp bostadsrättsföreningar och ge dessa rådgivningar. Energideklarationens främsta syfte är att ge information om energianvändningen i en fastighet och öka transparensen angående detta, och således minska asymmetrisk information mellan köpare och säljare (alt mellan hyresvärd och hyresgäst). Syftet med att energi- och klimatrådgivarna söker upp bostadsrättsföreningarna skulle främst vara den rådgivande biten: att ge information om konkreta åtgärder. Således skulle energideklarationen och energi och klimatrådgivarna verka kompletterande. En viktig målgrupp för energi- och klimatrådgivarna skulle vara bostadsrättsföreningar, men även fastighetsägare och privatpersoner som bor i flerbostadshusen. Det föreslås även att energioch klimatrådgivningen marknadsförs mot privatpersoner i syfte att öka kännedomen om tjänsten. Den primära målgruppen för denna del av insatsen skulle således vara privatpersoner. Insatsen motverkar hindren Transaktionskostnader och kunskap och osäkerhet kring ny teknik. 19 december

181 Etablera kompetenscentra - Flerbostadshus, Lokaler, Småhus Dessa kompetenscentra skulle kunna främja renoveringar och energieffektiviseringar i samband med dessa, samt ha kunnande vad gäller fastighetsdrift. Här kan regionala konstellationer ha en stor fördel om regionala etablerade nätverk och samarbetsplattformar, som de regionala energikontoren, kan byggas vidare på. Kompetenscentrats kunskapspool kan användas dels till att stärka konsulter inom området, dels till att stärka företagens egenkunskap. Målgrupperna för insatsen är således främst konsulter, flerbostadsägare och fastighetsägare. Sistnämnda handlar framförallt om att stärka beställarkompetensen. Denna insats överbrygger hindren Transaktionskostnader, kunskap och osäkerhet kring ny teknik samt Asymmetrisk information. Även Organisatoriska och Begränsad rationalitet kan minska som en följd av insatsen. Utnyttja LOU och befintliga nätverk för att reducera Asymmetrisk information inom kontorslokaler - Kontorslokaler Hindret Asymmetrisk information mellan fastighetsägare och hyresgäst kan reduceras med hjälp av så kallade gröna avtal. I ett grönt avtal sluter hyresgäst och fastighetsägare ett avtal om att gemensamt arbeta för att minska energiåtgången i fastigheten. Detta är något som marknaden i viss utsträckning redan arbetar med idag, och Fastighetsägarna tillhandahåller avtalsmallar som aktörerna kan använda sig av. Belok och Hylok kan verka för att ytterligare sprida information om byggnaders energianvändning, om konceptet samt om avtalsmallarna för att ge aktörerna möjlighet att själva skapa avtal som överbygger Asymmetrisk information. Vidare bör möjligheten ses över för offentliga aktörer att genom LOU efterfråga gröna avtal för att ytterligare stimulera dess framväxt. Målgruppen för insatsen är främst offentliga aktörer och hyresvärdar (fastighetsägare), men förhoppningen är att insatsen ska påverka andra hyresgäster att vilja skaffa denna typ av avtal. Observera att detta skulle vara en ökad kostnad för enskilda offentliga aktörer på kort sikt. Detta kan delvis motiveras med att EU har satt som riktlinjer att offentliga aktörer ska vara föregångare. En annan motivering är att detta skulle kunna bidra till att påskynda marknadsmognaden för gröna elavtal, något som på sikt skulle kunna ha potential att minska marknadsmisslyckanden och och vara samhällsekonomiskt motiverat. Ökad kännedom om Energimyndighetens information om energieffektiva produkter Flerbostadshus, Småhus Det arbete som Energimyndigheten gör inom ramen för ekodesign, energimärkning, produkttester och spridning av dess testresultat anses värdefullt. En ökad kännedom om Energimyndighetens arbete och den information de tillhandahåller vore därför önskvärt. Rekommendationen är således att detta bör marknadsföras ytterligare. Den primära målgruppen för denna insats skulle vara privatpersoner. Detta motverkar hindren Transaktionskostnader och kunskap och osäkerhet kring ny teknik. Energimärkningen av hus vidareutvecklas - Småhus Arbetet med energimärkning av produkter har fallit väl ut och har en hög kännedom i målgruppen. Det är även förhållandevis många som tittar på märkningen och tar energieffektivitet i beaktning vid köp av produkter. Vad gäller energimärkning av hus har dock inte kunskapen och intresset om detta varit lika stort. Energideklarationen visar husets energieffektivitet, dock uppfattas inte märkningen som lika kommunikativ och är heller inte 19 december

182 något som målgruppen tittar så mycket på vid val av hus. För småhus är energiåtgång överlag en betydande kostnad för småhusägaren, en potential att kommunicera energieffektivitet i hus och få målgruppen intresserad av att ta denna i beaktning tros därför finnas. Ett sätt att tydliggöra märkningen skulle kunna vara att överväga att använda ett likartat märkningssystem som energimärkningen för produkter, med bokstäver och plustecken. En tydligare märkning skulle kunna ha effekten att mäklare upplever den som ett bättre verktyg att använda i sin kommunikation med kunden. Eventuellt vore det även av värde att engagera mäklarsamfund och göra riktade informationsinsatser gentemot dessa i syfte att främja att mäklare i större utsträckning använder energimärkningen/energideklarationen som ett argument vid husförsäljning. De primära målgrupperna för insatsen skulle vara privatpersoner som äger eller överväger att köpa småhus samt mäklare. Insatsen är tänkt att motverka hindret Asymmetrisk information. 19 december

183 9.3.3 Styrmedelsrekommendationer Industri För industrin som en helhet kan Kunskap och osäkerhet om ny teknik och Policyinstabilitet sägas vara av störst värde att åtgärda. Vidare bedöms Organisatoriska vara ett stort. Det finns idag inte särskilt många styrmedel som i någon högre grad riktar sig mot energiintensiv industri, medan det finns ett antal som riktar sig mot övrig tillverkande industri. För övrig tillverkande industri bedöms att en vidareutveckling av dagens styrmedel kan nå resultat i målgruppen, medan energiintensiv industri bedöms behöva ytterligare styrmedel. En sammanställning av de som är störst respektive mest angelägna att åtgärda för de respektive sektorerna inom industrin visas i Tabell 20. Tabell 20: En sammanställning av de som är störst respektive mest angelägna att åtgärda för de respektive sektorerna inom industrin Största hindren Mest angelägna att åtgärda Energiintensiv industri Övrig tillverkande industri Källa: Sweco, 2014 Kunskap och osäkerhet om ny teknik Organisatoriska Organisatoriska Transaktionskostnader Kunskap och osäkerhet om ny teknik Policyinstabilitet Kunskap och osäkerhet om ny teknik Policyinstabilitet Kunskap och osäkerhet om ny teknik är ett stort som är angeläget att åtgärda, speciellt för energiintensiv industri. Industrin upplever en stor risk med att göra ändringar, bland annat energieffektiviserande åtgärder, i processen eftersom detta kan äventyra tillverkningen. Det vore av värde om denna risk gick att överbrygga genom styrmedelsinsatser. Ett sätt att sänka företagens upplevda risk kan vara genom demonstrationsprojekt av teknik, som leder till ökad kunskap om tekniken. Ett annat sätt skulle kunna vara att skapa incitament för företagen, vilket leder till att fler tycker att det är värt att ta risken. Swecos utvärdering visar att Organisatoriska är stora. Dessa är dock svåra för staten att ha rådighet över. Detta är både av praktiska skäl (hur kan staten delta i ett företags beslutsfattandeprocess) och av principiella skäl (risk för snedvridning av marknaden om staten hjälper några mer än andra). Dessa kan delvis nås indirekt, genom ökad information och kunskap (vilket även kan minska upplevd risk), samt genom ökade incitament att agera energieffektivt. Organisatoriska relaterar även till beteende och den stora energieffektiviseringspotential som inte är teknisk utan istället beteenderelaterad. Mer kunskap behövs inom detta område och hur det kan angripas. Energiintensiv industri är generellt stora företag och energikostnaden är betydande. Dessa företag har möjlighet att tillsätta resurser till energifrågan och bygga upp kompetens internt. För övrig tillverkande industri kan detta dock ibland inte vara av samma värde för företaget, givet begränsade resurser. Övrig tillverkande industri har såldes högre Transaktionskostnader än energiintensiv industri för att komma till stånd med energieffektiviseringar. 19 december

184 För större företag kan det handla om att få en ökad kunskap om frågan (exempelvis via statliga informationsinsatser) och således sänka företagets Transaktionskostnader, medan för mindre företag kan det ibland vara bättre att företaget inte behöver hantera energifrågan på egen hand. En välfungerande energitjänstemarknad kan då vara den part som sänker Transaktionskostnader och behovet av att avsätta resurser internt för övrig tillverkande industri. Utifrån denna bakgrund har Sweco tagit fram ett antal konkreta idéer på styrmedel, som skulle kunna ha potential att nå önskvärda effekter inom industrin: Nätverksarbete Energiintensiv industri, Övrig tillverkande industri Fortsätt att arbeta med nätverk som styrmedel och utveckla dessa. Syftet med nätverken ska vara att öka kunskap, så att det leder till bättre riskbedömningar för att implementera ny teknik samt att förändra attityder. Tanken är att Energimyndigheten ska arbeta för att möjliggöra att nätverk startas upp, och att dessa sedan kan bli självgående och drivas av branschen själv (främst genom branschorganisationer). De primära målgrupperna för insatsen är industrin och branschorganisationer för dessa. För övrig tillverkande industri föreslås att se över möjligheten att dessa nätverk kan verka på mer regional nivå. Övrig tillverkande industri har ofta en stor del av sin energianvändning i stödprocesser som är relativt lika mellan branscher: ventilation, tryckluft, uppvärmning, belysning etcetera. Därför bör nätverkens fokus vara kunskaps- och erfarenhetsutbyte rörande stödprocesser, samt hur företagen kan arbeta med beteende och dylikt för att kontinuerligt höja energieffektiviteten. Nätverken för energiintensiv industri bör utvidgas till att innefatta flera ledningsnivåer inom företagen, i syfte att möjliggöra kunskapsutbyte mellan ledning och operativ verksamhet men även att stärka ledningens kunskap och engagemang för energifrågan. Det vore även bra om det gick att fånga upp internationella erfarenheter. Här ses speciellt en möjlighet till utbyte mellan Sverige och Finland, då dessa länder har likartad energiintensiv industri. Nätverksarbetet kan med fördel bedrivas inom ramen för redan befintliga sammanhang där exempelvis företagens ledare redan idag träffas. I syfte att locka deltagare till nätverken vore det bra att få med en eller ett par tunga branschnamn. Hindren som ämnar överbryggas genom denna insats är Organisatoriska, Kunskap och osäkerhet kring ny teknik, och Begränsad rationalitet. Kompetenshöjning Energiintensiv industri Staten kan bidra med kompetenshöjande insatser. Det finns ett värde i att utbilda de som idag är bra på ekonomi i energi och de som är bra på energi i ekonomi. Utbildningarna kan med fördel göras i befintlig struktur i branschen, exempelvis via branschorganisationer. Dessa kan även verka som kanal för att nå ut till företagen. De primära målgrupperna för insatsen är således energiintensiv industri och branschorganisationer för energiintensiv industri. Vad gäller utbildningen av ledande funktioner inom företagen skulle denna kunna göras i samband med befintligt utbildningsorgan (universitet), men även i samverkan med till exempel IVA. Tanken är att staten ska finansiera utbildningarna, men att företagen bidrar med egen tid samt står för reskostnader. Det vore bra att på något vis kunna göra det attraktivt för företagen att gå utbildningarna. Ett exempel på detta skulle kunna vara att de personer som genomgått utbildningen får möjlighet att delta i ett nätverk. 19 december

185 En annan möjlighet är att utbildningen ger en märkning, certifiering eller liknande, något företag kan använda i sin marknadsföring. Hindren som ämnar överbryggas genom denna insats är Organisatoriska, Kunskap och osäkerhet kring ny teknik, och Begränsad rationalitet. Utveckla tillsynsarbetet för energihushållning och miljötillsyn Energiintensiv industri, Övrig tillverkande industri Kravet om plan för att aktivt arbeta för att reducera energianvändningen bör finnas med på ett tydligare sätt i miljötillsynen. Det är möjligt att denna insats går att kombinera med kravet om energikartläggning i stora företag ska påbörjas senast i slutet av De primära målgrupperna för insatsen är de som utför miljötillsynen samt industrin. För övrig tillverkande industri föreslås att tillsynsarbetet kombineras med insatser som idag riktar sig mot övrig tillverkande industri så att det blir morot och piska. Genom att samordna insatserna krav på energiplaner/energieffektiviseringar i tillsynsarbetet med energikartläggningscheckar och energi- och klimatrådgivning tros bättre förutsättningar för energieffektiviseringsarbete i målgruppen kunna nås. Detta motverkar som Transaktionskostnader och Kunskap och osäkerhet om ny teknik, men även Organisatoriska och Begränsad rationalitet. Till viss del har det även kopplingar till minskad policyinstabilitet, eftersom att den verkar för att befintligt regelverk (tillsynen) följs. Främja energitjänstemarknaden Övrig tillverkande industri Energimyndigheten arbetar idag med att främja energitjänstemarknaden. Detta arbete bör fortsätta och utvecklas ytterligare. Målgrupperna för denna insats är energitjänsteföretagen samt övrig tillverkande industri. För övrig tillverkande industri är det inte enbart större EPClösningar (energy performance contracting, incitamentsavtal) som är av intresse, utan även energitjänster till olika delar av stödprocessen. En affärsmodell som skulle kunna vara av intresse att titta vidare på är att industriföretag kan prenumerera på uppföljning av mätdata, och få detta tillsammans med beslutsunderlag. Mycket i detta kan branschen göra själva, men Energimyndighetens roll blir att, liksom idag, verka tillsammans med branschorganisationer och andra kanaler till aktörer för att höja beställarkompetensen och förtroendet för energitjänstemarknaden. Om energitjänstemarknaden blev mer välfungerande skulle det minska med asymmetrisk information (delade incitament mellan energitjänsteföretag och andra företag), finansiella (EPC-företag bekostar investeringen) samt transaktionskostnader (företagen behöver inte själva bygga upp all kunskap om energieffektiviseringar internt). Mer konkret skulle Energimyndigheten kunna initiera och finansiera, tillsammans med branschorganisationer för köpare och säljare, teknikupphandling och demonstration för nya energitjänster. 19 december

186 9.3.4 Styrmedelsrekommendationer Transporter För transportsektorn som helhet kan Kunskap och osäkerhet om ny teknik, Policyinstabilitet och Asymmetrisk information sägas vara av störst värde att åtgärda. Det finns idag inte särskilt många energieffektiviseringsstyrmedel som i någon högre grad riktar sig mot varken godstransporter eller persontransporter. Sweco föreslår därför en utveckling av de insatser som finns idag plus ett antal nya styrmedel införs. En sammanställning av de som är störst respektive mest angelägna att åtgärda för de respektive sektorerna inom transporter visas i Tabell 21. Tabell 21: En sammanställning av de som är störst respektive mest angelägna att åtgärda för de respektive sektorerna inom transporter Största hindren Persontransporter Begränsad rationalitet Policyinstabilitet Godstransporter Asymmetrisk information Policyinstabilitet Källa: Sweco, 2014 Mest angelägna att åtgärda Kunskap och osäkerhet om ny teknik Policyinstabilitet Asymmetrisk information Policyinstabilitet De sätt som transportsektorn kan energieffektiviseras är genom minskat transportbehov, överflytt mellan transportslag eller energieffektivare fordon. För transportsektorn talas det ofta om miljöförbättrande möjligheter (ofta genom lägre totala utsläpp). Detta är ofta, dock inte alltid, förknippat med en energieffektivisering. Exempelvis kan övergång till biobränslen ibland höja energiåtgången. Ett mer miljövänligt transportsystem är önskvärt, inom ramen för detta uppdrag är dock den främsta inriktningen på styrmedel som förbättrar energieffektiviteten. Studien påvisar att det som hindrar som privatpersoner att köpa energieffektivare personbilar, utöver om kostnaden hindrar, ofta är en kombination av osäkerhet om teknik (Kunskap och osäkerhet om ny teknik) respektive den politiska utvecklingen (policyinstabilitet). Dels finns en osäkerhet om tekniska frågor så som batteriets livslängd, dels om den politiska utvecklingen inom frågan (exempelvis hur mycket laddinfrastruktur som kommuner kommer att bygga). Ett sätt för staten att överbrygga den politiska osäkerheten är att ge tydligare riktlinjer om vad som kommer att satsas på framöver. Dock kan detta vara problematiskt, eftersom staten bör vara teknikneutral i sitt stöd och inte välja vinnare. Den tekniska osäkerheten kan överbryggas till viss del från statligt håll genom demonstrationsprojekt, men bedöms dock till stor grad hanteras av marknaden själv (tillverkare och återförsäljare av bilar). Därför bedöms att staten istället bör utforma styrmedel som skapar incitament för privatpersoner (och företag som köper företagsbilar) att våga köpa energieffektivare personbilar trots de associerade riskerna. Ett antal sådana incitament föreslås längre ner. Övergång från privatbilism till andra färdslag har potential att bidra till god energieffektivisering. En reduktion av transporter samt en ökad överflytt till kollektivtrafik och cykel kan möjliggöras genom medveten stadsplanering. Bilpooler kan verka som ett komplement. 19 december

187 Mer medveten stadsplanering behövs även för att möjliggöra överflytt av gods från väg till andra transportslag (exempelvis tåg). Överflyttningspotentialen begränsas dock av andra trasportslags tillgängliga kapacitet och räckvidd, samt det behov av flexibilitet som lastbilar ger. Det finns idag en begränsad transparens mellan transportköpare och den aktör som i slutändan utför transporten. Om denna transparens höjdes skulle transportköparen få större inblick i transportens energieffektivitet och i större mån ha möjlighet att efterfråga detta. Offentliga aktörer skulle kunna vara föregångare inom att efterfråga mer energieffektiva transporter och verka för att transparensen ska höjas. Att reglerna kring fjärrtransporter (delvis kopplat till den utbredda cabotageverksamheten) inte kontrolleras och efterföljs försämrar ytterligare incitamenten för aktörer (i detta fall främst åkerier) att vara energieffektiva. Utifrån denna bakgrund har Sweco tagit fram ett antal konkreta idéer på styrmedel, som skulle kunna ha potential att nå önskvärda effekter inom transportsektorn: Mer medveten fysisk planering för att främja energieffektivitet Persontransporter, Godstransporter När nya områden byggs eller byggs om finns möjlighet att reducera transportbehov genom att ha en medvetenhet kring ruttplanering, minskat trasportbehov, möjliggöra överflytt mellan transportslag och effektiva vägstrukturer. Detta kan exempelvis handla om närhet till mataffär och andra nödvändigheter, möjlighet att parkera så att omvägar undviks eller möjlighet att köra runt vid distribution istället för att köra fram och tillbaka. Genom att skapa förutsättningar för omlastningscentraler och förbättrad spårinfrastruktur kan överflytt från väg till spår ökas. Detta är ett långsiktigt sätt att arbeta för högre energieffektivitet, och föreslås göras inom ramen för Uthållig kommun eller liknande sammanhang. Målgrupperna för denna insats är alla de aktörer som är involverade i fysisk planering, där regionala och lokala beslutsfattare är viktiga målgrupper. Insatsen kan sägas överbrygga Delade incitament (en form av Asymmetrisk information) mellan aktörer. Dessutom överbryggs viss form av Begränsad rationalitet (kopplad till preferenser), eftersom det uppstår attraktiva alternativ till bilkörning. Förbättrad kontroll av fjärrtrafik Godstransporter Det finns brister i hur befintligt reglerverk för den tunga trafiken efterföljs vad gäller kör- och vilotider, cabotage, lastsäkring, överlaster och hastigheter. Kontrollen av regelverket är idag uppdelat på Transportstyrelsen och polismyndigheten. Risken för att bli kontrollerad är idag mycket låg, och de ekonomiska påföljderna är ofta inte tillräckligt höga för att vara kännbara. I syfte att ha en rättvis konkurrens bör detta förbättras, exempelvis vad gäller att regler kring lastsäkring, däck, hastigheter och kör- och vilotider efterlevs. Om dessa inte följs kan det ha negativ inverkan på energieffektiviteten, exempelvis vad gäller däckval och otillåtna hastigheter. 232 Det finns även problem med att utlänska åkare för in en otillåten mängd drivmedel in i Sverige, något som medför att de inte betalar svensk skatt för drivmedlet Näringsdepartementet: Fossilfrihet på väg, SOU 2013:84, Information som framkommit i de intervjuer och expertpaneler Sweco haft med branschaktörer hösten december

188 En mer systematisk och frekvent trafikövervakning, med fördel med enbart en ansvarig aktör, samt mer kännbara ekonomiska påföljder vid lagbrott rekommenderas således. Målgruppen för denna insats är de som idag ansvarar för kontrollen, de som kommer att ha ansvaret i framtiden samt åkerier och andra som kör tung trafik. De som överbyggs är Policyinstabilitet (lagen efterföljs) och Asymmetrisk information (idag råder bristande transparens mellan beställare och de som i slutändan faktiskt kör). Ej fungerande konkurrens ingår inte som ett av hindren i denna studie, dock överbyggs även detta marknadsmisslyckande/. Använd LOU till att främja energieffektiva transporter Godstransporter Åkeribranschen har själva tagit fram en märkning för rättvisa transporter, som även innefattar att körningen ska vara klimatsmart, vilket generellt har en positiv påverkan på energieffektiviteten. Möjligheten bör ses över att nyttja LOU till att ställa krav på energieffektivitet i köpta transporter. Detta skulle i så fall innebära att offentlig sektor kan främja branschinitiativet med energieffektivare transporter och märkning kring detta. En del företag har även börjat med att redovisa olika tidsalternativ för transporter. Ett alternativ är då exempelvis att en transport tar en dag, medan ett annat alternativ är att transporten tar tre dagar men är mer energieffektiv. Kunden får välja vilket av dessa alternativ som föredras, ofta med priset detsamma i båda fallen. Detta möjliggör överflytt från transport på väg till andra energieffektivare något långsammare transportslag såsom tåg och sjöfart. Även här kan offentlig sektor främja denna utveckling genom att själva välja det energieffektiva alternativet. Insatsens målgrupper är främst offentliga aktörer och åkerier, andra transportköpare är sekundär målgrupp. Dessa insatser motverkar hindret Asymmetrisk information, eftersom det ökar transparensen av hur energieffektiv en transport är gentemot köparen. Observera att detta skulle vara en ökad kostnad för enskilda offentliga aktörer på kort sikt. Detta kan delvis motiveras med att EU har satt som riktlinjer att offentliga aktörer ska vara föregångare. En annan motivering är att detta skulle kunna bidra till att påskynda utvecklingen av marknaden för energieffektiva transporter, något som på sikt skulle minska de externa effekterna och kunna vara samhällsekonomiskt motiverat. Överväg att Trafikverket får ansvaret för cykelinfrastruktur Persontransporter Kopplat till ovanstående om fysisk planering är utbyggandet av cykelbanor ett sätt som möjliggör överflytt från andra transportslag till cykel. Idag är ansvaret för cykelinfrastruktur otydligt och splittrat, och ett förslag är därför att cykelinfrastruktur läggs att ingå i Trafikverkets uppdrag. Målgruppen för denna insats är således Trafikverket. Även denna insats kan sägas överbrygga Delade incitament mellan aktörer samt överbrygga viss form av Begränsad rationalitet (kopplad till preferenser), eftersom det uppstår attraktiva alternativ till bilkörning. Bonus-malus-system för privatbilism Persontransporter Ett bonus-malus-system bygger på tanken att förorenarna får betala. Ett alternativ är således att kostnaden för inköp av energieffektiva bilar kan minska något, och att kostnaden för att köpa mindre energieffektiva bilar ökar i motsvarande grad. På samma sätt kan även justeringar vad gäller drivmedelskostnader ske. Bonus-malus-system rekommenderas att utredas ytterligare för att fortsätta värdera kostnader-nyttor samt konkretisera en potentiell utformning. 19 december

189 Målgrupperna för denna insats är privatpersoner och företag som planerar att köpa en bil, biltillverkare och återförsäljare. Denna insats överbrygger Finansiella för att satsa på energieffektiv teknik. Således minskar risken att investera i ny teknik, vilket riktar sig mot hindret Kunskap och osäkerhet om ny teknik. Dessutom talar insatsen mot hindret Begränsad rationalitet, eftersom köpare finner det attraktivt med en skattereduktion. Incitament för early-adopters Persontransporter Utöver energibesparing kan övervägas införande av ytterligare incitament för early-adopters av ny energieffektiv teknik. Norge har exempelvis infört ett antal fördelar för elbilar: gratis parkering, möjlighet att utnyttja bussfiler etcetera. Om sådana former av incitament infördes i Sverige skulle det kunna gynna försäljningen av elbilar. Detta är något som delvis kan sägas överbrygga hindret Kunskap och osäkerhet om ny teknik, eftersom det ökar viljan att satsa på ny teknik samtidigt som tekniken används mer och mer och kunskapen om denna sprider sig mun-mot-mun-metoden. I Norge ges även en kraftig skattesubvention, vilket minskar Finansiella. Viktigt att notera är dock att sådana här former av incitament endast är applicerbara under en begränsad tidsperiod, med syfte att få igång marknaden. Det är därefter viktigt att de inte fasas ut allt för hastigt, för att undvika policyinstabilitet. Målgrupperna för denna insats är privatpersoner och företag som planerar att köpa en bil, biltillverkare och återförsäljare. Detta förslag bör dock utredas ytterligare, eftersom det inte är säkert att detta leder till att mindre energieffektiva bilar byts ut. En norsk studie visar att många norska hushåll köpt en elbil för att ha som extrabil. Detta leder till att bilparkens kapacitetsutnyttjande sjunker, vilket inte gynnar energieffektivitet totalt sett. 234 Momsreduktion bilpooler Persontransporter Andra persontransporter i Sverige, såsom tåg-, flyg., buss- och taxitransporter av människor har idag 6 procent moms, medan bilpooler har 25 procent. 235 I syfte att främja bilpooler föreslås att momsen på dessa sänks eller helt tas bort. Målgrupperna för denna insats är främst privatpersoner och företag samt bilpoler. Denna insats överbygger främst Finansiella, men även Kunskap och osäkerhet om ny teknik eftersom den upplevda risken med att ansluta sig till en bilpool (vilket för många är ett nytt koncept) minskar. Omfördela mer av skatterna och avgifter för dieselbilar på den rörliga kostnaden (drivmedelsskatten) Persontransporter Fordonsskatten för koldioxidbeskattade bilar består av ett grundbelopp och en koldioxidkomponent. För dieselbilar tillkommer dock en bränslefaktor och miljötillägg. 236 Således ligger en större del av skatten som totalt betalas för dieseldriven bil och diesel på dieselbilens fordonsskatt. En större andel av skatten på drivmedelet, såsom för bensinbilar, skulle stärka prissignalen vad gäller marginalkostnaden att köra dieseldrivna bilar (och således att förbruka diesel). Detta är dock inget som Sweco utrett mer i detalj, men det rekommenderas att en skatteväxling vad gäller diesel och dieseldrivna bilar tittas vidare på. 234 Holtsmark, Bjart, Skonhoft, Anders: The Norwegian support and subsidy policy of electric cars. Should it be adopted by other countries?, Skatteverket: 6 procents moms, hämtat från 1259e4d html, Transportstyrelsen: Skattens storlek, hämtat från den 17 december december

190 Ta bort rådgivning för transporter inom ramen för EKR Persontransporter Transporter har idag en liten roll inom energi- och klimatrådgivningen. Eftersom kompetens inom energieffektiva transporter bedöms ligga något utanför energi- och klimatrådgivarnas ordinarie kompetensområde bör övervägas att helt slopa transportdelen inom EKR. Detta I syfte att bättre kunna rikta resurserna Översikt av styrmedelsrekommendationer I Tabell 22 visas en översikt av Swecos styrmedelsrekommendationer. Alla typer av styrmedel finns representerade, dock ligger tyngdpunkten på informativa styrmedel. De flesta av styrmedlen är vidareutvecklingar av styrmedel som idag ingår i styrmedelsportföljen, dock är några av dessa nya. 19 december

191 Tabell 22: Översikt av styrmedelsrekommendationer Typ av styrmedel Sektor Administrativa Informativa Ekonomiska FoU Flerbostadshus Lokaler Småhus Energiintensiv industri Övrig tillverkande industri Persontransporter Godstransporter Källa: Sweco, 2014 Uppföljning BBR Uppföljning BBR Utnyttja LOU och befintliga nätverk för att främja avtal som minskar asy info Uppföljning BBR Utveckla tillsynsarbetet Morot & Piska Trafikverket ansvarig myndighet för cykelinfrastruktur Förbättrad kontroll av fjärrtrafik Använd LOU till att främja energieffektiva transporter Förbättrad infospridning resultat EM:s nätverk Främja energitjänstemarknaden EKR stärks samt uppsöker BRF:er Etablera kompetenscentrum Förbättrad infospridning resultat EM:s nätverk Främja energitjänstemarknaden EKR stärks Öka kännedom om EM:s hemsida, testresultat etcetera. Vidareutveckla energimärkning hus Kompetenshöjning via branschorganisationer, ledningskurser Nätverksarbete flera ledningsnivåer, internationellt arbete, riskhantering Främja energitjänstemarknaden Nätverksarbete stödprocesser, beteende och riskhantering Mer medveten fysisk planering Ta bort EKR transporter Mer medveten fysisk planering Bonus-malus-system Incitament för early-adopters Momsreduktion bilpooler Skatteväxling dieselbilar 19 december

192 Övergripande Mer långsiktiga system Mindre start-stopp vad gäller styrmedel generellt och speciellt bidrag. Detta skapar Policyinstabilitet och en ojämn marknad för berörda tekniker. Exempelvis köper ingen en viss teknik under en tidsperiod då man vet att ett bidrag kommer att införas efter tidsperioden. Utveckla energistatistiken Dagens energistatistik har brister, och det skulle vara av stort värde om statistik som var uppdelad i fler undernivåer tillhandahölls. Speciellt vad gäller tjänstesektorns energistatistik finns stor förbättringspotential, även om detta givetvis även har att göra med tillgång på mätdata Övriga diskuterade åtgärder Inom projektgruppen har även ett antal andra åtgärder diskuteras. Bedömningen har dock gjorts att de av olika skäl inte är lämpliga att föreslås som styrmedel. ROT-avdrag för energieffektiviseringar för bostadsrättsföreningar kan möjligtvis ha en positiv påverkan på bostadsrättsföreningars beteende och attityd. Finansiella skulle även minska, även om detta inte bedömts vara ett stort. Dock går det förmodligen inte att rättfärdiga nationalekonomiskt. Ett sådant ROT-avdrag skulle troligtvis leda till fler energieffektiviserande åtgärder i sektorn, dock skulle det troligtvis vara kostsamt och kosta mer än det smakar. Ett frivilligåtagande om att sänka energianvändningen (så som många av SABOs medlemmar anslutit sig till i Skåneinitiativet) vore av stort värde. Genom kunskapsutbyte mellan företagen skulle Transaktionskostnader och Kunskap och osäkerhet om ny teknik minska. Det är dock inte givet vad statens roll i detta skulle vara. Av den nya teknik som tas fram brister det ofta i kommersialiseringsfasen. Detta får konsekvensen att påvisade energieffektiviseringspotentialer många gånger aldrig realiseras. Detta är en svårighet vad gäller kommersialisering av forskningsresultat generellt i samhället. Privata aktörer bör fylla denna lucka snarare än staten, dock är det ett problem att detta inte görs i tillräckligt stor utsträckning idag. Investeringslån och försäkring mot risker har kommit upp som initiativ som skulle kunna främja ytterligare energieffektiviseringar i den energiintensiva industrin. Detta skulle kunna minska företagens upplevda risk vad gäller energieffektiviserande åtgärder och såldes bidra till att reducera hindret Kunskap och osäkerhet om ny teknik. Dock har detta viss karaktär av direktstöd till industrin. Sweco ser inte heller att det skulle vara statens roll att ta fram detta: privata marknadsaktörer borde kunna erbjuda sådana typer av försäkringar och lån. Ett förslag som kommit upp är arbeta med privata finansieringsorgan (exempelvis banker) för att bygga upp deras kompetens om energieffektiviseringsåtgärder. Det bedöms dock som osäkert om detta är statens roll. Dessutom har branschen (finansieringsorgan) har tidigare uttryckt sig negativt angående detta förslag. 19 december

193 En vidare utveckling och kommersialisering av biobränslen i Sverige vore av värde. Detta är främst relaterat till miljönytta, snarare än energieffektivisering. Därför bedöms det ligga utanför ramen för detta uppdrag. Underhåll och utbyggnad järnväg är önskvärt ur ett energieffektiviseringsperspektiv. Detta överbygger inget speciellt, utan har mer karaktären av en systemåtgärd. Att tillåta längre och tyngre fordon är något som har potential att höja energieffektiviteten per tonkm. Det kan dock finnas andra aspekter i frågan (exempelvis trafiksäkerhetsaspekter) som inte har studerats inom ramen för detta uppdrag. Detta överbrygger inget speciellt, utan har mer karaktären av en systemåtgärd. 19 december

194 10 Slutsatser I detta kapitel besvaras de huvudfrågor som ställdes i inledningen av utredningen genom att sammanfatta studiens slutsatser Storleken på identifierade Hur stora/allvarliga är respektive marknadsmisslyckande/ som har identifierats? Sweco har definierat sju kategorier som hindrar energieffektiviseringar som förefaller företagsekonomiskt lönsamma. Till detta tillkommer den energieffektivisering som hindras av externa kostnaders otillräckliga internaliseringsgrad. Notera att sistnämnda inte ingår i det pris som kunden idag möter, och såldes inte i den potential som förefaller företagsekonomiskt lönsamt. Om externa kostnader för produktion och användning av energi inte är internaliserade är detta något som sänder fel prissignal vad gäller önskvärd nivå av energieffektivisering i samhället, och såldes något som hindrar energieffektivisering. Externa kostnader för elanvändning, värmeproduktion och transporter har beaktats. Studien finner att externa kostnader för elanvändning idag är internaliserade i sin helhet. För elanvändare som inte har stora skattelättnader, främst energiintensiv industri och spårbundna transporter, kan de negativa externa effekterna sägas vara överinternaliserade. Energiintensiv industri som betalar 0,5 öre/kwh i energiskatt för el, och andra aktörer med stora skattereduktioner bär möjligtvis inte sina externa kostander. Studiens resultat indikerar vidare att värmeproduktions negativa externa effekter har en sammanvägd internaliseringsgrad på cirka 65 procent. Vad gäller persontransporter är de negativa externa effekterna ifrån flyg internaliserade, men inte för övriga fordon (37-92 procent). För godstransporter är internaliseringsgraden procent beroende på fordonstyp. Hinder som finns i de olika sektorerna kan göra att prissignalen inte når fram. Om målgruppen har låg total energianvändning eller är mycket prisokänslig kan detta också påverka. En litteraturgenomgång har genomförts där Sweco kunnat konstatera att få tidigare ansatser har gjorts att kvantifiera för energieffektivisering. Asymmetrisk information, Kunskap och osäkerheter om ny teknik, Transaktionskostnader samt Organisatoriska faller alla ut som de mest betydande hindren i minst en sektorkategori, se Figur december

195 Figur 56: Hinder per sektor Lokaler - kontor Godstransport Övrig industri Flerbostadshus Småhus Persontransport Energiintensiv industri Källa: Sweco, TWh Asymmetrisk information Kunskap, osäkerhet om ny teknik Transaktionskostnader Begränsad rationalitet Organisatoriska Finansiella Policyinstabilitet Några sticker ut i respektive sektor som mer betydelsefulla än andra, dock kan sägas att hindren samspelar i princip i alla sektorer. Sett till alla sektorer tillsammans ses att de som äter upp mest av energieffektiviseringspotentialen (i TWh totalt för alla sektorer) är Begränsad rationalitet, kunskap och osäkerhet och Organisatoriska, se Figur december

196 Figur 57: Bedömd storlek per Policyinstabilitet Finansiella Organisatoriska Begränsad rationalitet Transaktionskostnader Kunskap, osäkerhet om ny teknik Asymmetrisk information TWh Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa: Sweco, 2014 Hindren kan grupperas i tre olika grupper utifrån deras karaktär; rena marknadsmisslyckanden, verksamhetsrelaterade samt omvärldsrelaterade. Den bedömda storleken på dessa visas i Figur 58. En jämförelse mellan de tre olika kategorierna visar att för nästan alla sektorer är den största gruppen de verksamhetsinterna hindren. För kontorslokaler är gruppen marknadsmisslyckanden lika stor som verksamhetsinterna. Detta beror främst på att Asymmetrisk information är sektorns största. 19 december

197 Figur 58: Fördelning av marknadsmisslyckanden, verksamhetsinterna respektive externt relaterade 100% 90% 80% 70% 60% 50% 40% 30% 20% 10% 0% Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Källa: Sweco, 2014 Marknadsmisslyckanden summa Verksamhetsrelaterat summa Externt relaterat summa 19 december

198 Storlek på TWh Kvantitativ utvärdering av marknadsmisslyckanden och 10.2 Behov att korrigera hindren med hjälp av styrmedel Finns behov av att korrigera respektive marknadsmisslyckande/ med hjälp av styrmedel? Det är inte enbart hindrens storlek som avgör huruvida det är angeläget för staten att åtgärda eller inte. Även statens rådighet över hindret, risken att snedvrida konkurrens (mellan branscher eller inom branscher), Sveriges konkurrenskraft, möjlighet till att åtgärda hindret kostnadseffektivt och möjlig energibesparing är av vikt att ta i beaktning. Sweco har med input ifrån expertpanelerna bedömt angeläenheten att åtgärda respektive för varje sektor. De som totalt sett faller ut som mest angelägna att åtgärda är Kunskap och osäkerhet om ny teknik samt Policyinstabilitet. I Figur 59 och Figur 60 är dessa plottade mot storleken på hindren i TWh för respektive sektor. Negativa externa effekter innefattas inte i dessa bilder. Dock kan sägas finnas ett behov att korrigera detta marknadsmisslyckande med hjälp av en högre internaliseringsgrad. Detta givet att det inte får för negativa effekter på Sveriges konkurrenskraft, om andra länder inte internaliserat externa effekter i samma utsträckning och detta leder till carbon leakage. Figur 59: Angelägenhet vs i TWh 6 Kunskap & osäkerhet om ny teknik Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Angeläget att åtgärda Källa: Sweco, december

199 Storlek på Kvantitativ utvärdering av marknadsmisslyckanden och Figur 60: Angelägenhet vs i TWh 5 Policyinstabilitet Energiintensiv industri Persontransport Småhus Flerbostadshus Övrig industri Godstransport Lokaler - kontor Angeläget att åtgärda Källa: Sweco, december

200 10.3 Den samhällsekonomiska potentialen för energieffektivisering i olika sektorer Hur stor är den samhällsekonomiska potentialen för energieffektivisering i olika sektorer? Negativa externa effekter har lämnats utanför kvantifieringen av samhällsekonomisk potential för energieffektivisering i olika sektorer, då detta marknadsmisslyckande genomgående i rapporten behandlas på ett annat sätt. Det kan dock sägas finnas ett samhällsekonomiskt värde i att internalisera negativa externa effekter Energieffektiviseringspotential och förväntad spontan effektivisering Ingenjörspotentialen definieras i denna studie som summan av alla tekniskt möjliga energieffektiviseringsåtgärder med ett positivt ekonomiskt nuvärde med en given kalkylränta. Både rena investeringar och förbättrad förvaltning, till exempel effektiv drift av fastigheter, logistikplanering för godstransporter etcetera ingår. I Figur 61 visas den uppskattade ingenjörspotentialen för energieffektivisering per sektor. Den sektor som använder störst mängd energi i Sverige är den energiintensiva industrin. I den sektorn finns också den största energieffektiviseringspotentialen sett i absoluta tal, cirka 22 TWh. Figur 61: Bedömd slutanvändning av energi år 2030 samt uppskattning av energieffektiviseringspotential (ingenjörspotential) till 2030 för de sju sektorerna med störst energianvändning Kontorslokaler Godstransporter (väg, spår) Övrig tillverkande industri Flerbostadshus Småhus (inkl fritidshus) Persontransporter (väg, spår) Energiintensiv industri TWh/år Bedömd energianvändning år 2030 Varav potential år 2030 Källa: Sweco, 2014 Energiintensiv industri har även den högsta förväntade spontant realiserade energieffektiviseringen. I och med att sektorn är just energiintensiv finns en tydlig koppling till konkurrenskraft vid effektivisering av sektorns energianvändning. Hur denna sektors energianvändning utvecklas har dock störst osäkerhet eftersom den är starkt bunden till konjunkturen och händelser på världsmarknaden. Inom övrig tillverkande industri är potentialen mindre och det kan även förväntas att mindre effektivisering realiseras spontant. 19 december

201 Gällande fastighetssektorn ses stora skillnader mellan dess delsektorer. Detta beror främst på variation i ägarstruktur. I småhussektorn finns en betydande energieffektiviseringspotential som inte kan förväntas realiseras spontant i särskilt hög grad. Inom kontorslokaler ses däremot en trend att den specifika energianvändningen ökar i nybyggda fastigheter till följd av höjda komfortkrav. Inom befintliga styrmedel kan därför inte en stor spontan effektivisering förväntas. Inom flerbostadshussektorn kan en större andel spontan effektivisering ske i samband med den omfattande renovering som förväntas före år Inom transportsektorn finns stora potentialer, särskilt inom persontransporter. En större andel av potentialen inom persontransporter än inom godstransporter förväntas realiseras spontant. De potentialer som finns genom överflytt från väg till spår eller genom kollektivt åkande är särskilt slagkraftiga eftersom skillnaden i energianvändning per nytta är mycket stor mellan väg och spår. För att på ett korrekt sätt kunna följa upp godstransportsektorn energianvändning behöver den ökande andelen cabotage följas upp. Energieffektiviseringspotentialen och förväntad spontan energieffektivisering för de olika sektorerna visas i Figur 62. Figur 62: Bedömd energieffektiviseringspotential (ingenjörspotential) år 2030, samt förväntad spontant realiserad energieffektivisering till år 2030 Källa: Sweco, 2014 Kontorslokaler Godstransporter (väg, spår) Övrig tillverkande industri Flerbostadshus Småhus (inkl fritidshus) Persontransporter (väg, spår) Energiintensiv industri TWh/år Total potential år 2030 Varav spontant realiserad potential år 2030 Storleken på den förväntade spontana energieffektiviseringen beror bland annat på aktörsstrukturen inom respektive sektor, eftersom de olika ägarkategorierna har olika förutsättningar i kompetens och incitament för energieffektivisering. Aktörsstrukturen kan variera mellan delsektorer, vilket exemplifieras i Tabell 23. Utöver ägarstruktur påverkas den spontana energieffektiviseringen även av om det finns styrmedel riktade till sektorn samt hur effektivt dessa adresserar de aktuella hindren. I och med att aktörsstrukturen har en stor bredd och variation inom delsektorer bör uppföljning av energieffektivitet samt utformning av styrmedel ske med hänsyn till detta så att de olika aktörernas förutsättningar blir korrekt adresserade. 19 december

202 Tabell 23: Exemplifiering av ägarkategorier inom respektive sektor, samt övriga aktörer som påverkar en eller flera sektorer Hushåll Industrin Bebyggelsen Transporter Villaägare Personbilsägare Bostadsrättsägare Privata företag Industriföretag Fastighetsägare lokaler Privata flerbostadshusägare Åkerier Tågfraktföretag Offentlig sektor Statligt ägda industrier Allmännyttiga bostadsbolag Statligt ägda fastigheter Landstingslokaler Persontransporter järnväg Godstransporter järnväg Kollektivtrafik Trafikverket Hyresgäster Tågresenärer Övriga aktörer (ej ägare) Energitjänsteföretag Leverantörer Branschorganisationer Branschorganisationer för ägare Organisationer för brukare Kommunala energi- och klimatrådgivare Kollektivtrafiksresenärer Offentliga upphandlare Godstransportköpare Branschorganisationer Källa: Sweco, 2014 Med utgångspunkt från uppskattningen av ingenjörspotential år 2030 i kombination med kvantifieringen av marknadsmisslyckanden inom respektive sektor, erhålls en bedömning av den samhällsekonomiskt lönsamma energieffektiviseringspotentialen. I den samhällsekonomiska potentialen ingår även den potential som förväntas realiseras spontant. Se även Figur 63. Figur 63: Bedömning av samhällsekonomisk energieffektiviseringspotential år 2030 TWh/år Källa: Sweco, december

203 Reboundeffekter Rekyleffekten 237 har diskuterats och uppskattats men ingår inte i de kvantitativa beräkningarna av potentialen. Rekyleffekten är per definition mätt i absolut energianvändning, inte i energianvändning per nytta. Därför har den mindre betydelse för Sveriges nuvarande nationella mål som är definierat som energianvändning per BNP. Rekyleffektens storlek varierar stort mellan sektorerna. Inom den energiintensiva industrin kan effekten vara mer än 100 procent eftersom den innebär en konkurrensfördel som på sikt kan öka produktionen. Rekyleffekten är däremot nära noll när det gäller uppvärmning av småhus och flerbostadshus eftersom komforten inte blir högre med ökad temperatur i de redan väl uppvärmda hus vi har i Sverige. Inom godstransporter finns risk för en relativt stor rekyleffekt om effektivisering av vägtransporter för med sig en överflytt från spår och sjöfart till väg. Rekyleffekten inom persontransporter bedöms vara mindre eftersom efterfrågan på transporter begränsas av att det tar tid att transportera sig även om transporten är billig och tid är en begränsad resurs Behov att förändra dagens styrmedelsportfölj Hur förhåller sig dagens styrmedelskatalog till befintliga och marknadsmisslyckanden? Hur förhåller sig styrmedlens kostnader till storleken på de /marknadsmisslyckanden som är tänkta att adressera? Finns behov att förändra styrmedelskatalogen? Den nuvarande styrmedelsportföljen bedöms inte adressera hindren i tillräckligt stor utsträckning. Det finns idag få styrmedel som riktar sig mot energiintensiv industri och godstransporter, medan flera adresserar bebyggelsen. Speciellt sektorn energiintensiv industri har en stor energieffektiviseringspotential som borde kunna realiseras i högre utsträckning än idag, om styrmedel gentemot denna sektor utformas på rätt sätt. De flesta av styrmedlen har inte heller gett tillräckliga påvisbara effekter. För ett antal av dessa styrmedel handlar det om att det inte har gått tillräckligt lång tid sedan styrmedlet implementerades för att kunna mäta effekter. Att de intervjupersoner och medverkande i expertpaneler som deltagit i Swecos studie bedömt att för energieffektivisering förligger, och att Sweco genom befintlig litteratur kunnat påvisa att icke-realiserad potential finns för lönsamma energieffektiviseringar, talar även detta för att det finns behov att förändra och vidareutveckla styrmedelskatalogen. Detta förutsatt att hindren går att överbrygga på ett kostnadseffektivt sätt. Analysen påvisar även att den samhällsekonomiska potentialen vida överstiger nuvarande energieffektiviseringsåtgärder. Kostnaden för styrmedel bedöms även vara liten i jämförelse med den samhällsekonomiska potentialen. Därmed finns både utrymme och behov av att komplettera nuvarande styrmedelsportfölj. 237 Att energieffektivisering föder ny energiefterfrågan som motverkar effektiviseringens energibesparande potential kallas för rekyleffekten ( the rebound effect ). 19 december

204 10.5 Förändring av dagens styrmedelsportfölj Hur ska dagens styrmedelsportfölj förändras för att bättre möta de och marknadsmisslyckanden som bedöms tillräckligt allvarliga för att ett behov att korrigera dem föreligger? Några aspekter som Sweco vill lyfta som viktiga att ta i beaktning generellt är att: Icke-internaliserade externa effekter bör i högre grad internaliseras. Dock behövs då tas hänsyn till internaliseringsgrad i andra konkurrerande länder. Detta i syfte att inte snedvrida marknader och riskera carbon leakage. Risk för snedvridning av konkurrens bör beaktas vid all form av styrmedelsutformning. Detta gäller konkurrens inom branscher, mellan branscher och för Sveriges konkurrenskraft gentemot övriga världen. Bedömningar bör göras huruvida en prissignal inte påverkar målgruppen eftersom prissignaler inte når fram (exempelvis på grund av Asymmetrisk information) eller ifall detta beror på att målgruppen inte är priskänslig (exempelvis eftersom energikostnaderna ändå är en liten del av totala kostnader). Om sistnämnda är fallet bör andra former av insatser än prissignaler användas, om det bedöms finnas samhällsekonomiskt värde i att dessa målgrupper energieffektiviserar. Fokus för styrmedelsutformning inom respektive målgrupp bör ligga på att lägga krut på de som anses angelägna att åtgärda, vilket även kopplar till hindrens storlek. Dock är en annan viktig iakttagelse ifrån studien att hindren samspelar med varandra, och att olika typer av styrmedel således behövs för att nå resultat. En flexibilitet i utformningen av styrmedlen bör således finnas, där styrmedlen kan utvärderas och förbättras kontinuerligt. Detta måste dock göras på ett sätt som inte ger upphov till ytterligare upplevd Policyinstabilitet hos aktörerna. Policyinstabilitet åtgärdas inte genom styrmedel som riktar sig mot att överbrygga hindret policyinstabilitet, utan snarare genom att i de styrmedelsutformningar som görs ha en medvetenhet om att Policyinstabilitet bör undvikas. Aktörernas ägandeform varierar, och ofta behövs olika kommunikationssätt för att styrmedel ska få avsedd verkan för de olika aktörerna inom en målgrupp. 19 december

205 Det finns ett antal aspekter som bör tas i beaktning vid utformning av styrmedel inom bebyggelse, industri respektive transporter. Att ta i beaktning vid utformning av styrmedel som riktar sig mot bebyggelse: Det finns ett flertal etablerade styrmedel inom bebyggelse. Det framtida arbetet med styrmedelsutformning gentemot bebyggelsen bör ta sin utgångspunkt i dagens styrmedelskatalog. För småhusägare och bostadsrättsföreningar behövs informationsinsatser för att minska Transaktionskostnader och Kunskap och osäkerhet om ny teknik. Dock finns en svårighet att nå ut till dessa, främst givet målgruppens stora spridning och antal. En prioritering kan behöva göras i vilka som kan nås på ett kostnadseffektivt sätt. Informationsinsatser och en mer välutvecklad energitjänstemarknad kan reducera Asymmetrisk information i kontorslokaler. Eftersom de installationer som görs i fastigheter har lång livslängd är det naturligt att aktörer är riskaversa. Denna Kunskap och osäkerhet om ny teknik kan delvis minskas genom demonstrationer av teknik. Förbättrad uppföljning av befintliga lagkrav är eftersträvandsvärt. Att ta i beaktning vid utformning av styrmedel som riktar sig mot industrin: För övrig tillverkande industri bedöms att en vidareutveckling av dagens styrmedel kan nå resultat i målgruppen, medan energiintensiv industri bedöms behöva ytterligare styrmedel. Kunskap och osäkerhet är ett för energieffektiviseringar, speciellt genom att energieffektiv industri upplever en stor risk med att göra ändringar processen eftersom detta kan äventyra tillverkningen. Ett sätt att sänka företagens upplevda risk kan vara genom demonstrationsprojekt av teknik, som leder till ökad kunskap om tekniken. Ett annat sätt skulle kunna vara att skapa incitament för företagen, vilket leder till att fler tycker att det är värt att ta risken. Övrig tillverkande industri har högre Transaktionskostnader än energiintensiv industri för att komma till stånd med energieffektiviseringar. En välfungerande energitjänstemarknad kan då vara den part som sänker Transaktionskostnader och behovet av att avsätta resurser internt för övrig tillverkande industri. Swecos utvärdering visar att Organisatoriska och Begränsad rationalitet är betydande. Dessa är dock svåra för staten att ha rådighet över. Detta är både av praktiska skäl (hur kan staten delta i ett företags beslutsfattandeprocess) och av principiella skäl (risk för snedvridning av marknaden om staten hjälper några mer än andra). Dessa kan delvis nås indirekt det kan det vara aktuellt med styrmedel av mer incitamentskaraktär för att sätta bollen i rullning i företagen. Det tidigare styrmedelet PFE medförde i sin utformning en överbryggning av vissa organisatoriska som ledningens engagemang, och även att resurser anställdes för att arbeta med energifrågan. 19 december

206 Organisatoriska relaterar även till beteende och den stora energieffektiviseringspotential som inte är teknisk utan istället beteenderelaterad. Mer kunskap behövs inom detta område och hur det kan angripas. Att ta i beaktning vid utformning av styrmedel som riktar sig mot transporter: De sätt som transportsektorn kan energieffektiviseras är genom minskat transportbehov, överflytt mellan transportslag eller energieffektivare fordon. Studien påvisar att det som hindrar som privatpersoner att köpa energieffektivare personbilar ofta är en kombination av osäkerhet om teknik (Kunskap och osäkerhet om ny teknik) respektive den politiska utvecklingen (policyinstabilitet). Den tekniska osäkerheten bedöms till stor grad hanteras av marknaden själv (tillverkare och återförsäljare av bilar). Därför bedöms att staten istället bör utforma styrmedel som skapar incitament för privatpersoner (och företag som köper företagsbilar) att våga köpa energieffektivare personbilar trots de associerade riskerna. Övergång från väg till andra färdslag har potential att bidra till god energieffektivisering. Detta kan främjas genom medveten stadsplanering. Det finns idag en begränsad transparens mellan transportköpare och den aktör som i slutändan utför transporten. Offentliga aktörer skulle kunna vara föregångare inom att efterfråga mer energieffektiva transporter. Att reglerna kring fjärrtransporter (delvis kopplat till den utbredda cabotageverksamheten) inte kontrolleras och efterföljs försämrar ytterligare incitamenten för aktörer (i detta fall främst åkerier) att vara energieffektiva. 19 december

207 Ett antal specifika styrmedelsförslag har även tagits fram av Sweco. Dessa visas i Tabell 24. Tabell 24: Översikt av styrmedelsrekommendationer Typ av styrmedel Sektor Administrativa Informativa Ekonomiska FoU Flerbostadshus Lokaler Småhus Energiintensiv industri Övrig tillverkande industri Persontransporter Godstransporter Uppföljning BBR Uppföljning BBR Utnyttja LOU och befintliga nätverk för att främja avtal som minskar asymmetrisk information Uppföljning BBR Utveckla tillsynsarbetet Morot & Piska Trafikverket ansvarig myndighet för cykelinfrastruktur Förbättrad kontroll av fjärrtrafik Använd LOU till att främja energieffektiva transporter Källa: Sweco, 2014 Förbättrad infospridning resultat EM:s nätverk Främja energitjänstemarknaden EKR stärks samt uppsöker BRF:er Etablera kompetenscentrum Förbättrad infospridning resultat EM:s nätverk Främja energitjänstemarknaden EKR stärks Öka kännedom om EM:s hemsida, testresultat etcetera. Vidareutveckla energimärkning hus Kompetenshöjning via bransch-organisationer, ledningskurser Nätverksarbete flera ledningsnivåer, internationellt arbete, riskhantering Främja energitjänstemarknaden Nätverksarbete stödprocesser, beteende och riskhantering Mer medveten fysisk planering Ta bort EKR transporter Mer medveten fysisk planering Bonus-malus-system Incitament för earlyadopters Momsreduktion bilpooler Skatteväxling dieselbilar 19 december

208 Bilagor BILAGA 1: Definitioner Tabellen nedan listar de definitioner vi använt oss av för olika såväl ekonomiska som ingenjörsmässiga begrepp. BEGREPP Energianvändning Energieffektivitet Energieffektiviserings gap Hinder Kostnad Kostnadseffektiv Lönsam Marknadsmisslyckande Nytta DEFINITION SOM ANVÄNDS I RAPPORTEN När energi används for olika ändamål. Den teknologorienterade definitionen av energieffektivisering är att energieffektivisering är förhållandet mellan energianvändning och produktion av energinytta. Till skillnad ifrån begreppet energianvändning som mäts i absoluta mått, mäts energieffektivitet som ett förhållande mellan två storheter. Detta kan exempelvis vara kwh/kvm eller kwh/bnp. Energieffektiviserings gap är en benämning för företeelsen att hushåll och företag inte investerar i alla energieffektiviseringsåtgärder som är lönsamma för dem eller samhället. Om så är fallet finns en samhällsekonomisk potential att förbättre energieffektiviteten. Energieffektiviseringsgapet avser egentligen privata kalkyler, dvs. externa effekter är oväsenliga i sammanhanget. Energieffektiviserings gap beskrivs ofta med utgångspunkten i en fri marknad utan marknadsinterventioner. Det är alltså inte ett förhållande som speglar situationen i Sverige idag. Utöver marknadsmisslyckanden kan det föreligga andra för att nå ökad energieffektivisering. Eftersom inte är renodlade marknadsimperfektioner kan det finnas som bör finnas på en marknad, och andra som kan vara av intresse att överbygga med statliga insatser för att exempelvis motivera politiskt uppsatta energimål. Kostnad kan antingen beakta enskilda aktörers utgifter och summera ihop dessa eller, i ett bredare perspektiv, även innefatta alla resursers alternativanvändning. Vanligtvis tillämpas en kalkylränta i investeringskalkyler för att beakta alternativkostnader. Andra kostnader kan också vara viktiga att beakta, t.ex. vad avser tidsåtgång och komfort. I samhällsekonomiska analyser brukar negativa externa effekter (t.ex. miljöskador) beaktas som en samhällsekonomisk kostnad. Ekonomisk lönsam en investering som kan uppvisa ett positivt ekonomiskt överskott givet kalkylförutsättningar anses som kostnadseffektiv. En situation där önskad nytta/kvantifierade mål uppnås till lägsta möjliga samhällsekonomiska kostnad Mest lönsam en jämförelse mellan olika investeringar där den mest lönsamma också anses som kostnadseffektiv. De flesta är enliga om att en ränta måste användas för att en investering ska kunna kallas lönsam, dock varierar vilken nivå denna ränta anses ska vara för energieffektiviseringsinvesteringar. Ett marknadsmisslyckande är en företeelse som gör att marknaden inte fungerar optimalt. Detta gör att samhällets ekonomi och nytta inte maximeras. Ekonomer definierar marknadsmisslyckanden i förhållande till en teoretisk perfekt fungerande ekonomi. I princip kan statliga ingripanden motiveras utifrån potentialen att förbättra den faktiska marknadslösningen i förhållande till en sådan perfekt fungerande ekonomi. I praktiken finns det också kostnader även för väl utformade statliga ingripanden, samt betydande risker för regleringsmisslyckanden. Det innebär att kostnaderna för marknadsmisslyckanden bör vägas mot kostnaderna för de åtgärder som kan lösa dem, samt risken för regleringsmisslyckanden. An economic term referring to the total satisfaction received from consuming a good or service. A consumer's utility is hard to measure. However, we can determine it indirectly with consumer behavior theories, which assume that consumers will strive to maximize their utility. For the usual person, utility increased with wealth but at a decreasing rate. Utility, or usefulness, is the ability of something to

209 BEGREPP Primärenergi Rekyleffekten/ Reboundeffekten Samhällsekonomi Samhällsekonomiskt perspektiv Samhällsekonomiskt effektiv Samhällsekonomi skt motiverad DEFINITION SOM ANVÄNDS I RAPPORTEN satisfy needs or wants. [1] Utility is an important concept in economics and game theory, because it represents satisfaction experienced by the consumer of a good. Not coincidentally, a good is something that satisfies human wants and provides utility, for example, to a consumer making a purchase. It was recognized that one cannot directly measure benefit, satisfaction or happiness from a good or service, so instead economists have devised ways of representing and measuring utility in terms of economic choices that can be counted. Nyttomaximerande En nyttomaximerande person väljer det som ger hen flest fördelar eller mest njutning i förhållande till hur mycket det kostar. Primärenergi är en teknisk term för energi som inte, av människan, har omvandlats till annan form av energi. Primärenergi kommer från primära energikällor som är en benämning på energikällor i den form som de tillförs ett energisystem. Det kan till exempel röra sig om råa bränslen som råolja och stenkol. Primära energikällor kan omvandlas till mer användbara former, till exempel elektricitet eller finare bränslen. Dessa brukar då kallas sekundära energikällor. En benämning för det faktum att det inte finns ett ett till ett förhållande mellan energieffektivisering och energianvändning på grund av ekonomiska återverkningseffekter. Lönsam energieffektivisering bidrar till lägre kostnad för energianvändning och således till lägre konsumtions- och produktionskostnader. Detta ger upphov till två effekter: en inkomst (output)- respektive en substitutionseffekt. Substitutionseffekten innebär att aktörerna efterfrågar mer av den vara eller resurs som blivit relativt billigare, medan inkomsteffekten innebär att aktörernas efterfrågan på alla (normala) varor eller resurser ökar till följd av en ökad realinkomst. Återverkningarna kan ske i flera led i ekonomin och när alla dessa beaktas talar man om den ekonomiövergripande rekyleffekten. Något som kallas samhällsekonomiskt berör ekonomiska förhållanden i samhället som helhet, till skillnad från företagsekonomisk och privatekonomisk, som rör enstaka företag respektive individer. Att betrakta något med en nationalekonoms glasögon och att eftersträva alla aktörers totala sammanvägda maximala nytta. En samhällsekonomiskt effektiv resursanvändning maximerar välfärden i samhället genom att uppfylla det så kallade paretokriteriet som säger att resurserna inte kan omfördelas så att någon får det bättre utan att någon annan för det sämre. En samhällsekonomiskt effektiv energianvändning är en del av detta tillstånd i ekonomin. Om alla marknader fungerar teoretiskt perfekt, vilket innefattar att alla externa effekter är internaliserade, är den situation som spontant uppstår lika med den samhällsekonomiskt effektiva. I nationalekonomisk teori är då samhällets nytta av att använda en ytterligare enhet av en resurs lika stor som kostnaden för att tillhandahålla den. Samhället har då använt all energi som smakar mer än den kostar. Resursen energi kan alltså inte studeras isolerat från annan resursanvändning. I praktisk mening bidrar en åtgärd till samhällsekonomisk effektivitet om den uppvisar lönsamhet i en samhällsekonomisk kalkyl. I sådana kalkyler tillämpas en kalkylränta för att beakta resursanvändningens alternativkostnad, det vill säga den nytta som valts bort. Olönsamhet är här liktydligt med att resurserna kan användas mer effektivt om de investeras i något annat. Samhällsekonomiskt effektiv betyder att målet maximerar välfärden. Samhällsekonomiskt motiverad innebär att något är samhällsekonomiskt lönsamt. Positivt nuvärde av alla kostnader och intäkter som är förknippade med förbrukning av resurser eller effekter och nytta som medborgarna och företagen är villiga att betala för. (Den önskade energianvändningen är ett subjektivt begrepp baserat på värderingar. Teoretiskt sett behöver inte det önskvärda vara vare sig effektivt eller optimalt. Vidare kan det finnas skillnader mellan de enskilda aktörernas och samhällets värderingar.) 19 december A report to Näringsdepartementet

210 BEGREPP Systemperspektiv (energisystem resp. ekonomiska system) Tekniskt optimal energianvändning Transaktionskostnader Välfärd DEFINITION SOM ANVÄNDS I RAPPORTEN Energisystem Systemperspektiv innebär ett avgränsat område inom vilket vissa regler styr aktörers energianvändning inom området och en förändring påverkar - direkt eller indirekt - andra aktörer. Det avgränsade området kan utgöras av ett land, en stad eller en fabrik t ex. Ett val om att beakta och värdera användningen av Primärenergi eller ha ett fokus på slutanvänd energi. Användningen av primärenergi är direkt kopplat till hur mycket energi som tas i anspråk och därmed också hur stora utsläppen till mark, luft och vatten blir. Primärenergi är ett tekniskt begrepp som inte beaktar värdet av olika resurser och inte heller marknaders funktionssätt. Ekonomiska system Systemperspektivet omfattar hela samhällets ekonomi inte bara energirelaterad ekonomi. Påverkan på investeringsmönster och konkurrenskraft etcetera Med tekniskt optimal energianvändning avses den användning och sammansättning av energibärare som är optimal då enbart energiinnehållet betraktas. Någon hänsyn tas således inte till kostnaderna utan resursen energi studeras isolerat. Med Transaktionskostnader avses sökkostnader för att hitta rätt produkt och rätt företag samt eventuella kostnader för att förhandla fram avtal och genomföra en affär. Läroboken underlättar analysen av marknader genom att anta att det inte finns några Transaktionskostnader samt att alla aktörer har all information de behöver. I verkligheten kostar alla transaktioner tid och ibland pengar och det kostar att informera sig. Ibland är dessa kostnader relativt små medan de andra gånger är mycket höga, t.ex. vid husköp. Dessa kostnader är verkliga kostnader som måste beaktas av rationella aktörer. Transaktionskostnader är i sig inget marknadsmisslyckande utan har som all annan resursanvändning en alternativkostnad. Alla konsumtions- och produktionsval inbegriper Transaktionskostnader. Transaktionskostnader kan vara av flera olika slag. Dels kan det handla om kostnader för att hitta information eller en leverantör, dvs. olika typer av sökkostnader. Dels kan det handla om kostnader förknippade exempelvis med att skriva ett kontrakt. Detta kan särskilt vara fallet för nya tjänster där erfarenheten av att utforma kontrakt på området är begränsat. Detta gäller speciellt om det också är svårt att mäta output, vilket kan vara fallet med vissa tjänster relaterat till energieffektivisering. Regeringens definition i utredning: Den insats som åtgår för köparen av en energi åtgärd, från det att idén om åtgärd uppstår, inklusive att skaffa information, undersöka möjliga alternativa utföranden, leta upp utförare eller leverantörer, förhandla med dem, beställa, hålla kontakter under utförandet, följa upp samt utvärdera genomförandet. Samlande benämning på människors levnadsförhållanden Inom begreppet rymmer dock både materiell välfärd och mental välfärd. Med materiell välfärd menas ekonomiska resurser, förväntad livslängd och andra mer objektiva välfärdsindikatorer. Med mental välfärd menas mer subjektiva eller subtila välfärdsindikatorer som exempelvis olika mått på välbefinnande, upplevd lycka och livstillfredsställelse. Begreppet Välfärd kan således beskrivas som ett mått på både fysiska och psykiska parametrar för livskvalitet och välbefinnande. Det förefaller rimligt att utgå från att samhällets resurser skall användas för samhällsinvånarnas bästa, vilket kan formuleras som att resurserna skall användas så att välfärden i samhället maximeras. I ekonomisk teori definierar man ofta välfärd som en sammanvägning av de enskilda individernas levnadsstandard, eller med andra ord en sammanvägning av individuella nyttor. 19 december A report to Näringsdepartementet

211 BILAGA 2.1: Viktigaste källor för Ecofys kvantifieringen av externa kostnader för el- och värmeproduktion Tabell 25: Informationskällor för Ecofys Projektnamn Kommentar ExternE ( ) (External Costs of Energy) CASES ( ) (Cost Assessment for Sustainable Energy Systems) NEEDS ( ) (New Energy Externalities Development for Sustainability) Ett storskaligt EU-finansierat och EU-omfattande forskningsprojekt. Tog fram ett förhållningssätt (bland annat impact pathway metoden) till att förstå och värdera de externa kostnaderna. Ett projekt stött av EUs forskningsprogram FP6. Målet var att skapa en konsekvent och heltäckande bild av hela kostnaden för energi, inklusive privata och externa kostnader, nu och i framtiden. Ett projekt stött av EUs forskningsprogram FP6. Fokus var att utveckla bland annat livscykelanalys (LCA) för olika energiteknologier och metoder för monetär värdering av externa effekter. ReCiPe ( ) Projektet initierades av Nederländerna. Utvecklade en integrerad analysmetod utifrån LCA metoden för bedömning av en mittpunkt och slutlig konsekvens för 18 kategorier av miljöpåverkan. CE Delft (2010) Shadow Prices Handbook Källa: Ecofys, EU-kommissionen, 2014 Projektet fokuserade på bedömning av monetära värden för miljöskador utifrån olika metoder (abatement, damage and direct valuation approaches). 19 december A report to Näringsdepartementet

212 BILAGA 2.2: Analysmetod tillämpad i Ecofys Figur 64: External-E analysverktyg för kvantifiering av externa kostnader för el- och värmeproduktion Källa: Ecofys, EU-kommissionen, 2014 Figur 65: Schematisk bild av relationen mellan kategorier av miljöpåverkan och relaterade skador enligt ReCiPe - ramverket Källa: Ecofys, EU-kommissionen, december A report to Näringsdepartementet

KVANTIFIERING AV HINDER FÖR ENERGIEFFEKTIVISERING

KVANTIFIERING AV HINDER FÖR ENERGIEFFEKTIVISERING 2013-06-14 Sweco har på uppdrag av Näringsdepartementet kvantifierat hinder som gör att energieffektivisering inte kommer till stånd samt energieffektiviseringspotentialen i olika sektorer. Analysen visar

Läs mer

Energieffektivisering Energimyndighetens strategier

Energieffektivisering Energimyndighetens strategier Energieffektivisering Energimyndighetens strategier 2009-11-24 Carin Karlsson Avdelningen för hållbar energianvändning carin.karlsson@energimyndigheten.se Nya satsningar i Sverige I energipropositionen

Läs mer

Hearing. #renoveringsstrategi WIFI: birgerjarl birgerjarl

Hearing. #renoveringsstrategi WIFI: birgerjarl birgerjarl Hearing #renoveringsstrategi WIFI: birgerjarl birgerjarl Bakgrund Energieffektiviseringsdirektivets artikel 4 En första version av strategin ska offentliggöras senast den 30 april 2014 Strategin kommer

Läs mer

MARKNADSIMPERFEKTIONER. Ofullständig konkurrens

MARKNADSIMPERFEKTIONER. Ofullständig konkurrens MARKNADSIMPERFEKTIONER Ofullständig konkurrens Ofullständig information (asymmetrisk information) Externa effekter Kollektiva nyttigheter Ständigt fallande genomsnittskostnader (Jämviktsbrist/trögheter)

Läs mer

Ett hållbart energisystem Målsättningar och styrmedel. Klimatutbildning, 18 mars 2014, Luleå

Ett hållbart energisystem Målsättningar och styrmedel. Klimatutbildning, 18 mars 2014, Luleå Ett hållbart energisystem Målsättningar och styrmedel Klimatutbildning, 18 mars 2014, Luleå Energipolitiska mål för Sverige fram till 2020 Energimyndighetens vision: Ett hållbart energisystem Svensk och

Läs mer

Hushållens energianvändning - vilken roll har informationsstyrmedel?

Hushållens energianvändning - vilken roll har informationsstyrmedel? Hushållens energianvändning - vilken roll har informationsstyrmedel? Thomas Broberg och Andrius Kazukauskas (CERE, Umeå Universitet) 18 februari, 2015 Om projektet Start: oktober, 2013 Avslut: oktober,

Läs mer

Vägval Energi vilka egentliga vägval rymmer framtiden?

Vägval Energi vilka egentliga vägval rymmer framtiden? Vägval Energi vilka egentliga vägval rymmer framtiden? Staffan Eriksson, IVA Huvudprojektledare Vägval energi 15 oktober 2009 IVAs uppdrag IVA ska till nytta för samhället främja tekniska och ekonomiska

Läs mer

Sammanställning av workshops, hearings och intervjuer

Sammanställning av workshops, hearings och intervjuer Sammanställning av workshops, hearings och intervjuer Viktigt för uppdraget har varit att samråda med berörda intressenter och aktörer för att få ta del av deras synpunkter, kunskaper och erfarenheter.

Läs mer

Utveckling av Frivilliga avtal för energibolag och energitjänsteföretag

Utveckling av Frivilliga avtal för energibolag och energitjänsteföretag Utveckling av Frivilliga avtal för energibolag och energitjänsteföretag En utveckling av till Energimyndighetens ER 2013:04 Implementering av artikel 7 i energieffektiviseringsdirektivet Bakgrund Energimyndigheten

Läs mer

Klimatåtgärder och energieffektivisering Vilka styrmedel är kostnadseffektiva i ett samhällsperspektiv?

Klimatåtgärder och energieffektivisering Vilka styrmedel är kostnadseffektiva i ett samhällsperspektiv? Klimatåtgärder och energieffektivisering Vilka styrmedel är kostnadseffektiva i ett samhällsperspektiv? Stefan Jendteg Miljöavdelningen Länsstyrelsen Skåne Utsläpp av växthusgaser i Sverige 2010 (66 Mton)

Läs mer

Remiss av Energimyndighetens rapport Implementering av artikel 7 i energieffektiviseringsdirektivet Energimyndighetens

Remiss av Energimyndighetens rapport Implementering av artikel 7 i energieffektiviseringsdirektivet Energimyndighetens YTTRANDE 2 maj 2013 Dnr. 6-18-13 Näringsdepartementet 103 33 Stockholm Remiss av Energimyndighetens rapport Implementering av artikel 7 i energieffektiviseringsdirektivet Energimyndighetens beräkningar

Läs mer

Naturvårdsverket anser att en ökad samordning med tillsyn enligt miljöbalken är önskvärd.

Naturvårdsverket anser att en ökad samordning med tillsyn enligt miljöbalken är önskvärd. 1(6) SW E D I SH E N V IR O N M EN T A L P R OT E C T IO N AG E NC Y YTTRANDE 2013-05-02 Ärendenr: NV-03015-13 Näringsdepartementet n.registrator@regeringskansliet.se Yttrande över remiss av Energimyndighetens

Läs mer

Bilaga 1 Enkät Frågeformulär. 1 Hinder för energieffektiviseringar. Frågorna besvaras, om inget annat anges med ett kryss (X).

Bilaga 1 Enkät Frågeformulär. 1 Hinder för energieffektiviseringar. Frågorna besvaras, om inget annat anges med ett kryss (X). Bilaga 1 Enkät Frågeformulär Frågorna besvaras, om inget annat anges med ett kryss (X). Typ av hinder 1 Hinder för energieffektiviseringar Studier genomförda av forskare identifierar vanligtvis energieffektiviseringsmöjligheter

Läs mer

Fossiloberoende fordonsflotta blir svårt och kostsamt att nå, trots kraftigt höjda skatter och omfattande teknikutveckling

Fossiloberoende fordonsflotta blir svårt och kostsamt att nå, trots kraftigt höjda skatter och omfattande teknikutveckling MILJÖEKONOMI 10 december 2012 Sammanfattande slutsatser Mål för energieffektivisering och förnybar energi fördyrar klimatpolitiken Energiskattens många mål komplicerar styrningen och Program för energieffektivisering

Läs mer

Grön skatteväxling. Policysammanfattning. Teoretisk bakgrund. FORES 2012 Rutqvist, Sköld, Engström Stenson

Grön skatteväxling. Policysammanfattning. Teoretisk bakgrund. FORES 2012 Rutqvist, Sköld, Engström Stenson FORES 212 Rutqvist, Sköld, Engström Stenson Grön skatteväxling Policysammanfattning Teoretisk bakgrund Målet med en grön skatteväxling är inte att öka det totala skattetrycket utan att förändra strukturen

Läs mer

Remissyttrande över Boverkets rapport: Piska och Morot Boverkets utredning om energieffektivisering i byggnader (M2005:4831/Bo)

Remissyttrande över Boverkets rapport: Piska och Morot Boverkets utredning om energieffektivisering i byggnader (M2005:4831/Bo) Remissyttrande över Boverkets rapport: Piska och Morot Boverkets utredning om energieffektivisering i byggnader (M2005:4831/Bo) Miljö- och samhällsbyggnads- Sollentuna den 9 januari 2006 departementet

Läs mer

Bygg- och fastighetssektorns syn på investeringsstöd till renovering och energieffektivisering

Bygg- och fastighetssektorns syn på investeringsstöd till renovering och energieffektivisering Näringsdepartementet 2015-05-12 103 33 Stockholm Anders.lonnberg@regeringskansliet.se Mattias.persson@regeringskansliet.se Bygg- och fastighetssektorns syn på investeringsstöd till renovering och energieffektivisering

Läs mer

Effektivare energianvändning och energitjänster

Effektivare energianvändning och energitjänster Fera 2008-05-14 Effektivare energianvändning och energitjänster Delbetänkande Ett energieffektivare Sverige och Nationell handlingsplan för energieffektivisering EG:s Energitjänstedirektiv Tomas Bruce

Läs mer

2013-05-03. Storgatan 19 Box 5501 114 85 Stockholm telefon 08-783 84 21 info@byggmaterialindustrierna.se

2013-05-03. Storgatan 19 Box 5501 114 85 Stockholm telefon 08-783 84 21 info@byggmaterialindustrierna.se Remissvar avseende Energimyndighetens rapport Implementering av artikel 7 i energieffektiviseringsdirektivet, Energimyndighetens beräkningar och förslag med kompletteringar och Finansdepartementets promemoria

Läs mer

Interaktion mellan de klimat- och energipolitiska målen

Interaktion mellan de klimat- och energipolitiska målen Interaktion mellan de klimat- och energipolitiska målen Mål för energieffektivisering och ökad förnybarhet ökar kostnaden att uppnå mål för minskade utsläpp av växthusgaser till 2020. För att vara motiverade

Läs mer

Virker virkemidlene? Styr styrmedel rätt?

Virker virkemidlene? Styr styrmedel rätt? Virker virkemidlene? Styr styrmedel rätt? Ola Larsson WSP Environmental 3 december 2009 Disposition Information om WSP Bakgrunden till projektet Beskrivning av Fjärrsyn Beskrivning av projektet Analyser

Läs mer

Remissvar avseende Boverkets och Energimyndighetens förslag till nationell strategi för energieffektivisering av byggnader

Remissvar avseende Boverkets och Energimyndighetens förslag till nationell strategi för energieffektivisering av byggnader Näringsdepartementet n.registrator@regeringskansliet.se n.remissser-energi@regeringskansliet.se Remissvar avseende Boverkets och Energimyndighetens förslag till nationell strategi för energieffektivisering

Läs mer

Remissvar Ett energieffektivare Sverige (SOU 2008:25) och Vägen till ett energieffektivare Sverige (SOU 2008:110)

Remissvar Ett energieffektivare Sverige (SOU 2008:25) och Vägen till ett energieffektivare Sverige (SOU 2008:110) Näringsdepartementet 103 33 Stockholm Yttrande 26 januari 2009 Dnr. 6-24-08 Remissvar Ett energieffektivare Sverige (SOU 2008:25) och Vägen till ett energieffektivare Sverige (SOU 2008:110) Sammanfattning

Läs mer

Ledord för Sveriges energipolitik Styrmedel. Energiförsörjning för ett hållbart samhälle. Förnybartdirektivet. Energieffektivisering

Ledord för Sveriges energipolitik Styrmedel. Energiförsörjning för ett hållbart samhälle. Förnybartdirektivet. Energieffektivisering Ledord för Sveriges energipolitik Styrmedel Inom energiområdet Energiläget 2013 sid 56-57, 94-105 En sv-no elcertifikatmarknad Naturvårdverket - NOx Ekologisk hållbarhet Konkurrenskraft Försörjningstrygghet

Läs mer

Ta ansvar för miljö och ekonomi - spara energi

Ta ansvar för miljö och ekonomi - spara energi Ta ansvar för miljö och ekonomi - spara energi 2 Energihushållning är allas ansvar Energieffektiviseringar leder till minskad användning av energi och därmed indirekt till minskade utsläpp av växthusgaser

Läs mer

David A, Pär E, Magnus F, Niklas G, Christian L 2011-02-17 CHALMERS INLÄMNING3. IKOT Grupp B4

David A, Pär E, Magnus F, Niklas G, Christian L 2011-02-17 CHALMERS INLÄMNING3. IKOT Grupp B4 David A, Pär E, Magnus F, Niklas G, Christian L 2011-02-17 CHALMERS INLÄMNING3 IKOT Grupp B4 Innehållsförteckning Kartläggning av användarens röst... 3 Marknadssegment... 3 Kundkedja... 4 Kundundersökning...

Läs mer

Energi- och klimatfrågor till 2020

Energi- och klimatfrågor till 2020 Energi- och klimatfrågor till 2020 Daniel Johansson Statssekreterare Klimatförändringar och andra miljöhot Mänskligheten står inför en global miljöutmaning Jorden utsätts globalt för ett förändringstryck

Läs mer

REMISSVAR. Inledning. 2 maj 2013. I remissen ingår att regeringen vill ha synpunkter på förslagen eller materialet i de bifogade texterna särskilt:

REMISSVAR. Inledning. 2 maj 2013. I remissen ingår att regeringen vill ha synpunkter på förslagen eller materialet i de bifogade texterna särskilt: 2 maj 2013 REMISSVAR IVAs synpunkter på Energimyndightens rapport Implementering av artikel 7 i energieffektiviseringsdirektivet Energimyndighetens beräkningar och förslag med kompletteringar, samt av

Läs mer

Remissvar på Naturvårdsverkets underlag till Färdplan 2050

Remissvar på Naturvårdsverkets underlag till Färdplan 2050 Remissvar på Naturvårdsverkets underlag till Färdplan 2050 Remissvar från Hagainitiativet, Stockholm den 1 februari 2013 Sammanfattning: Naturvårdsverkets underlag till Färdplan 2050 tar sig an en viktig

Läs mer

Kommittédirektiv. Framtidens stöd till konsumenter. Dir. 2011:38. Beslut vid regeringssammanträde den 5 maj 2011

Kommittédirektiv. Framtidens stöd till konsumenter. Dir. 2011:38. Beslut vid regeringssammanträde den 5 maj 2011 Kommittédirektiv Framtidens stöd till konsumenter Dir. 2011:38 Beslut vid regeringssammanträde den 5 maj 2011 Sammanfattning En särskild utredare ska se över det befintliga stödet till konsumenter i form

Läs mer

Elbilar och Laddhybrider

Elbilar och Laddhybrider Elbilar och Laddhybrider Preliminärt förslag för att underlätta introduktionen av elbilar och laddhybrider i Sverige Greger Ledung Energimyndigheten Bakgrund Regeringen har givit Energimyndigheten uppdraget

Läs mer

Framtida Behov och System för Småskalig Värmeproduktion med Biobränslen

Framtida Behov och System för Småskalig Värmeproduktion med Biobränslen Framtida Behov och System för Småskalig Värmeproduktion med Biobränslen Åsa Jonsson, IVL Svenska Miljöinstitutet Susanne Paulrud, SP Sveriges Tekniska Forskningsinstitut Joakim Lundgren, Luleå Tekniska

Läs mer

Industrin och energin. Peter Nygårds 20140402

Industrin och energin. Peter Nygårds 20140402 Industrin och energin Peter Nygårds 20140402 1 Är industrins tid förbi? Tjänstesamhället är tyngdpunkten i samhällsekonomin och därmed för sysselsättning och välfärd. Industrin är på väg till låglöneländer.

Läs mer

Ett energieffektivare Sverige (SOU 2008:25), Vägen till ett energieffektivare Sverige (SOU 2008:110)

Ett energieffektivare Sverige (SOU 2008:25), Vägen till ett energieffektivare Sverige (SOU 2008:110) KKV1001, v1.0, 2008-09-15 YTTRANDE 2009-01-29 Dnr 659/2008 1 (10) Näringsdepartementet 103 33 Stockholm Ett energieffektivare Sverige (SOU 2008:25), Vägen till ett energieffektivare Sverige (SOU 2008:110)

Läs mer

Investeringar på elmarknaden - fyra förslag för förbättrad funktion

Investeringar på elmarknaden - fyra förslag för förbättrad funktion - fyra förslag för förbättrad funktion Expertgruppen för miljöstudier den 11 november 2011 Sven-Olof Fridolfsson, fil dr Thomas P. Tangerås, docent www.ifn.se/forskningsprogrammet_elmarknadens_ekonomi

Läs mer

Olika scenarier, sammanställning och värdering. Anna Wolf, PhD Sakkunnig Energifrågor

Olika scenarier, sammanställning och värdering. Anna Wolf, PhD Sakkunnig Energifrågor Olika scenarier, sammanställning och värdering Anna Wolf, PhD Sakkunnig Energifrågor Många olika scenarier Greenpeace 2011 ER 2014:19 Scenarier över Sveriges energisystem WWF/IVL 2011 Energy Scenario for

Läs mer

2014-01-28 Villagatan 17A 619 35 Trosa

2014-01-28 Villagatan 17A 619 35 Trosa Trosa Swedisol AB 2014-01-28 Villagatan 17A 619 35 Trosa Conny Pettersson, vd +46 705 94 62 10 Remissvar avseende Boverkets och Energimyndighetens förslag till nationell strategi för energieffektivisering

Läs mer

Energieffektivisering i Svensk industri-

Energieffektivisering i Svensk industri- Energieffektivisering i Svensk industri- Vad gör Energimyndigheten? Energikonferens ENIG 2010-04-21 Mölndal Thomas Björkman Energimyndigheten Att prata om Stöd till: Forskning, affärsutveckling och företagens

Läs mer

Effektivare energianvändning i Höganäs. Magnus Pettersson, Energisamordnare

Effektivare energianvändning i Höganäs. Magnus Pettersson, Energisamordnare Effektivare energianvändning i Höganäs Magnus Pettersson, Energisamordnare Höganäs är ledande inom metallpulver Världens största och ledande tillverkare av järnbaserade metallpulver Marknadsandel: ~ 35%

Läs mer

Svar till ÖVNING 4. SVAR

Svar till ÖVNING 4. SVAR Svar till ÖVNING 4. 1. Förklara varför en lagstiftning om att arbetsgivaren inte får fråga en arbetssökande om dennes eventuella föräldraledighet torde vara meningslös. SVAR: Arbetsgivaren vill hellre

Läs mer

Vad gör STEM?? - Ställer om energisystemet, - från svart till grön energi - utan magi - men med hårt arbete. Thomas Korsfeldt Generaldirektör

Vad gör STEM?? - Ställer om energisystemet, - från svart till grön energi - utan magi - men med hårt arbete. Thomas Korsfeldt Generaldirektör Vad gör STEM?? - Ställer om energisystemet, - från svart till grön energi - utan magi - men med hårt arbete Thomas Korsfeldt Generaldirektör Energipolitikens tre huvudmål Låg negativ miljö- och klimatpåverkan

Läs mer

Hur främjar Energimyndigheten energitjänster?

Hur främjar Energimyndigheten energitjänster? Hur främjar Energimyndigheten energitjänster? Nätverksträff energieffektivisering och energitjänster, Svensk Energi och Svensk Fjärrvärme 15 maj 2013, Göteborg Glenn Widerström, Energimyndigheten Bakgrund

Läs mer

Miljö- och energidepartementet. Boverkets rapport Förslag till svensk tillämpning av näranollenergibyggnader

Miljö- och energidepartementet. Boverkets rapport Förslag till svensk tillämpning av näranollenergibyggnader Handläggare HDa Datum Diarienummer 2015-08-28 M2015/2507/Ee 1 (5) Miljö- och energidepartementet Boverkets rapport Förslag till svensk tillämpning av näranollenergibyggnader Hyresgästföreningen har beretts

Läs mer

Samhällsekonomiska begrepp.

Samhällsekonomiska begrepp. Samhällsekonomiska begrepp. Det är väldigt viktigt att man kommer ihåg att nationalekonomi är en teoretisk vetenskap. Alltså, nationalekonomen försöker genom diverse teorier att förklara hur ekonomin fungerar

Läs mer

Ta ansvar för miljö och ekonomi. - spara energi

Ta ansvar för miljö och ekonomi. - spara energi Ta ansvar för miljö och ekonomi - spara energi Ta ansvar för miljö och ekonomi - spara energi Framtagen av Länsstyrelsen i Skåne län 2012 Foton: Roza Czulowska och Björn Olsson Energihushållning är allas

Läs mer

Ett energieffektivt samhälle

Ett energieffektivt samhälle Ett energieffektivt samhälle Utgångspunkt Sveriges byggnaders specifika energianvändning ska halveras till år 2050 jämfört med 1995 Tidigare mål revideras nu Skälen Minskad klimatbelastning Minskat omvärldsberoende

Läs mer

Utbildningsmodul 1. Grundläggande om Avtal om energiprestanda. Project Transparense Juni 2015. www.transparense.eu

Utbildningsmodul 1. Grundläggande om Avtal om energiprestanda. Project Transparense Juni 2015. www.transparense.eu Utbildningsmodul 1. Grundläggande om Avtal om energiprestanda Project Transparense Juni 2015 Översikt utbildningsmoduler I. Grundläggande om Avtal om energiprestanda II. Processen från projektidentifiering

Läs mer

ENERGILEDNINGSSYSTEM ISO 50001 2014-06-03

ENERGILEDNINGSSYSTEM ISO 50001 2014-06-03 ENERGILEDNINGSSYSTEM ISO 50001 2014-06-03 CIT INDUSTRIELL ENERGI AB Chalmers teknikpark 412 88 Göteborg Susana Municio municio@cit.chalmers.se VERKSAMHETSOMRÅDEN Energieffektivisering Industri Ökad effektivitet

Läs mer

Sammanfattning 2014:8

Sammanfattning 2014:8 Sammanfattning Varje år placeras i Sverige omkring 8 000 ungdomar i Hem för vård eller boende (HVB). Majoriteten av dessa placeras på grund av egna beteendeproblem, t.ex. missbruk eller kriminalitet. En

Läs mer

Förslag till nya regler om krav på amortering av bolån

Förslag till nya regler om krav på amortering av bolån REMISSVAR Hanteringsklass: Öppen Dnr 2015/287 2015-04-20 Finansinspektionen Box 7821 103 97 STOCKHOLM Förslag till nya regler om krav på amortering av bolån (FI Dnr 14-16628) Sammanfattning Riksgäldskontoret

Läs mer

Näringsdepartementet Remiss nr: N2014-7434-E 103 33 Stockholm. Yttrande över Fossilfrihet på väg SOU 2013:84

Näringsdepartementet Remiss nr: N2014-7434-E 103 33 Stockholm. Yttrande över Fossilfrihet på väg SOU 2013:84 2014-05-16 Näringsdepartementet Remiss nr: N2014-7434-E 103 33 Stockholm Yttrande över Fossilfrihet på väg SOU 2013:84 kemiindustrierna i Sverige och Skogsindustrierna har valt att gemensamt yttra sig

Läs mer

VAD KAN HÄNDA OM INFORMATIONEN INTE ÄR FULLSTÄNDIG? EFFEKTER AV BEGRÄNSAD INFO OM KVALITET:

VAD KAN HÄNDA OM INFORMATIONEN INTE ÄR FULLSTÄNDIG? EFFEKTER AV BEGRÄNSAD INFO OM KVALITET: INFORMATION VAD KAN HÄNDA OM INFORMATIONEN INTE ÄR FULLSTÄNDIG? M A P KVALITET? M A P PRISER? HUR LÖSA PROBLEM MED BRISTANDE INFORMATION? LÖNAR DET SIG ATT BEGRÄNSA INFORMATION? I så fall när och för vem?

Läs mer

CAMP 2050 Nässjö 2015-10-01. Tore Carlsson Anna Wistrand Helena Ahlkvist Johansson. Avdelningen för energieffektivisering Energimyndigheten

CAMP 2050 Nässjö 2015-10-01. Tore Carlsson Anna Wistrand Helena Ahlkvist Johansson. Avdelningen för energieffektivisering Energimyndigheten CAMP 2050 Nässjö 2015-10-01 Tore Carlsson Anna Wistrand Helena Ahlkvist Johansson Avdelningen för energieffektivisering Energimyndigheten Upplägg Senaste nytt budgetpropositionen Kort återblick på energi-

Läs mer

Hur ser Svenskt Näringsliv på energifrågan och utvecklingen fram till 2020? Maria Sunér Fleming

Hur ser Svenskt Näringsliv på energifrågan och utvecklingen fram till 2020? Maria Sunér Fleming Hur ser Svenskt Näringsliv på energifrågan och utvecklingen fram till 2020? Maria Sunér Fleming Svenskt Näringsliv Svenskt Näringsliv företräder närmare 60 000 små, medelstora och stora företag 50 bransch-

Läs mer

Utbildningsmodul II. EPC-processen från projektidentifiering till upphandling. Project Transparense. www.transparense.eu

Utbildningsmodul II. EPC-processen från projektidentifiering till upphandling. Project Transparense. www.transparense.eu Utbildningsmodul II. EPC-processen från projektidentifiering till upphandling Project Transparense Översikt utbildningsmoduler I. Grundläggande om EPC II. EPC-processen från projektidentifiering till upphandling

Läs mer

ATT AGERA NU! DAGS. Byggindustrin en basnäring. på en låg energianvändning under byggnadens livstid.

ATT AGERA NU! DAGS. Byggindustrin en basnäring. på en låg energianvändning under byggnadens livstid. VI HAR INGET VAL DAGS ATT AGERA NU! Sverige står inför stora utmaningar. Miljonprogrammets bostäder måste rustas upp och renoveras. Om detta inte sker om kommer områdena att förfalla och byggnaderna förlora

Läs mer

Ett hållbart energisystem. Energimyndigheten

Ett hållbart energisystem. Energimyndigheten Ett hållbart energisystem Energimyndigheten Energimyndighetens verksamhet Vision: Ett hållbart energisystem Analys Teknik Främjande Tillväxt Information och kommunikation Lokal, regional, nationell och

Läs mer

Tjänsteföretagen och den inre marknaden

Tjänsteföretagen och den inre marknaden November 2005 Tjänsteföretagen och den inre marknaden Denna rapport bygger på en SCB-undersökning av företagens kunskaper om och attityder till den inre marknaden som gjorts på uppdrag av Kommerskollegium

Läs mer

Hållbara transportsystem i ett globalt perspektiv. Mikael Karlsson, Fil. Dr. Ordförande Naturskyddsföreningen

Hållbara transportsystem i ett globalt perspektiv. Mikael Karlsson, Fil. Dr. Ordförande Naturskyddsföreningen Hållbara transportsystem i ett globalt perspektiv Mikael Karlsson, Fil. Dr. Ordförande Naturskyddsföreningen Sveriges största miljöorganisation 180000 medlemmar, 6000 aktiva Natur, hälsa, global solidaritet

Läs mer

BUY SMART Green Procurement for Smart Purchasing. Upphandling och skydd av klimatet. D6.3 Nationell skrift om grön upphandling - Sverige.

BUY SMART Green Procurement for Smart Purchasing. Upphandling och skydd av klimatet. D6.3 Nationell skrift om grön upphandling - Sverige. BUY SMART Green Procurement for Smart Purchasing Upphandling och skydd av klimatet D6.3 Nationell skrift om grön upphandling - Sverige Lighting www.buy-smart.info Det här dokumentet har tagits fram inom

Läs mer

Gröna elcertifi kat ett bakvänt och ineffektivt system

Gröna elcertifi kat ett bakvänt och ineffektivt system CECILIA HÅKANSSON Gröna elcertifi kat ett bakvänt och ineffektivt system Våren 2003 infördes gröna certifi kat med kvotplikt på den svenska elmarknaden. Huvudsyftet med styrmedlet är att främja elproduktionen

Läs mer

Sammanfattning och slutsatser 1

Sammanfattning och slutsatser 1 1 Syftet med denna rapport är att ur ett nationalekonomiskt perspektiv analysera hur Sverige bäst utnyttjar sina mineraltillgångar. Fokus ligger på fördelningen av vinsterna mellan staten och privata företag,

Läs mer

Enkätundersökning. Villaägarnas Riksförbund 2010-04-20

Enkätundersökning. Villaägarnas Riksförbund 2010-04-20 Enkätundersökning Villaägarnas Riksförbund 2010-04-20 Pronto Communication AB Kammakargatan 48 111 60 Stockholm T +46 8 23 01 00 F +46 8 23 01 05 info@prontocommunication.se Bakgrund Pronto har på uppdrag

Läs mer

Vägen till ett energieffektivare Sverige (SOU 2008:110) Systemperspektivet som en grundläggande princip

Vägen till ett energieffektivare Sverige (SOU 2008:110) Systemperspektivet som en grundläggande princip Till: Näringsdepartementet 103 33 Stockholm REMISSYTTRANDE Vägen till ett energieffektivare Sverige (SOU 2008:110) SABOs synpunkter Systemperspektivet som en grundläggande princip SABO håller med om att

Läs mer

Styrmedel som kommer att behövas för en omställning av transportsektorn. Bo Rydén & Ebba Löfblad, Profu

Styrmedel som kommer att behövas för en omställning av transportsektorn. Bo Rydén & Ebba Löfblad, Profu Styrmedel som kommer att behövas för en omställning av transportsektorn Bo Rydén & Ebba Löfblad, Profu Tolv slutsatser från projektet 1. Möjligt att minska fossila drivmedel med 80 % 2. Klarlägg begreppet

Läs mer

Leder energieffektivisering till energibesparing?

Leder energieffektivisering till energibesparing? Leder energieffektivisering till energibesparing? Energieffektivisering har blivit ett ledord i klimat- och energipolitiken. Ofta används begreppet synonymt med minskad energianvändning och förväntas leda

Läs mer

Redovisning av regeringsuppdrag miljöskadliga subventioner

Redovisning av regeringsuppdrag miljöskadliga subventioner 1(5) SWEDISH ENVIRONMENTAL PROTECTION AGENCY SKRIVELSE 2014-04-02 Ärendenr: NV-00641-14 Miljödepartementet 103 33 Stockholm Redovisning av regeringsuppdrag miljöskadliga subventioner 1. Uppdraget Naturvårdsverket

Läs mer

Statligt stöd för miljö- och sociala frågor till små och medelstora företag - en jämförande studie mellan Sverige och Storbritannien

Statligt stöd för miljö- och sociala frågor till små och medelstora företag - en jämförande studie mellan Sverige och Storbritannien I ett examensarbete från Sveriges Lantbruksuniversitet (SLU) av Katarina Buhr och Anna Hermansson i samverkan med Nutek, jämförs det statliga stödet till små och medelstora företags arbete med miljöoch

Läs mer

VFTF01 National- och företagsekonomi ht 2010 Svar till övning 2, den 7 september

VFTF01 National- och företagsekonomi ht 2010 Svar till övning 2, den 7 september VFTF01 National- och företagsekonomi ht 2010 Svar till övning 2, den 7 september 1. Knapphet (scarcity) är ett viktigt begrepp för att kunna tala om värden. Använd utbudefterfråge-modellen för att analysera

Läs mer

Det här är elcertifikatsystemet

Det här är elcertifikatsystemet MEDDELANDE 1 (7) Datum 2003-04-23 Dnr Det här är elcertifikatsystemet Den 1 maj år 2003 införs elcertifikatsystemet som ska ge en ökad elproduktion från sol, vind, vattenkraft och biobränslen. Systemet

Läs mer

1:7. Hur Sverige ska nå energi- och klimatmålen inom bebyggelsen

1:7. Hur Sverige ska nå energi- och klimatmålen inom bebyggelsen 1:7 Hur Sverige ska nå energi- och Vi står inför vår tids största utmaning att på kort tid ställa om vår energianvändning till en nivå som skapar förutsättningar för ett långsiktigt hållbart samhälle.

Läs mer

Hållbar uppvärmning med värmepumpar

Hållbar uppvärmning med värmepumpar Hållbar uppvärmning med värmepumpar EFFSYS+ FoU - program för Resurseffektiva Kyl- och Värmepumpssystem Den 26 oktober 2010 Emina Pasic, Energimyndigheten Mål för energipolitiken EU och den svenska riksdagen

Läs mer

Sverigedemokraterna 2011

Sverigedemokraterna 2011 Energipolitiskt program S 2011 Vision För att Sverige ska kunna upprätthålla en hög internationell konkurrenskraft och levnadsstandard vill S föra en energipolitik som säkerställer en prisvärd och tillförlitligenergiförsörjning,

Läs mer

Varför ett nytt direktiv?

Varför ett nytt direktiv? Energieffektiviseringsdirektivet Energibranschens perspektiv Styrmedelsdagen Henrik Wingfors 2013-04-24 Varför ett nytt direktiv? EU:s 20-20-20-mål till år 2020 closing the gap Källa: EU-kommissionen 2

Läs mer

KUNDCASE C4 ENERGI 2

KUNDCASE C4 ENERGI 2 KUNDCASE C4 ENERGI KUNDCASE C4 ENERGI 2 3 KUNDCASE C4 ENERGI Strategi och positionering 4 KOMMUNIKATIV PLATTFORM ELNÄT STADSNÄT FJÄRRVÄRME miljövänlig komfort varje dag 5 KUNDCASE C4 ENERGI Affärsidé C4

Läs mer

Energikartläggning i stora företag

Energikartläggning i stora företag EM1000 W-4.0, 2010-11-17 Datum 1 (8) Avdelningen för energieffektivisering Energikartläggning i stora företag - Frågor och svar Box 310 631 04 Eskilstuna Besöksadress Kungsgatan 43 Telefon 016-544 20 00

Läs mer

Metoduppgift 4: Metod-PM

Metoduppgift 4: Metod-PM Metoduppgift 4: Metod-PM I dagens samhälle, är det av allt större vikt i vilken familj man föds i? Introduktion: Den 1 januari 2013 infördes en reform som innebar att det numera är tillåtet för vårdnadshavare

Läs mer

EU:s påverkan på svensk energipolitik och dess styrmedel

EU:s påverkan på svensk energipolitik och dess styrmedel EU:s påverkan på svensk energipolitik och dess styrmedel Värme- och Kraftkonferensen 2012, Morgondagens energisystem Daniel Friberg 12 november 2012, Energimyndigheten Waterfront Congress Centre Stockholm

Läs mer

Samråd angående marknaderna för lokalt och centralt tillträde

Samråd angående marknaderna för lokalt och centralt tillträde KKV1007, v1.3, 2012-09-10 YTTRANDE 2014-12-04 Dnr 704/2014 1 (5) Post- och telestyrelsen Box 5398 102 49 Stockholm Samråd angående marknaderna för lokalt och centralt tillträde 11-9306, 11-9313 och 14-1253

Läs mer

Framtidskontraktet. Avsnitt: Ansvar för morgondagen med en bättre miljö i dag. Version: Beslutad version

Framtidskontraktet. Avsnitt: Ansvar för morgondagen med en bättre miljö i dag. Version: Beslutad version Framtidskontraktet Avsnitt: Ansvar för morgondagen med en bättre miljö i dag Version: Beslutad version Ansvar för morgondagen med en bättre miljö i dag 5 Klimatfrågan är vår tids ödesfråga. Om temperaturen

Läs mer

SVERIGEDEMOKRATISKT INRIKTNINGSPROGRAM FÖR ENERGIPOLITIK

SVERIGEDEMOKRATISKT INRIKTNINGSPROGRAM FÖR ENERGIPOLITIK SVERIGEDEMOKRATISKT INRIKTNINGSPROGRAM FÖR ENERGIPOLITIK Antogs av Landsdagarna 2011. Tryckversion 2.0-2014-03-04 VISION För att Sverige ska kunna upprätthålla en hög internationell konkurrenskraft och

Läs mer

Enligt socialbidragsnormen ska det finnas drygt 3 000 kronor kvar per vuxen och något mindre per barn efter det att boendet betalats.

Enligt socialbidragsnormen ska det finnas drygt 3 000 kronor kvar per vuxen och något mindre per barn efter det att boendet betalats. Pressmeddelande 2006-03-20 Ny undersökning: Fattiga småhusägare ökar i antal Antalet familjer med småhus som lever under socialbidragsnormen är i dag 145 000. När den nya fastighetsskatten slår igenom

Läs mer

Yttrande över Skatteverkets förslag till föreskrifter om personalliggare och om identifikationsnummer för en byggarbetsplats

Yttrande över Skatteverkets förslag till föreskrifter om personalliggare och om identifikationsnummer för en byggarbetsplats Regelrådet är ett särskilt beslutsorgan inom Tillväxtverket vars ledamöter utses av regeringen. Regelrådet ansvarar för sina egna beslut. Regelrådets uppgifter är att granska och yttra sig över kvaliteten

Läs mer

OLIKA SÄTT ATT RÄKNA

OLIKA SÄTT ATT RÄKNA OLIKA SÄTT ATT RÄKNA Man brukar utgå från en s k fullkostnadskalkyl där alla kostnader (både direkta och indirekta) och en viss vinst är medräknad. En sådan modell tar inte hänsyn till marknadspris och

Läs mer

Sammanfattning Rapport 2012:1

Sammanfattning Rapport 2012:1 Sammanfattning Rapport 2012:1 Mål som styrmedel målet för den offentliga konsumtionen av ekologiska livsmedel Riksdagen satte på regeringens initiativ målet att 25 % av den offentliga livsmedelskonsumtionen

Läs mer

Ekonomi Sveriges ekonomi

Ekonomi Sveriges ekonomi Ekonomi Sveriges ekonomi Ekonomi = Att hushålla med det vi har på bästa sätt Utdrag ur kursplanen för grundskolan Mål som eleverna ska ha uppnått i slutet av det nionde skolåret. Eleven skall Ha kännedom

Läs mer

Problemstillinger knyttet til et norsk/svensk elsertifikatmarked. Martin Johansson

Problemstillinger knyttet til et norsk/svensk elsertifikatmarked. Martin Johansson Problemstillinger knyttet til et norsk/svensk elsertifikatmarked Martin Johansson Energimyndigheten Enheten för operativa styrmedel Energidagarna i Oslo den 14 oktober Historik Elcertifikat infördes den

Läs mer

2020 så ser det ut i Sverige. Julia Hansson, Energimyndigheten

2020 så ser det ut i Sverige. Julia Hansson, Energimyndigheten EU:s 20/20/20-mål till 2020 så ser det ut i Sverige Julia Hansson, Energimyndigheten EU:s 20/20/20-mål till 2020 EU:s utsläpp av växthusgaser ska minska med 20% jämfört med 1990 års nivå. Minst 20% av

Läs mer

En sammanhållen klimat- och energipolitik

En sammanhållen klimat- och energipolitik En sammanhållen klimat- och energipolitik Europas mest ambitiösa klimat och energipolitik En strategi ut ur beroendet av fossil energi Resultatet av en bred process Sverige får en ledande roll i den globala

Läs mer

Tillsyn av penningöverföring, valutaväxling och kontanthantering

Tillsyn av penningöverföring, valutaväxling och kontanthantering Tillsyn av penningöverföring, valutaväxling och kontanthantering AUGUSTI 2015 augusti 2015 Dnr 15-7266 INNEHÅLL Sammanfattning 3 Finansinspektionens tillsyn av penningöverföring, valutaväxling och kontanthantering

Läs mer

Egenföretagare och entreprenörer

Egenföretagare och entreprenörer 5 1 Sammanfattning Varför startar man eget? Och vad är det som gör att man väljer att fortsätta som egenföretagare? V år rapport har två syften. Det första är att redovisa fakta om egenföretagandets betydelse

Läs mer

Samhällsekonomi. Ordet ekonomi kommer från grekiskan och betyder hushålla. Nationalekonomi Hushåll Företag Land Globalt, mellan länder

Samhällsekonomi. Ordet ekonomi kommer från grekiskan och betyder hushålla. Nationalekonomi Hushåll Företag Land Globalt, mellan länder Samhällsekonomi Ordet ekonomi kommer från grekiskan och betyder hushålla Nationalekonomi Hushåll Företag Land Globalt, mellan länder Samhällsekonomi Ordet ekonomi kommer från grekiskan och betyder hushålla

Läs mer

ENERGIRÅDGIVARNA FRAMTIDEN REDAN I DAG

ENERGIRÅDGIVARNA FRAMTIDEN REDAN I DAG ENERGIRÅDGIVARNA FRAMTIDEN REDAN I DAG Roland Jonsson Energichef HSB Riksförbund roland.jonsson@hsb.se 010-4420332 DE FYRA STEGEN Stoppa slöseriet Effektivisera Energieffektivisera Tillförsel 1 STOPPA

Läs mer

ONLINEMÄTNINGAR I BUTIKER

ONLINEMÄTNINGAR I BUTIKER ONLINEMÄTNINGAR I BUTIKER Författare: Anna-Lena Lane Projektnummer: BF01 År: 2012 Onlinemätningar i butiker Rapport förstudie Anna-Lena Lane SP Sveriges Tekniska Forskningsinstitut Projektnummer: BF01

Läs mer

Effekter på kustsjöfarten av likabehandling av transportslagen. Per Kågeson

Effekter på kustsjöfarten av likabehandling av transportslagen. Per Kågeson Effekter på kustsjöfarten av likabehandling av transportslagen Per Kågeson Hypoteser 1. Ett likvärdigt utformat kostnadsansvar för infrastruktur, miljöpåverkan och olyckor leder till att kust- och inlandssjöfarten

Läs mer

Nöjda och trygga kunder konsumentinformation inom försäkring

Nöjda och trygga kunder konsumentinformation inom försäkring Särtryck ur Svensk Försäkrings rapportserie 2013:2 Nöjda och trygga kunder konsumentinformation inom försäkring En sammanfattning Denna sammanfattning utgör ett särtryck ur rapporten Nöjda och trygga kunder

Läs mer

Samhällsekonomi. Ordet ekonomi kommer från grekiskan och betyder hushålla. Nationalekonomi Hushåll Företag Land Globalt, mellan länder

Samhällsekonomi. Ordet ekonomi kommer från grekiskan och betyder hushålla. Nationalekonomi Hushåll Företag Land Globalt, mellan länder Samhällsekonomi Ordet ekonomi kommer från grekiskan och betyder hushålla Nationalekonomi Hushåll Företag Land Globalt, mellan länder Samhällsekonomi Ordet ekonomi kommer från grekiskan och betyder hushålla

Läs mer

Vad innebär nya Energieffektiviseringsdirektivet för Sverige? 7 november 2013 Henrik Wingfors Svensk Energi

Vad innebär nya Energieffektiviseringsdirektivet för Sverige? 7 november 2013 Henrik Wingfors Svensk Energi Vad innebär nya Energieffektiviseringsdirektivet för Sverige? 7 november 2013 Henrik Wingfors Svensk Energi Innehåll Varför ett nytt energieffektiviseringsdirektiv? Vilka krav ställs på Sverige? Vad innebär

Läs mer

Remissvar Förslag om ändrade regler om direktupphandling

Remissvar Förslag om ändrade regler om direktupphandling Socialdepartementet Enheten för upphandlingsfrågor 103 33 Stockholm Stockholm Dnr 2014-01-27 S2013/9124/RU Remissvar Förslag om ändrade regler om direktupphandling Företagarna har givits möjlighet att

Läs mer

Anteckningar från arbetsmöte den 25 april med referensgruppen för nästa fiskeriprogram

Anteckningar från arbetsmöte den 25 april med referensgruppen för nästa fiskeriprogram 1(5) 2012-05-09 Landsbygdsavdelningen Anteckningar från arbetsmöte den 25 april med referensgruppen för nästa fiskeriprogram Inledning Lina Andersson, som är projektledare för att ta fram ett tekniskt

Läs mer