Bli kaffekund hos oss!

Save this PDF as:

Storlek: px
Starta visningen från sidan:

Download "Bli kaffekund hos oss!"


1 Bli kaffekund hos oss! Hos oss kan du bli kaffekund med förmånliga förmåner

2 Bli kaffekund hos oss! Innehåll 1. Kaffebönor Sida 4 2. Kaffesyrup Sida 6 3. Reklammaterial Sida 8 4. För din kaffeservering Sida 9 5. E.S.E. Pods Sida FAP Kapslar Sida 13 Vid kontinuerliga inköp av vårt espressokaffe! Hos oss kan du bli kaffekund med förmånliga förmåner! OmOss Visäljerochservarmaskinerförrestauranger,café,bageri,storkökochprivatbruk.Viimporte rarochmarknadsförbl.a.glassmaskiner,espressomaskinerochkvarnar.ivårtstorakontaktnät finnsbådesvenskaochutländskaleverantörer.våraffärsidébyggerpåattförenklahanteringen avsnabbsåldaproduktersåsommjukglass,espressoochkaffegenomattlevereraprodukterav högkvalitetochbiståvårakundermedgodserviceochsupport.företagethar30årslångerfa renhetavbl.a.glassmaskinerochespressomaskiner.merän35åribranschen. 2 AlrpAgenturAB Telefon: NorraGrängesbergsgatan5,21444Malmö Fax: Som kaffekund hos oss,erhåller ni: Vid leverans av espressokaffe kan vi göra: Servicerabatt10%rabattvidarbetepå espressomaskinen Arbete&reskostnad Brakaffeerbjudanden! Okulärbesiktningavmaskinen Vidbehov,rengöringavgruppermed rengöringsmedel Kontrollavkvarn,justeringvidbehov. Testavfärdigprodukt(espresso:crema, smakmm) E 3

3 Kaffebönor Kaffebönor Cafes Richard, franskt rostat kaffe 250gr, 500gr eller 1kg påsar. Vidköpav1kartonghelaCAFFÈGIOIAbönor Helabönorärdetbästavaletnärduharen (12kg=1680koppar) 5%rabattpålistpriset kvarnellerenespressomaskinmedkvarn.ny Vidköpav2kartongerhelaCAFFÈGIOIAbö maletkaffegerbästatänkbararesultatoch nor(24kg=3360koppar) 10%rabattpålistpri doftenärljuvlig.kaffebönornaärförpackade set ipåsarmedenventilpåframsidan,somsläp Förvart3:einköpavhelkartongCAFFÈGIOIA bönor,medföljer6stkopparheltutankostnad! perutdengassombildasavkaffet,samtidigt somdenstängerförattluftinteskallsläppas Introduktionserbjudande i två delar: intillkaffet.meddethärsystemetbehåller Köp4kgCafféGioiaespressokaffetilllistprisoch bönornasinfräschörochsmakunderhelaför få1kgextrautankostnad varingstiden.dukanköpavårtespressokaffei Vidnästaköpavminst12kgerhållesutanextra påsar,mendukanocksåbeställakartongvis. kostnad: Vidstörrekaffeorder,vänligenkontaktaför 6stGioiaespressokoppar säljningskontoretförenoffert. Köp 5kg, 12stGioiacappuccinokoppar betala för CAR 11.1 Florio, 1kg 4kg! Caffé Gioia, italienskt kaffe 1kg och 250g påsar. 12 kg i en kartong GI 513 BIO & FAIRTRADE, 1kg GI 531 BIO & FAIRTRADE, 250g Söt,godocharomatisk blandning,naturligt ljusochmedlåg koffeinnivå. Fullständigtodlademed biologiskprocessutan fytokemiskagödsel 4 GI 603 Nero, 1kg Smakriktmed rikbouquet, någotsötare ängioia90%. GI 503 Oro, 1kg Vårstorsäl jare!stark smak&rik bouquet,kaffet förkaffeälska renmeden passionfördet mustiga. GI 403 Guld, 1kg GI Guld, 250g 80% Arabica Kraftfullt&di stinktmedper fektbalansi smak&kropp. Finnsocksåi påseom 250gram. GI 303 -Napoli, 1kg 60% Arabica Kraftfulltna politanskt rostatkaffe medperfekt balansismak &kropp. Kraftfullt&krä migt.perfekt balansmellan styrka&mjukhet CAR 10.1 Perle Noire, 1kg CafesRichardtopp blandning Rikt& harmoniskt.en blandningavbästa Arabicabönor,med rund&balanserad. IZ AG Silver, 1kg IZ AU Guld, 1kg Enutsöktbland ningmedenper fektharmoni mellanaromoch smak. CAR 05.1 Colombia, 500g Milt,litesött,myck etmjukt&aroma tiskt.enklassiker CAR 08.1 Jamaican, 250g Riktismaken,med enfantastiskarom. Fylligt&medla gomsyrlighet,en perfektbalans.av mångaansettsom världensbästa kaffe CAR Ethiopan, 500g Vilt&aromatiskt, medenkraftig bouquet IZZO, italienskt kaffe 1kg burkar. Enkaffe blandning avdebästaarabica bönorna GI 103S Silver Strong, 1kg 20% Arabica Ettmycketmustigt kaffemedangenäm smak.fantastiskt gottmedmjölk. 5

4 Kaffesyrup Kaffesyrup TOR T Smaksätt och piffa upp din espresso, Café Latte, Cappuccino, drink, is te, dessert mm med Tora nis kaffesyrups.torani syrups är framför allt framtagna för användning i café, restaurang, bar och coffeeshop, men även för hemmabruk. Syrupen säljs i flaska om 750ml. TOR T TOR T Chai Amaretto Ärdoftandemedsmak Harenmildkryddigsmak avnötter&sötma. medsötma. TOR T Crème de Caramel Karamellsmak. 6 TOR T TOR T Chocolate Bianco Vitchoklad. TOR T TOR T Cinnamon Enaningmerbeskare ändenäktakanelsma ken. TOR T Vanilj Syrupenharen lockandedoftoch enrik,intensivva niljsmak,gjordpå debästavanilj stängerna! TOR T TOR T TOR T TOR T Sockerfri choklad Nyhet!Choklad, utankalorier. TOR T TOR T Nyhet!Syrupsmak sattmedpumpa, kanel,muskot,inge fära&kryddnejli kor,gördennatill dinnyafavorit! Nyhet!Syrupmed smakav pepparkakor Sockerfri karamell Nyhet!Karamell, utankalorier. French vanilla Smakriksomfram manarliknelseav förfinad,krämig, fräschsmakavan tingenvaniljglass ellervaniljkräm. Almond Roca Mandel,choklad& fullavbuttercrunch smak. TOR T Creme De Cacao Hasselnöt Irish cream Ensyrupmedenrik,robust Ärljuvochsmakrik.En Enperfektblandning chokladsmak. kulinariskfavorit. mellanrobustkaffe smak&len,krämigva niljsmak. Tiramisu Fångardenriktiga smakenavdenitali enskadesserten. Pumpkin Spice TOR T Ginger Dennasyrupärspeci elltframtagendär manvillgeförfrisk ningarellerkomple menttillchailatte. TOR T Chocolate Milano Ensyrupmedintensiv mörkchokladsmak ochkakaosmak,med fylligaromochdjup mörknyans Gingerbread 7

5 Reklammaterial För din kaffeservering Vikantillverkadinamenyskyltarochreklamskyltariolikaformat. Sakersomärtrevligaochpraktiskaattha närduanvänderdinespressomaskinoch somgerdenriktiga,italienskakänslan: Latteglas Cappuccino&Espressomuggar Skumningsbringare&termometer Termos Lattebestickmm Rörpinnar Takeaway Muggar,glas,lock,ser vettermm Kaffestampar&Sumplådor Gioiapromotionartiklar:Förkläde, brickor,kopparmm.senedanbild. 8 9

6 E.S.E. Kaffepods E.S.E. Kaffepods E.S.Esystemetäridealisktfördigsomvillha engarantiförjämnkvalitetpåkaffet.enkaffe podinnehåller7gr/14grmaletkaffeavrätt malningsgrad.kaffetärstampatochklart,för packatienlufttätförpackning.dutarbara framdetantalpodsdubehöverförtillfället.på såsätthardufräschtkaffevarjegång.dubehö verinteoroadigförattkaffetärförlösteller förhårtpressat.detblirperfektvarjegång. Kuddarnaskonstruktionmedförocksåattren göringavmaskin,arbetsytor,filteretcblir mycketlättareochsnabbare. Ivårtsortimentharvibådeespressomaskiner förpodsochmaskinerförmaletkaffe,samt någramaskinermeddenunikaegenskapenatt deklararbådadelar. Caffé Gioia, italienskt lösa förpackade pods Kartong/Box med 150st, 50st eller 20st GI 514 -BIO & FAIRTRADE, 50st GI 554 -BIO & FAIRTRADE, 20st GI 574 -BIO & FAIRTRADE, 50st GI 518 -BIO & FAIRTRADE, 25st GI 314A Svart 14gr, 100st Söt,godocharomatisk blandning,naturligtljus ochmedlågkoffeinnivå. Fullständigtodlademed biologiskprocessutanfy tokemiskagödsel 50% Arabica Ärenblandningav Arabica&Robusta,ett kaffefördensomäls karsmaken&styrkani etttypisktitalienskt barkaffe. Fullständigtodlademed biologiskprocessutan fytokemiskagödsel Grönt kaffe Råkaffe,tillverkadeavhög kvalitativaarabicakaffebö norfrånperu.kaffebönorna ärinterostade.denkraftfulla antioxidantsområkaffetin nehåller,kanökaupptaget avsockersamtsnabbapådin ämnesomsättningochdär medpåskyndafettförbrän ningen.detgrönakaffetkan drickassomte. Medenkryddig& fylligsmak,särskilt omtycktavsvenska kaffekännare. Podsom14grkaffe,för 2kopparkaffe.Podsma skinenskallvaraanpas sadför14grkuddar. Fungerarmedendel2 koppsfilteritradition ellamaskiner. GI 806 Svart, 150st GI Svart, 20st GI 352 Decaff, 20st GI 311 -Grön Classic, 150st GI 313 -Grön Classic, 20st Medenkryddig&fyllig smak,särskiltomtycktav svenskakaffekännare 10 Koffeinfriapods.Rik& mjukespressomed mindreän0,10% koffein,menändåmed entypiskkaffesmak. Smakrikapods.Ärenbland ningavarabica&robusta, fördensomälskarsmaken& styrkanietttypisktitalienskt barkaffe. 11

7 E.S.E. Kaffepods E.S.E. Kaffepods Cafes Richard, franskt lösa förpackade E.S.E pods Kartong/Box med 100st eller 25st Övriga kaffesorter, lösa förpackade E.S.E pods Kartong/Box med 150st, 100st eller 20st JB M1190 Mauro De Luxe CAR 11 -Florio, 25st CAR Florio, 100st Kraftfullt&krämigt. Perfektbalansmellan styrka&mjukhet. CAR 10 -Perle Noire, 25st CAR Perle Noire, 100st CafesRichardtopp blandning Rikt&har moniskt.enblandning avbästaarabicabönor, medrund&balanserad. CAR 05 -Colombia, 25st Milt,litesött,mycket mjukt&aromatiskt. Enklassiker. CAR 08 -Jamaican, 25st Riktismaken,meden fantastiskarom.fylligt& medlagomsyrlighet,en perfektbalans.avmånga ansettsomvärldensbästa kaffe. Mild,aromatiskt smakmedenantydan avchoklad&kryd dighet. CAR 02 -Papua New Guinea, 25st CAR 04 -Sumatra, 25st CAR 12 Decaff, 25st Livligt,elegant,runt &behagligt,meden långeftersmak. Fruktigt,balanserat& aromatiskt,medenrik, balanseradsmak. Enmångsidigbland ning,medenren& finkaffesmakutan syra. Lätt&aromatisk.Ettnjut ningsfulltsättattdricka kaffeutankoffein. FAIRTRADE CAR 07 Guatemala, 25st BIO & FAIRTRADE CAR 18 Bolivia Bio, 25st CAR 03 Ethiopan, 25st CAR 14 Moka, 25st Fin&mogensmak. Fylligt&någotsyr ligt,medenantydan avchoklad. 12 Ettkaffemedfin,ädel smak,subtiltfruktigt ochmedenantydanav rostatbröd. Vilt&aromatiskt, medenkraftigbou quet Enkrämigblandning avintensivsmakoch perfektarom.den innehållerdenfinaste kaffefrånbrasilien ochcentralamerika. MOK Strong Enmycketstark blandningochin tensivsmak.dess aromärutmärkt, medenintensivoch ihållandeefter smak. IZ 0820 Svart/Guld IZ Svart/Guld IZ 0821-Grandespresso IZ Grandespresso CAR 01 -Costa Rica, 25st MOK Classic Aromatisktkaffeför denkrävandekaffe älskaren. 50% Arabica Ettkrämigtkaffe medenmjuksöt aktigsmak. ArabicafrånEtiopienmed nötsmak.ettkaffemeden antydanavkryddor,ut söktnötaromochenfin fylligbalans. 13

8 FAP Kaffekapslar FAP Kaffekapslar Cafes Richard, franskt lösa förpackade kapslar Kartong med 40st CAR CAP Espresso Intense, 40st Kaffekapslarärettnyttsystemförattförenklaespressohanteringen.Vårakapselmaskiner tillhörmarknadensbästaochlevererarettperfektkaffe,koppefterkopp.ivårtsortimenthar vikapslarsompassartillcaffitalymaskinerna,modellenpointfrånlavazza,makifrån Brasiliaochdenyakapselmaskinerna,EspressoCappuccinoochTouchCap.Enkapselinne håller7grmaletkaffeavrättmalningsgradförkapselmaskiner.kaffetärstampatochklart, förpackatienkapsel.dutarbaraframdetantalkapslardubehöverförtillfället.påsåsätt hardufräschtkaffevarjegång.kapslarnaskonstruktionmedförocksåattrengöringavma skin,arbetsytor,filteretcblirmycketlättareochsnabbare. Caffé Gioia, italienskt lösa förpackade kapslar Kartong med 100st GI 515 -BIO & FAIRTRADE, 40st Söt,godocharomatisk blandning,naturligtljus ochmedlågkoffeinnivå. Fullständigtodlademed biologiskprocessutanfy tokemiskagödsel.kapslari biologisknedbrytbarplast. 14 GI CAPAR Svart, 100st Medenkryddig& fylligsmak,särskilt omtycktavsvenska kaffekännare GI CAPCL -Grön Classic, 100st Smakrikapods.Ären blandningavarabica& Robusta,fördensomäls karsmaken&styrkaniett typisktitaliensktbar kaffe. Koffeinfritt Rik& mjukespressomed mindreän0,10% koffein,menändå medentypiskkaffe smak. CAR CAP Espresso Long, 40st Riksmakmedgodba lans,aningensyrlig. Kaffegerenfinrundhet &enlångeftersmak CAR CAP Decaff, 40st Kraftfullsmak,intensiv doftochharenkrämig, finkonsistens Riksmakmedgodba lans,aningensyrlig. Kaffegerenfinrundhet &enlångeftersmak CAR CAP Breakfast, 40st CAR CAP Earl Grey, 40st CAR CAP Grön Mint, 40st BIO & FAIRTRADE CAR CAP Espresso, 40st GI CAPDE Decaff, 100st CAR CAP Espresso DOUX, 40st Lätt&aromatisk.Ett njutningsfulltsättatt drickakaffeutankoffein, sompassarallatidpunk terpådagen Rikt,fylligtocharoma tisktkaffemedenliten syrlighet.fruktigt,ljust, medelfylligtochmed mångakryddiganyan ser 100% Te Denfinakombination avtrekarakteristiska teer:ceylon,assamoch Darjeeling.Vilketger kaffetenkraftfullsmak arom&rundhet. 100% Te Elegant,aromatiskt& doftandeteblandningav blommigt,svartberga mottte. 100% Te Enmintteblandingpå traditionelltrecept.teet ärsmakrikt&aromatisk, &medenuppfriskande eftersmak. Mjölkpulver Medmjölktoppingkan dusnabbtochenkeltfå varmmjölkfråndin kapselmaskin. CAR CAP Mjölktopping 15

9 16


ENZO GER DIG EN DOS KONCENTRERAD NJUTNING MED MJUK CREMA ESPRESSO SORTERNA ENZO GER DIG EN DOS KONCENTRERAD NJUTNING MED MJUK CREMA En sensuell upplevelse som väcker din mörka sida. Den sida som får liv om natten men som också kan väckas till liv på dagen när

Läs mer

Big Tom tomatjuice EF GRUPPEN AB. Textilgatan 43 120 30 STOCKHOLM VX + 46 8 663 30 09

Big Tom tomatjuice EF GRUPPEN AB. Textilgatan 43 120 30 STOCKHOLM VX + 46 8 663 30 09 Big Tom tomatjuice En Bloody Mary mix, tillsätt endast spriten, eller inte, och garnera med Selleri. Smakar likadant varje gång, oavsett vem som står i baren. Snabbt och kostnadseffektivt. Artikel nr Benämning

Läs mer


PARTNER PRISLISTA - NORGE Valid from 2015-08-15 PARTNER PRISLISTA - NORGE Partner Start kit Sales Rep Digitalt material med personlig Online Office 1 st 0,00 Training kit 1 Training Kit 1 st 500,00 0 Mini kit 1 Training Kit 1 st

Läs mer Art. namn Produkttyp Förpackning Sorteras som Kaffe Lipton te Art. namn Produkttyp Förpackning Sorteras som Kaffe Lipton te Art. namn Produkttyp Förpackning Sorteras som Kaffe 800 Royal Pure Colombia Frystorkat kaffe plast med aluminium, wellpapp plast, kartong 830 Royal Gold Frystorkat kaffe plast med aluminium, wellpapp

Läs mer


BRISTOT DET ITALIENSKA KAFFET SOM STICKER UT BRISTOT DET ITALIENSKA KAFFET SOM STICKER UT Bristot är ett italienskt rosteri som startades 1919 av Domenico Bristot i den norditalienska orten Belluno. Filosofin har varit densamma de senaste 90 åren;

Läs mer

Bild Artikelnr Förklaring Antal Pris/st/kg. 33-904lös Franska Fyllda Gröna Äpplen 3kg

Bild Artikelnr Förklaring Antal Pris/st/kg. 33-904lös Franska Fyllda Gröna Äpplen 3kg 33-904lös Franska Fyllda Gröna Äpplen 44-5158lös 44-5158p 44-5158plexi 44-5145lös 44-5145p 44-5145plexi Engelsk Fudge Pepparkaka (styck inslagna i klar film) Engelsk Fudge Apelsin/Tranbär (styck inslagna

Läs mer

Bild Artikelnr Förklaring Antal Pris/st/kg. Engelsk Fudge Apelsin/Tranbär (styck inslagna i klar film) TST Plexikartong 150 g

Bild Artikelnr Förklaring Antal Pris/st/kg. Engelsk Fudge Apelsin/Tranbär (styck inslagna i klar film) TST Plexikartong 150 g 44-5145lös 44-5145plexi Engelsk Fudge Apelsin/Tranbär (styck inslagna i klar film) 44-5090lös 44-5090plexi Engelsk Fudge Choklad (styck inslagna i klar film) 44-5143lös 44-5143plexi Engelsk Fudge Clotted

Läs mer

Känn ingen oro, jultomten har klappar till dig i år också...

Känn ingen oro, jultomten har klappar till dig i år också... God Jul 2010 Känn ingen oro, jultomten har klappar till dig i år också... Julen är vår allas favorit och bäst firas den med en härlig blandning av det allra senaste samt traditionella klassiker, som alla

Läs mer

ProduktBLAD. En fyllig espresso med en fruktig eftersmak. Perfekt för dig som rundar av med mjölk. Våra kapslar passar till Caffitaly System.

ProduktBLAD. En fyllig espresso med en fruktig eftersmak. Perfekt för dig som rundar av med mjölk. Våra kapslar passar till Caffitaly System. Blue Storm Kaffe espresso En fyllig espresso med en fruktig eftersmak. Perfekt för dig som rundar av med mjölk. Våra passar till Caffitaly System. ART NR 10578 7310050005782 Kfp 7310050105789 Dfp Pink

Läs mer

Choklad. Ekologisk & Fairtrade

Choklad. Ekologisk & Fairtrade Hösten 2015 Choklad 5 gr kvadrater. Art. 3590952 Vi trycker i CMYK eller PMS från 5.000 st. Vi kan även prägla i 1-färg, metallic (3590951). Våra smaker är: Mjölkchoklad: 30,5% kakao. Mörk choklad: 52%

Läs mer


PARTNER PRISLISTA - FINLAND (SVENSKA) Valid from 2015-08-15 PARTNER PRISLISTA - FINLAND (SVENSKA) Partner Start Kits Sales Rep Digitalt material med personlig Online Office 1 st 0,00 Training kit 1 Training Kit 1 st 55,00 0 Mini kit 1 Trainig

Läs mer


SORTIMENTLISTA 2013-03-01 SORTIMENTLISTA 2013-03-01 Sortimentlista 2013-03- 01 KAFFE ARVID NORDQVIST HELHETSLEVERANTÖR Med Fikalösningar som leverantör så öppnar sig en värld full av möjligheter. Vad ni än behöver för fikapausen,

Läs mer

Sortimentslista Fairtrade

Sortimentslista Fairtrade Kaffe, hela bönor Sortimentslista Sidan 5-09-0 04029 Dark Mountain, Mörkrost Bönor kg 04034 Midnight Grown, X-tra mörkrost Bönor kg 0404 Sincero Espresso Bönor kg 04049 Ethic Harvest, Mörkrost Bönor kg

Läs mer

Bild Artikelnr Förklaring Antal Pris/st SIDNEY S KITCHEN

Bild Artikelnr Förklaring Antal Pris/st SIDNEY S KITCHEN SIDNEY S 1 KRYDDLAGRET AB, Kraftgatan 15, SE-242 35 Hörby, Tfn:+4-(0)415-153 00, Fax:+4-(0)415-153 02, E-post: 34-01 Sidney s Kitchen Olivolja Basilika 200ml Olivolja med underbar smak

Läs mer


1. 2. 3. 4. VÅRA ESPRESSON ESPRESSO RECEPT FÖR EN PERFEKT ESPRESSO LÄR DIG ALLT OM KAFFE PÅ PAULIG INSTITUTE ESPRESSO-KONCEPT VÅRA ESPRESSON På Paulig har vi alltid älskat att lära känna olika smaker och kulturer. Inspirerade av olika kaffestunder, ger våra espresson trevliga och mjuka smaker med minnesvärda

Läs mer

Det handlar inte om fika.

Det handlar inte om fika. Det handlar inte om fika. Det handlar om gott kaffe. Det finns en massa tankar om vad som är gott kaffe. Vi har i alla fall bestämt oss för vad vi tycker är gott. Kaffe från Italien. I alla dess former.

Läs mer

miofino Coffee Bar En kaffestation och mötesplats på ditt kontor

miofino Coffee Bar En kaffestation och mötesplats på ditt kontor miofino Coffee Bar En kaffestation och mötesplats på ditt kontor MIOFINO EN NY FIKAUPPLEVELSE PÅ JOBBET HJÄRTAT OCH SJÄLEN AV KAFFE miofino Coffee Bar är helt ny fikaupplevelse på jobbet. Här kombinerar

Läs mer

Avtalade produkter. Dryckesautomater SLL718. v MBK = Minsta beställningsbara kvantitet av en artikel Fp nivå: CU=ST TU=Avdfp DU=Trpfp

Avtalade produkter. Dryckesautomater SLL718. v MBK = Minsta beställningsbara kvantitet av en artikel Fp nivå: CU=ST TU=Avdfp DU=Trpfp Gäller datum: 215-5-1 Dryckesautomater 214 - SLL718 Avtalsperiod: 214-4-1-217-3-31 Position: 1 Kaffe Exklusive hela bönor, eko rättvisemärkt mörkrost 1Kgx6 Kaffe Harmoni hela bönor, eko rättvisemärkt mellanrost

Läs mer

PRODUKTBLAD. SORTIMENT g. Kokkaffe Ljusrost 500g ART NR Bricka 12 x 500g Kfp Dfp.

PRODUKTBLAD. SORTIMENT g. Kokkaffe Ljusrost 500g ART NR Bricka 12 x 500g Kfp Dfp. Kokkaffe Ljusrost 500g Vårt ljusrostade kokkaffe framhäver en fin och mjuk arom med lång, rund eftersmak. Smaken domineras av en lätt nötaktig sötma med inslag av behaglig syrlighet i efter smaken. arabicakaffe

Läs mer

CaviarBolaget COLONIAL

CaviarBolaget COLONIAL CaviarBolaget COLONIAL Svarta Teer Adam - Eve (BF01) Pris: 50 kr/100g Smak: Blommig och mjuk, med ton av fikonmarmelad. Innehåll: Svart te (51%), fikon (15%) (fikon, rismjöl), karamell (kondenserad skummjölk,

Läs mer

Produktkatalog 2015 SOMMAR

Produktkatalog 2015 SOMMAR Produktkatalog 2015 SOMMAR Varm Choklad 89:- All varm choklad blandas med mjölk, med undantag för Skinny Luxury som blandas med vatten (sid 2) 01 02 03 04 Mint 70% Cocoa Chilli Luxury Caramel 06 07 08

Läs mer

Svarta Teer. Adam - Eve (BF01) Blood Orange (BF02) Goldberry (BF03) Apple Elder (BF04) Sicilian Lemon (BF05) Sweetheart (BF06)

Svarta Teer. Adam - Eve (BF01) Blood Orange (BF02) Goldberry (BF03) Apple Elder (BF04) Sicilian Lemon (BF05) Sweetheart (BF06) Caviarbolaget of Sweden AB Produktkatalog 2015-2016 Svarta Teer Adam - Eve (BF01) Smak: Blommig och mjuk, med ton av fikonmarmelad Innehåll: svart te (51%), fikon (15%) (fikon, rismjöl),

Läs mer

Kakor. Switsbake/ Hägernäs BRÖD. Polarbröd. Allt polar- och tunnbröd är nu parve OBS deras färdiga smörgåsar är inte kosher.

Kakor. Switsbake/ Hägernäs BRÖD. Polarbröd. Allt polar- och tunnbröd är nu parve OBS deras färdiga smörgåsar är inte kosher. BRÖD olarbröd Allt polar- och tunnbröd är nu parve OBS deras färdiga smörgåsar är inte kosher inte kosher Fazer/ Skogaholm Allt Fazer/ Skogaholms mat, tunn- och kaffebröd är kosher parve OBS Skogaholms

Läs mer

PRISLISTA GÄLLER FRÅN MAJ 2014. ORIGINAL Original Line... 3 Tillbehör... 4. SERVING CONCEPT Serving Concept... 5 Tillbehör... 6

PRISLISTA GÄLLER FRÅN MAJ 2014. ORIGINAL Original Line... 3 Tillbehör... 4. SERVING CONCEPT Serving Concept... 5 Tillbehör... 6 PRISLISTA MAJ 2014 ORIGINAL Original Line... 3 Tillbehör... 4 SERVING CONCEPT Serving Concept... 5 Tillbehör... 6 PREZZO CONCEPT Prezzo... 7 Tillbehör... 7 CQUBE FILTERBREW CQube SF... 8 Tillbehör... 8

Läs mer

Enkelt, smakfullt och grönt

Enkelt, smakfullt och grönt Enkelt, smakfullt och grönt OneCup nytt, unikt kapselsystem med premiumkvalitet Upptäck Arvid Nordquist OneCup ett unikt helhetskoncept med kaffemaskin och. OneCup ger dig smakfull njutning enkelt och

Läs mer

Sort Sor iment slist iment slist

Sort Sor iment slist iment slist Sortimentslista Med erfarenhet och omtanke sedan 80-talet och med över 1000 nöjda kunder tar vi hand om Din fikarast med dokumenterad service och hygien. Våra ledord är kvalitet, service och hygien så

Läs mer

Rek.ut pris-under HET NY HET NY HET NY HET. award. winning

Rek.ut pris-under HET NY HET NY HET NY HET. award. winning l u j d o g 2013 Rek.ut pris-under Kuliga Julkulor av plåt med Lasse Åberg motiv -fyllda med 225gram härlig Italiensk choklad Årets motiv heter Flygande Hund & Enigma III 60840!! JULKULOR 225g x

Läs mer

Bild Artikelnr Förklaring Antal Pris/st/kg. Engelsk Fudge Apelsin/Tranbär (styck inslagna i klar film)

Bild Artikelnr Förklaring Antal Pris/st/kg. Engelsk Fudge Apelsin/Tranbär (styck inslagna i klar film) 44-5145lös Engelsk Fudge Apelsin/Tranbär (styck inslagna i klar film) 44-5090lös Engelsk Fudge Choklad (styck inslagna i klar film) 44-5143lös 44-5143plexi Engelsk Fudge Clotted Cream (styck inslagna i

Läs mer

Innehåll. Kaffe mer än bara kaffe

Innehåll. Kaffe mer än bara kaffe Innehåll 3 Kaffe mer än bara kaffe 4 Skillnader på kaffe 6 Rosta fram smakerna 7 Smak & arom 8 Fairtrade för smakens skull 11 Stor eller liten espresso 12 Fantastiska smaker 18 En liten teskola 20 Vårt

Läs mer


ZINZINO COFFEE PRODUKTKATALOG SVENSKA ZINZINO COFFEE PRODUKTKATALOG SVENSKA INNEHÅLL 3 Kaffe mer än bara kaffe 4 Skillnader på kaffe 6 Rosta fram smakerna 7 Smak & arom 8 Fairtrade för smakens skull 11 Stor eller liten espresso 13 Espressomaskiner

Läs mer


LISTA A LISTA D LISTA C LISTA D LISTA B LISTA C 1 Jag själv 2 Partner 3 Annan vuxen i hushållet 4 Barn under 18 år 5 Barn över 18 år 6 Gäst 1 Snabb LISTA A LISTA B 2 Kaffe (inte snabb eller gjort med kapsel) 3 Kaffe med kapsel 4 Varm choklad/choklad

Läs mer

GOD JUL 2014 - the best chocolate, e - the best chocolate v, e er v...

GOD JUL 2014 - the best chocolate, e - the best chocolate v, e er v... GOD JUL 2014 - the best chocolate, ever... i Tuff Läderdesign med sidenband & rosett! Klappat & Klart från Belgien Sorterade Praliner av Äkta choklad i Fin Belgisk Kvalité! 96006 Leather Box Black

Läs mer

Vill du stärka ditt varumärke och samtidigt skapa goda relationer

Vill du stärka ditt varumärke och samtidigt skapa goda relationer Reklamkatalog 2010 Innehåll & Villkor Vill du stärka ditt varumärke och samtidigt skapa goda relationer Karamello är ett företag som har varit verksam inom konfektyrmarknaden sedan 1994. Vi arbetar bara

Läs mer

Choklad. Ekologisk & Fairtrade

Choklad. Ekologisk & Fairtrade Våren 2015 Choklad 5 gr kvadrater. Art. 3590952 Vi trycker i CMYK eller PMS från 5.000 st. Vi kan även prägla i 1-färg, metallic (3590951). Våra smaker är: Mjölkchoklad: 30,5% kakao. Mörk choklad: 52%

Läs mer

100% Arabicabönor mellanrost Välbalanserad smak, harmonisk rostning med svaga nyanser av karamelliserad kola.

100% Arabicabönor mellanrost Välbalanserad smak, harmonisk rostning med svaga nyanser av karamelliserad kola. Brygg&Espresso Martin Olsson Blå 100% Arabicabönor mellanrost Välbalanserad smak, harmonisk rostning med svaga nyanser av karamelliserad kola. 101576 40x100 g 391425 36x110 g 391391 35x115 g 101584

Läs mer

Ett personligt företag med ett spännande sortiment

Ett personligt företag med ett spännande sortiment Ett personligt företag med ett spännande sortiment 1 VÄLKOMMEN TILL DAFONTE DaFonte distribuerar premiumprodukter till hotell-, restaurang- och cafébranschen. Ett personligt företag med ett spännande sortiment.

Läs mer

Påskte. Påskkaffe. Påskte

Påskte. Påskkaffe. Påskte SMAKGLÄDJE 2010 Julen försvann, kylan & snön stannade kvar. Men nu går vi mot ljusare tider, och vad passar väl bättre än ett välfyllt utskick med extra mycket innehåll. Vi har fyllt det med nya kaffe

Läs mer

Sortimentslista Gäller from 2009-03-01

Sortimentslista Gäller from 2009-03-01 INSTANTKAFFE FÖR AUTOMAT eskrivning Innehåll/kart. eställningsvara 20101 Nescafé Fines Tasses 12 x 250 g. 20102 Nescafé Espresso Pur Arabica 12 x 250 g. INSTANTKAFFE FÖR AUTOMAT EKOLOGISKT & FAIRTRADE

Läs mer



Läs mer

Sortimentslista. Kaffe, hela bönor. Malet. Frystorkat kaffe. Sidan 1 2015-01-29. Rainforest Alliance. Ekologisk. Fairtrade. Krav

Sortimentslista. Kaffe, hela bönor. Malet. Frystorkat kaffe. Sidan 1 2015-01-29. Rainforest Alliance. Ekologisk. Fairtrade. Krav Sidan 1 Sortimentslista Kaffe, hela bönor 04029 Dark Mountain, Mörkrost Bönor Arvid Nordquist 1 kg 6 04034 Midnight Grown, X-tra mörkrost Bönor Arvid Nordquist 1 kg 6 04048 Giusto Espresso Bönor Arvid

Läs mer

Earl Grey Organic (BF01) PRIS: 60 KR/100G Smak: Frisk bergamot. Innehåll: Svart te*, naturliga bergamotaromer och andra naturliga aromer.

Earl Grey Organic (BF01) PRIS: 60 KR/100G Smak: Frisk bergamot. Innehåll: Svart te*, naturliga bergamotaromer och andra naturliga aromer. CaviarBolaget Svarta Teer Earl Grey Organic (BF01) PRIS: 60 KR/100G Smak: Frisk bergamot. Innehåll: Svart te*, naturliga bergamotaromer och andra naturliga aromer. * Ekologiskt odlat. Blood Orange (BF02)

Läs mer

Choklad. Förpackningar till 5gr

Choklad. Förpackningar till 5gr Hösten 2013 Choklad 5 gr Kvadrater. Art. 3590952 Vi trycker i CMYK eller PMS från 5.000 st. Vi kan även prägla i 1-färg, metallic (3590951). Mjölkchoklad: 30,5% kakao, 30,5% kakao med kaffe, Mörk choklad:

Läs mer

NYHET ännu fler tryffelkulor med karamell & nougat.. mjölk, vit och mörk choklad med tryffelfyllningar 85275 Splendid Truffl es 370gr x 12

NYHET ännu fler tryffelkulor med karamell & nougat.. mjölk, vit och mörk choklad med tryffelfyllningar 85275 Splendid Truffl es 370gr x 12 Tryffel Kulor i Kul Tub - Världsberömda & Prisbelönta! Mjölkchokladkulor, med fantastiska fyllningar med äkta Baileys Original Irish Cream likör & Famous Grouse Original 85266 Baileys Original Truffl

Läs mer

ERBJUDANDEN. Månadens EKOLOGI KÖTT & CHARK. Fortsätter 31 MARS - 1 MAJ 2016

ERBJUDANDEN. Månadens EKOLOGI KÖTT & CHARK. Fortsätter 31 MARS - 1 MAJ 2016 Månadens ERBJUDANDEN 31 MARS - 1 MAJ 2016 EKOLOGI 14031960 Blå kornblomst 60+, ost ca. 3 kg 134,75/kg 34660751 Earl Grey te, Fair Trade 20 ps. 14,75/fö. 15266538 Fruktstång med jordgubb 24 x 20 g 78,50/fö.

Läs mer

Choklad. Förpackningar till 5gr

Choklad. Förpackningar till 5gr Våren 2013 Choklad 5 gr Kvadrater. Art. 3590952 Vi trycker i CMYK eller PMS från 5.000 st. Vi kan även prägla i 1-färg, metallic (3590951). Mjölkchoklad: 30,5% kakao, 30,5% kakao med kaffe, Mörk choklad:

Läs mer

p l a y b o o k Nestlé Professional Nordic Version Nestlé Professional

p l a y b o o k Nestlé Professional Nordic Version Nestlé Professional e By p l a y b o o k Nestlé Professional Nordic Version 2.1 - Nestlé Professional - 2017 Välkommen till Nestlé Professionals eplaybook eplaybooken är verktyget för dig som arbetar med företagets digitala

Läs mer


PRISLISTA GODISKATALOGEN höst & vinter 2012 PRISLISTA GODISKATALOGEN höst & vinter 2012 Quatre Chocolate SEK/st 2400 st 4800 st 9600 st 2,3:- 1,8:- 1,6:- Startkostnad Quatre: 692:-/tryck Repeatkostnad: 346:-/tryck Leveranstid: 20 arbetsdagar från

Läs mer

gott kaffe sedan Martin Olsson kaffe - ett riktigt gott restaurangkaffe

gott kaffe sedan Martin Olsson kaffe - ett riktigt gott restaurangkaffe gott kaffe sedan 1897 Martin Olsson kaffe - ett riktigt gott restaurangkaffe Martin Olsson kaffe ett unikt kaffe av högsta kvalitet Vi har 100-årig erfarenhet av kaffe. Det har gett oss kunskap och tradition

Läs mer


GODISKATALOGEN JULEN 2012. GODISKATALOGEN JULEN 2012 NU ÄR DET JUL IGEN NU ÄR DET JUL IGEN Dags att ta fram lådan med julsakerna som legat i skymundan. Man tar sig tid att utforska lådan. Ljusslingor, pynt till granen,

Läs mer


Vårt finaste kaffe HANTVERKSROSTAT SPECIALKAFFE ETT UNIKT SAMARBETE MED LILLA KAFFEROSTERIET. Nyhet! Sortimentslista #1 2015 Vårt finaste kaffe Sortimentslista #1 2015 Nyhet! HANTVERKSROSTAT SPECIALKAFFE ETT UNIKT SAMARBETE MED LILLA KAFFEROSTERIET KUNSKAP & TRADITION Vi har 100 års erfarenhet av allt från böna, rostning och

Läs mer

En god kopp kaffe och mycket mer. i fokus. Cafitesse. Kunden. Vi gör vårt bästa för dig varje dag. Goda smaker. Goda lösningar.

En god kopp kaffe och mycket mer. i fokus. Cafitesse. Kunden. Vi gör vårt bästa för dig varje dag. Goda smaker. Goda lösningar. JDE Professional är helhetsleverantören för dig, ditt företag, dina anställda och dina gäster till alla som uppskattar en god kopp kaffe. Cafitesse är det enda kaffekonceptet som på en och samma gång ger

Läs mer

501212 Ø 68 mm 501211 88 x 40 mm 501214 72 x 65 mm 501215 98 x 40 mm 501216 & 501217 75 x 70 mm Priser Mintkort enligt ovan

501212 Ø 68 mm 501211 88 x 40 mm 501214 72 x 65 mm 501215 98 x 40 mm 501216 & 501217 75 x 70 mm Priser Mintkort enligt ovan 2014 Sweet Promotion har ett sortiment av prisvärda kvalitetsprodukter inom produktmedia området godis och sötsaker. Våra produkter tillverkas av erfarna Europeiska leverantörer. De arbetar målmedvetet

Läs mer

KAFFE SORTERNA ÄKTA JAVA ETIOPISK SIDAMO. (/sv- SE/Mountain- Coffee#myCarousel) (/sv- SE/Mountain- Coffee#myCarousel)

KAFFE SORTERNA ÄKTA JAVA ETIOPISK SIDAMO. (/sv- SE/Mountain- Coffee#myCarousel) (/sv- SE/Mountain- Coffee#myCarousel) (/da-dk/mountain-coffee) (/sv-se/mountain-coffee) (/sv- SE/Mountain- Coffee#myCarousel) (/sv- SE/Mountain- Coffee#myCarousel) ETIOPISK SIDAMO - imponerande komplex, kryddig och fyllig smak. Läs mer om

Läs mer

Mindre Rätter. Större Rätter - DAGMENY -

Mindre Rätter. Större Rätter - DAGMENY - - DAGMENY - Mindre Rätter HEMMAGJORDA ROTFRUKTSCHIPS med Currysalt... 55 POTATISKROKETTER med ekrökt Cheddar & Habanero... 75 MOROTSSOPPA med Ingefära & Chili... 115 HUMMERSOPPA med Palsternackschips...

Läs mer

Espresso Fair Trade Organic

Espresso Fair Trade Organic F T O Espresso Espresso Fair Trade Organic 5 Estate Organic Det här är något så sällsynt som ett espressokaffe som är både gott och etiskt. Vi har blandat arabicabönor från dubbelcertifierade kooperativ

Läs mer

Nästa. Fresh Brew. Animo introducerar den nya Optifresh (BEAN)

Nästa. Fresh Brew. Animo introducerar den nya Optifresh (BEAN) Nästa generation Fresh Brew Animo introducerar den nya Optifresh (BEAN) OptiFresh Next generation OptiFresh från Animo OptiFresh Bean NG OptiFresh Bean NG OptiFresh NG OptiFresh NG Fresh Brew har fått

Läs mer

GodJul. önskar. ÅSÖ AB 0120-844 60 Öppettider 08:00-16:30, webbutiken är öppen dygnet runt alla dagar.

GodJul. önskar. ÅSÖ AB 0120-844 60 Öppettider 08:00-16:30, webbutiken är öppen dygnet runt alla dagar. för kockar, konditorer & gourmetbutiker GodJul önskar för kockar, konditorer & gourmetbutiker ÅSÖ AB 0120-844 60 Öppettider 08:00-16:30, webbutiken är öppen dygnet runt alla dagar.

Läs mer

En smakresa. Följ med på en jorden runt-resa i kaffets värld. Limited Blend Hela bönor Kaffekunskap

En smakresa. Följ med på en jorden runt-resa i kaffets värld. Limited Blend Hela bönor Kaffekunskap En smakresa Följ med på en jorden runt-resa i kaffets värld Limited Blend Hela bönor Kaffekunskap Ett hantverk Som ansvariga för inköp och kvalitet på Z0ÉGAS har Douglas Jonhag och Minette Rosén båda ett

Läs mer

Vill du bjuda på något gott under eventet?

Vill du bjuda på något gott under eventet? Vill du bjuda på något gott under eventet? Det är detaljerna som gör det På vår Grafiska enhet flödar kreativiteten och inga uppdrag är för små och inga idéer för stora. Vi finns med från det att din monter

Läs mer



Läs mer

2008/2009. surpresso EQ.7. Helautomatiska kaffemaskiner. Framtiden flyttar in.

2008/2009. surpresso EQ.7. Helautomatiska kaffemaskiner. Framtiden flyttar in. 2008/2009 surpresso EQ.7 Helautomatiska kaffemaskiner Framtiden flyttar in. En ny stjärna är född. Nya Siemens EQ.7 lyfter din kaffestund till nya höjder. Fulländad arom och oöverträffat mjölkskum ger

Läs mer



Läs mer

Ingredienser. Gör så här (BananChoklad) Mixa bananen, citronjuicen och sockret. Blanda i Kesellan, Fresubin DRINK Choklad och chokladpulvret.

Ingredienser. Gör så här (BananChoklad) Mixa bananen, citronjuicen och sockret. Blanda i Kesellan, Fresubin DRINK Choklad och chokladpulvret. BananaDelight BananChoklad 100 ml Fresubin DRINK Choklad 1 mogen banan juice av ½ citron 50 g socker 200 g lätt Kesella (kvarg, 1 % fett) 4 tsk chokladdryck (pulver) 3 g gelatin (1,5 blad) Vaniljkvarg

Läs mer

Ingredienser TIPS: DRYCKER Amaretto Ischokladshake. 3 min

Ingredienser TIPS: DRYCKER Amaretto Ischokladshake. 3 min Amaretto Ischokladshake 200 ml Fresubin DRINK Choklad 2 skopor vaniljglass 4 cl Amaretto kakaopulver vispgrädde rostad mandel Fresubin 2kcal fibre DRINK choklad Fresubin protein energy DRINK choklad Fresubin

Läs mer

Ett personligt företag med ett spännande sortiment

Ett personligt företag med ett spännande sortiment Ett personligt företag med ett spännande sortiment VÄLKOMMEN TILL DAFONTE DaFonte distribuerar premiumprodukter till hotell-, restaurang- och cafébranschen. Ett personligt företag med ett spännande sortiment.

Läs mer

299: 179: 295: 1695: PER SET. Klappat och klart alla julklappar på ett ställe! Julsäck God helg. Julpåse Cellofan

299: 179: 295: 1695: PER SET. Klappat och klart alla julklappar på ett ställe! Julsäck God helg. Julpåse Cellofan Klappat och klart alla julklappar på ett ställe! 2 Julsäck God helg 1346 g. ART NR 95090097 Julpåse Cellofan 665 g. Med Christmas Pudding Fudge 200 g, Merry Christmas fudge 215 g samt Swirly Chocolate

Läs mer


ETT unikt KONCEPT FÖR PREMIUMKAFFE ETT unikt KONCEPT FÖR PREMIUMKAFFE EN HELT NY kaffevärld ÖPPNAR SIG Vi ställer allt högre krav på vårt kaffe. Där det en gång räckte med en svart slät kopp finns det idag oändliga möjligheter. Med olika

Läs mer


VARDAGAR till kl 11:00. KLANG LYX 149 kr. EARLY BIRD 69 kr. BAGUETTE KARRÉ 38 kr. BAGUETTE COMTÉ 38 kr. BAGUETTE AVOCADO 40 kr. BAGUETTE ÄGG 40 kr VARDAGAR till kl 11:00 KLANG LYX 149 kr Valfri kaffe, Baguette Karré, juice & Granola. EARLY BIRD 69 kr Valfri liten kaffe & Baguette Karré. BAGUETTE KARRÉ 38 kr Vedrökt karré, Comté (fransk alpost), romansallad,

Läs mer


JOHAN & NYSTRÖMS KAFFEREVOLUTION JOHAN & NYSTRÖMS KAFFEREVOLUTION KAFFEREVOLUTION SEDAN 2004 Vi är ett gäng kaffeälskande vänner som grundade Johan & Nyström med visionen om en bättre kaffevärld. Vår mission, då som nu, är att förmedla

Läs mer

FÖR ORDER! Telefon: +46 (0) 13 24 43 90 Mail:

FÖR ORDER! Telefon: +46 (0) 13 24 43 90 Mail: FÖR ORDER! Telefon: +46 (0) 13 24 43 90 Mail: GODIS, PEPPARKAKOR & CHOKLAD 2014 1 REKLAM DU INTE FÅR NOG AV Karamello startade 1994 och sedan dess har vi arbetat med det vi kan bäst,

Läs mer


PEPPARKAKOR PRisExEmPEl/st: 155:- Den goda julkatalogen 2011 PEPPARKAKOR Vår mest omtyckta produkt bakas jul efter jul enligt traditionellt svenskt recept. Välj mellan en burk med ett juligt tomtemotiv och dekal på locket eller en silverburk

Läs mer


NESTLÉ PROFESSIONAL PRODUKTKATALOG NESTLÉ PROFESSIONAL PRODUKTKATALOG Ett nytt sortiment för professionella. Ett nytt sortiment för professionella. Vi byter sortiment och vill nu introducera dig för ZOÉGAS Professional unika kaffeblandningar

Läs mer


JULBESTÄLLNINGSLISTA JULBESTÄLLNINGSLISTA Vi på Femtorp önskar dig en bra julförsäljning och en riktigt God Jul och Gott nytt år! Fyll i din beställning och skicka sedan in den till oss. Produktnamn Förp. Trp.förp.

Läs mer

LATHUND. Hål i hyllan efter Clipper? Här är en enkel lathund för hur du kan ersätta teerna!

LATHUND. Hål i hyllan efter Clipper? Här är en enkel lathund för hur du kan ersätta teerna! LATHUND Hål i hyllan efter Clipper? Här är en enkel lathund för hur du kan ersätta teerna! = = Du vet väl att vi inte längre har distributionen av Clipper i Sverige? Dagsmeja hade under 2014 123 stycken

Läs mer

VÅRA MENYER. För beställningar ring 031 13 82 10

VÅRA MENYER. För beställningar ring 031 13 82 10 VÅRA MENYER Sida Sallader 2 Smörgåsar och Landgångar 3 Smörgåstårtor 5 Bufféer 6 Tallrikar och Fat 8 Pajer 9 Smått o Gott 10 För aktuell information gå in på Sida 1 SALLADER, PASTA OCH GRYN

Läs mer

magazine Låglaktosprodukter ökade valmöjligheterna Berikande mjölk Enkel svalka #1 2009

magazine Låglaktosprodukter ökade valmöjligheterna Berikande mjölk Enkel svalka #1 2009 magazine #1 2009 Berikande mjölk Enkel svalka Låglaktosprodukter ökade valmöjligheterna Njutning för alla Laktosintolerans har blivit något av ett folkhälsoproblem hela fem procent av alla svenskar lider

Läs mer

Choklad. Ekologisk & Fairtrade

Choklad. Ekologisk & Fairtrade Hösten 2014 Choklad 5 gr kvadrater. Art. 3590952 Vi trycker i CMYK eller PMS från 5.000 st. Vi kan även prägla i 1-färg, metallic (3590951). Våra smaker är: Mjölkchoklad: 30,5% kakao. Mörk choklad: 52%

Läs mer

VÅRA MENYER. För beställningar ring 031 13 82 10

VÅRA MENYER. För beställningar ring 031 13 82 10 VÅRA MENYER Sida Sallader 2 Smörgåsar och Landgångar 3 Smörgåstårtor 5 Bufféer 6 Tallrikar och Fat 8 Pajer 9 Smått o Gott 10 Uppdaterad juni 2011 För aktuell information gå in på Sida 1

Läs mer


JULBESTÄLLNINGSLISTA JULBESTÄLLNINGSLISTA Vi på Femtorp önskar dig en bra julförsäljning och en riktigt God Jul och Gott nytt år! Fyll i din beställning och skicka sedan in den till oss. Produktnamn Förp. Trp.förp.

Läs mer

EN KOPP KAFFE En färd till kaffets värld.

EN KOPP KAFFE En färd till kaffets värld. EN KOPP KAFFE En färd till kaffets värld. 2 3 En kopp kaffe. Till dig. I Norden dricks det mest kaffe i hela världen. Vårt kaffe görs av världens bästa kaffesorter och kaffet har en särskild plats i det

Läs mer

Läckerheter i snygga förpackningar

Läckerheter i snygga förpackningar Läckerheter i snygga förpackningar Godsaker PRIS 299:- / ART NR SILVER 1418 Sötsaker som fyller munnen med ljuvliga smaker. Spröda mandelskorpor, fikonmarmelad perfekt till en bit ost eller på en skorpa.

Läs mer


GODISKATALOGEN JULEN 2011 GODISKATALOGEN JULEN 2011 EN GOD JUL En god jul Det ska pysslas, stökas, handlas och såklart bakas när julen står för dörren. Kakor, bröd och godis i massor! Härlig är stunden när allt är på plats och

Läs mer

Allers stora glasstest!

Allers stora glasstest! REPORTAGE MAT & BAK Allers stora glasstest! STICKA & HANDARBETE Riktiga höjdare och några bottennapp. Allers testar årets glassnyheter! VINN FYNDA 24 MARS 2015 06.15 Bild: Shutterstock Vi kan inte garantera

Läs mer

Om du i år varit snäll så kommer tomten med en karamell. Julgodis

Om du i år varit snäll så kommer tomten med en karamell. Julgodis Om du i år varit snäll så kommer tomten med en karamell Julgodis 2010 Chokladaskar Golden Chokladask 800 g Förstklassig belgisk chokladask i en lyxig guldfärgad kartong. Inslagen i ett band med rosett.

Läs mer


PRISLISTA AUGUSTI 2012 PRISLISTA AUGUSTI 2012 PRISLISTA GÄLLER FRÅN AUGUSTI 2012 COFFEE QUEEN & EXPOBAR ORIGINAL Original Line... 3 Kaffekvarn... 3 Hetvatten... 3 Tillbehör... 4 SERVING CONCEPT Tower... 5 Tea Cater... 5 Mega

Läs mer

Avtalade produkter. Kaffeautomater 2010 - SLL715. v 3.7.0 MBK = Minsta beställningsbara kvantitet av en artikel Fp nivå: CU=ST TU=Avdfp DU=Trpfp

Avtalade produkter. Kaffeautomater 2010 - SLL715. v 3.7.0 MBK = Minsta beställningsbara kvantitet av en artikel Fp nivå: CU=ST TU=Avdfp DU=Trpfp Position: 1 Kaffe Hela bönor mellanrost Sackeus KRAV/Fairtrade ekologiskt och rättvisemärkt Kaffe Hela bönor mellanmörk Mountain high LöfbergsKRAV/Fairtrade 0,5kg Kaffe Hela bönor espressorostning Sackeus

Läs mer

Baristautbildning. Restaurang och livsmedelsprogrammet

Baristautbildning. Restaurang och livsmedelsprogrammet Baristautbildning Restaurang och livsmedelsprogrammet Med tiden har trenderna inom kaffedrickandet ändrats och numera nöjer man sig inte med vanligt bryggkaffe. Kaffedrycker har därför blivit mycket viktiga

Läs mer

Allt för en God Jul på kontoret

Allt för en God Jul på kontoret Allt för en God Jul på kontoret Julen 2014 Ett kilo härlig kola! 69:Kolasäck 1000g Nu - mjukare, lenare, ännu godare 1 kg härligt mjuka kolor i julig jute. Art nr 2890946, Antal/fp 6 Pris 69:- 160:- Hundra

Läs mer

169 kr Salladsbestick i bambu (L30 cm B6,5 cm) 15237 Ursprungsland: Vietnam. 89 kr/st. 89 kr/st

169 kr Salladsbestick i bambu (L30 cm B6,5 cm) 15237 Ursprungsland: Vietnam. 89 kr/st. 89 kr/st 249 kr Tvåvåningsfat Tupp i metall (H 42 B 25 cm) 82035 169 kr Salladsbestick i bambu (L30 cm B6,5 cm) 15237 299 kr Vattenkanna Gris i handmålad plåt (21x16x23 cm) 56087 299 kr Vattenkanna Katt i handmålad

Läs mer

Ruby Red Berries, rooibos

Ruby Red Berries, rooibos Uppgiftslämnare: Arvid Nordquist HAB Artikelbenämning: Produktinformation Ingrediensförteckning: INGREDIENSER: Rooibos, tranbärsarom, hallonarom, jordgubbsarom. Produktgruppsindelning: 110915441 / Kolonial/Speceri

Läs mer

PRALINER & ANDRA GODSAKER. Handgjorda produkter på Direct-trade-choklad från Valrhona & Felchlin Rena råvaror & inget annat

PRALINER & ANDRA GODSAKER. Handgjorda produkter på Direct-trade-choklad från Valrhona & Felchlin Rena råvaror & inget annat PRALINER & ANDRA GODSAKER Handgjorda produkter på Direct-trade-choklad från Valrhona & Felchlin Rena råvaror & inget annat T o m Sommaren 2014 HANDGJORDA GODSAKER med naturliga smaker, gjorda på rena råvaror

Läs mer

Produktnyheter. Höstprodukter. Julen

Produktnyheter. Höstprodukter. Julen Produktnyheter Höstprodukter Julen Produktnyheter NYHETER HÖSTEN 2014 Konditoripraliner / Petit-Fours CONFISERIE BURG LAUENSTEIN, TYSKLAND Benämning Vikt/förp. Ca-ant/förp. Pris/förp. Ca-pris/st.

Läs mer

Spagetti puttanesca Tomatsås, kapris, sardeller och oliver. 99:-

Spagetti puttanesca Tomatsås, kapris, sardeller och oliver. 99:- STRANDMENY Spagetti puttanesca Tomatsås, kapris, sardeller och oliver. 99:- Fransk pasta med fläskfilé Fläskfilé och champinjon i en krämig dijon- och dragonsås. 119:- Sjöviks klassiska bakade potatis

Läs mer

SPECIALERBJUDANDE. Gäller Mån-Fre kl. 15.00-18.00 Lör kl. 11.30-16.00 Sön kl. 13.00 18.00. Pris 135:-

SPECIALERBJUDANDE. Gäller Mån-Fre kl. 15.00-18.00 Lör kl. 11.30-16.00 Sön kl. 13.00 18.00. Pris 135:- SPECIALERBJUDANDE Gäller Mån-Fre kl. 15.00-18.00 Lör kl. 11.30-16.00 Sön kl. 13.00 18.00 Pris 135:- Välj mellan: A) Kalkonschnitzel med pommes och bearnaisesås B) Grillbiff med persiljesmör och pommes

Läs mer

Kung Markatta Mousserande Äppelmust, 750 ml. Kung Markatta Mousserande Vitt Vin, alkoholfritt, 750 ml. Kung Markatta Äkta Fransk Cider 2 %, 750 ml

Kung Markatta Mousserande Äppelmust, 750 ml. Kung Markatta Mousserande Vitt Vin, alkoholfritt, 750 ml. Kung Markatta Äkta Fransk Cider 2 %, 750 ml Bilaga till pressmeddelande från Kung Markatta 26 april 2016 Produktinformation nyheter Kung Markatta sommaren 2016 Kung Markatta Mousserande Äppelmust, 750 ml Kung Markattas Mousserande Äppelmust tillverkas

Läs mer

surdeg hantverk FRENCH BAKERY stenugnsbakat bröd

surdeg hantverk FRENCH BAKERY stenugnsbakat bröd surdeg hantverk FRENCH BAKERY stenugnsbakat bröd sommar sortiment 2013 HANTVERK SURDEG STENUGNSBAKAT KVALITET FRENCH BAKERY ANNO 1985 FRENCH BAKERY ANNO 1985 BAGERIET French Bakery startade 1985 som ett

Läs mer


SOCKER & TORKAD FRUKT SOCKER & TORKAD FRUKT 1 SOCKER PRODUKTER 30-2261 Råsocker Granulerat 30-2262 Kandisocker på Pinne Brun 100/förp 1st 30-2379 Kandisocker på Pinne Vit 100/förp 1st 46-3962 Vit Diamant Socker 2kg 2 46-3961

Läs mer


SOCKER, FRUKT & NÖTTER SOCKER PRODUKTER 30-2261 Råsocker Granulerat 30-2262 30-2262p 30-2262plexi Kandisocker på Pinne Brun 100/förp Kandipinnar påse 5st Kandipinnar plexibox 10st 1st 12st 30-2379 30-2379p 30-2379plexi Kandisocker

Läs mer


GRAFISKA PRODUKTER 2013 GRAFISKA PRODUKTER 2013 PRODUKTER OCH PRISER Fokus på: Cirkelvepor Takdekor Vepor Godis Vinyltexter Vepa Cirkelformad Välj storlek och skicka oss ett original så löser vi resten. Vepan hänger i taket lagom

Läs mer

sockrets stora SMAKVÄRLD! Upptäck FARINSOCKER

sockrets stora SMAKVÄRLD! Upptäck FARINSOCKER sockrets Upptäck stora SMAKVÄRLD! FARINSOCKER SMAKCIRKLAR Hur kan man se hur något smakar? Med hjälp av våra smakcirklar får du en bild av sockers olika nyanser och smakrikhet. I broschyren hittar du flera

Läs mer