Better$use$of$space$ $ a$sustainable$focus$$

Storlek: px
Starta visningen från sidan:

Download "Better$use$of$space$ $ a$sustainable$focus$$"

Transkript

1 NationellITSKonferensden16417september The12 th SwedishNational ITSConference 2015 Betteruseofspace asustainablefocus Gothenburg16A17September2015

2 NationellITSKonferensden16417september 2015 svensk nationell ITS konferens. Årets nationella ITS-konferens kommer att genomföras den september i Göteborg. Vi kommer att vara på Lindholmen Science Park och deras konferensanläggning. Årets tema är better use of space - a sustainable focus vilket har koppling till ITS världskongress lite senare under hösten i Bordeaux. Med temat anger vi inriktning mot ökad hållbarhet och effektivitet inom transportsektorn samt hur olika perspektiv kommer att integreras mer och mer inte bara inom transportsektorn utan i hela samhället. Vår tolkning av space är i flera dimensioner som du kommer att märka på konferensen. Konferensen kommer naturligtvis att handla mycket om vad som sker i Sverige inom såväl ITS och ICT-området, men kommer också att ge inspiration från andra europeiska länder samt trender som är starka. Better use of space rymmer flera dimensioner, exempelvis hur vi bygger våra städer smartare, hur telekominfrastrukturen blir bärare av nya tjänster med efterföljande affärer. Vidare hur uppkoppling av saker och människor kommer att förändra våra beteenden och kunskaper, hur data kommer att vara en nyckelfråga och hur sociala media kan skapa ny realtidsinteraktion mellan individer och operatörer, hur informationsfederationer kan uppstå genom samverkan mellan offentlig och kommersiell verksamhet. Konferensen kommer att spegla skeendet i ett brett perspektiv bland många aktörer såväl i näringsliv som i de offentliga organisationerna. Det fortsatta arbetet med Sveriges ITS Strategi och Handlingsplan kommer att redovisas liksom vad som händer inom akademin och de offentliga organisationerna. Du får höra mer av detta under konferensen. Välkommen Christer Karlsson ITS Sweden

3 E1F8G88H#?+,'5.'+/0 "#%&'())*+,-&'.(/('01('234250(6(78(/ 8GI8D<#0+0? +9(:9#%/7#'.&/*+,,;(1(';%))8(&6('%'<9(:&'.(/(':(= 8GJ9D<#0+0?,#,,+/07=#''#5;,#/4,<.6# :#''#5K,C.5'#5.0*C/5##44+6+#0';,#/4/;5'5.0,</5',L,'#C+,'"#'"#C#/4'"+,L#.5M,3/04#5A #06#.0*+,.<.5'/4'"#?5/)'"/4'"#,;,'.+0.=1#,/6+#'LFD;5,<#.N#5,)+11'/;6"/0'"#6".1A 1#0?#,)#,##+0'"#()#*+,"'5.0,</5',/6+#'L)+'"4.,'A?5/)+0?=+?6+'+#,.0*)+'"'"#?5/)+0? 0##*4/5+0'#11+?#0''5.0,</5',FO#)+11.1,/"#.5"/)0#)5/1#,.5#=#+0?65#.'#*.0*"/).6/;0A '5L+0'"#C+*,'/4P;5/<#0/=+??#5'".0/;5/)0'.6N1#,'"#6".11#0?#,)#".Q#F"#,#,,+/0"+?"A 1+?"','"#)"/1#23+0*;,'5L.,.,'5/0?/<</5';0+'L4.6'/54/5?5#.'#5,L0#5?L.0*#44#6'+Q#0#,,'/ =#+00/Q.'+/0*5+Q#5,F S&1(/#&/C/U((/M/'D.=1=&/1.G/#'1(%O()(<#%&'('.G/9?))8#/#0C1(/ %8J9 R+0?#1

4 "#%&'())*+,-&'.(/('01('234250(6(78(/ %%%9 O".'6.0)##S<#6'45/C'"#5.<+**#Q#1/<C#0'/4'"#*+?+'.1)/51*T-#),#5Q+6#6/0A 6#<',K'"#;,#/4*.'.+0*+44#5#0'6/06#<',7"/),/T "+,,#,,+/0)+11"+?"1+?"''"#C.U/5+0Q#,'C#0',.0*6".0?#,'".'/66;5'"5/;?"/;''"#*+?+'.1,/A 6+#'LF2'+061;*#,'"#20'#50#'/4PQ#5L'"+0?K)"+6"C#.0,#Q#5L'"+0?'".'+,6/00#6'#*,;6".,<#/A <1#K'"+0?,.0*Q#"+61#,FO".'*/)#*/)+'".11'"#*.'.?#0#5.'#*K"/))#)/5N'/?#'"#5K"/) )#6.0?.+00#)N0/)1#*?#.0*"/))#)+11#S<#5+#06#0#),#5Q+6#,.0*=;,+0#,,C/*#1,FV;5A '"#5/0)#.5#'/1*.=/;''"#,'5/0?#,''5#0*,+0.4+Q#AL#.5<#5+/*K0#)=;,+0#,,)+'"0#),#5A Q+6#,K.1,/"/):+?W.'.)+11=##S<1/+'#*.0*?+Q#,;,0#)+0,+?"',KN0/)1#*?#.0*,#5Q+6#,4/56+'A +X#0,.0*=;,+0#,,FV;5'"#5/0"/),/6+.1C#*+.)+11=#.</'#0'+.14/50#),#5Q+6#,)+'"5.0,</5' 4/5Y/0*/0.,.0+0,<+5+0?#S.C<1#F &:99J/J66)(E(/E%'F#LC'0(/&:9#..C/07&1())(/= 0&:%#)#7(1%#0&76&('%#).G/'F#LC'0(/7(1+/#'06&/.&/Y&'1&'0&7%'06%/(/#'1((H(76()= R1E%0&/6?,#70J'<"&/1%:D,%7&'S&/%[O##,:%('%06?K/%:00&'T(0(#/:9DP9#/)%(,J'1./?' +/#'06&/.&/Y&'1&'= S&1(/#&/C/U((/M/'D.=1=&/1.G/#'1(%O()(<#%&'('.G/9?))8#/#0C1(/ %&J9R+0?#11;06"

5 NationellITSKonferensden16417september 1400Kanvianvändatransportsystemeteffektivare?Ärökaddigitalsamverkansvaret? Sessionenkommerattvisapåmöjligheternaochplanernamedattanvändastadensoffentligarum effektivareochmerahållbart.stadensutrymmenochsärskiltgaturummenäridagutsattaförstor konkurrensmycketberoendepåinflyttningtillstäderna.medborgarnaochnäringslivetidessolika formerärdenlevandestadenspuls,deolikatransporternaärkittetochallavillhahögstaprioritet. Enutmaning Stadensplaneringmåsteklaraenkollektivtrafiksomharhögattraktionskraftochpunktlighetmed säkerinformation,särskiltvidbytes4ochmötespunkternamellanolikatrafikslag.leveranstrafikentill stadensolikaaktörermåstevaraflexibelnärochhurskadenske.sammantagetmåsteenstörresam4 verkanöverbranschgränsernaskeföratteffektiviseraochmötaresenärensbehovavhelhetslös4 ningarochförattfrämjautvecklingenavhandelnsvillkor.vikommerattfåpresenteratnågraexem4 pelfrånbl.a.göteborgochstockholm TalareärLinaOlssonprojektledareDenCitypåLindholmenScienceParkochprojektledarefrånNorra DjurgårdsstadenStockholm(ejkonf.),ÅsaBurmanverksamhetschefLighthouse,Göteborg,LiliaHal4 senbidarprojektledareigöteborgsstadtk,janbergstrandsektionschefpåtrafikverket,olgakor4 dasföreståndareförsmartsustainablecitiespåkth,olalindströmverksamhetsutvecklarepåtrafik Stockholm. ModeratorärMikaelLind,ViktoriaSwedishICT&SwedishCenterforDigitalInnovation, 1530Mingel 1600Vilkafordonvillvihaframöver?Temaomfordonsutvecklingenochdessanvändning allaslagavfordon/farkoster Runtomivärldenhändermycketinomfordons4ochfarkostområdet,alltfrånsjälvkörandebilar, avanceratförarstöd,tilleldrivnafordonochfjärrstyrdadrönare.vikommerattfåenöverblickavde starkastetrenderna.detärocksåflerainitiativsompågårinomfordons4ochelområdetisverige, ElectriCity,Bussplan2030,RoadMap:Swedenförattnämnanågraprojektdärfordonsindustrin,stä4 derochlandstingärengageradeliksomolikatankesmedjor. TalareärMaximeFlament,HeadofSector SafeMobilitypåErtico,JennyKönbergHeadofIntelligent TransportsystempåEricsson,JanHellåkerProgramManagerDriveSwedenpåLindholmenScience Park,JohanKonnbergHeadofRoadMap:Sweden,SvenWolf,VDpåBzzt, ModeratorärSamuelHenningsson,VDpåNetPortSciencePark. 1730AvslutningförstadagenmedmingelochmedutdelningavITSAward.

6 Torsdagen17september NationellITSKonferensden16417september 0830Temakringvåratestsiter Sverigeärkäntfördensvenskamodellen.Braocheffektivsamverkanenligttriple4helixmodellen. VåratestsiterinomTestsitesofSwedenkommerattvisapåsamverkan,medexempelpåresultat ochhursverigekandrauppmärksamhettillsig. MedverkargörLeifAxelssonProgramManagerpåLindholmen,ÅkeLindströmDirectorpåKistaSci4 encecity,samuelhenningssonvdpånetportscienceparkochtomramstedtordförandeföritsda4 larna ModererargörIngerGustafsson,enhetschefpåVINNOVA. 0930Mingel 1000RedovisningavITSHandlingsplan(Observeraattdennasessionenäröppenföralla) Sverigeharsedanvärldskongressen2009arbetetmedITS/ICTsomenmöjliggörareförattförbättra såväleffektivitetenitransportsystemetsombrukarensnyttorgenomendigitalsamverkan.rege4 ringenharinitieratdettaochsåvältrafikverketsomvinnovahardrivitutvecklingengenomolika plattformar.vifårenrapporteringochdiskussionkringdetgemensammauppdragettilltrafikverket, Transportstyrelsen,VinnovaochakademinomSverigesITSStrategiochHandlingsplan.Enmöjlighet tillpåverkanges. ModeratorärPetterÅsmanprojektledarefrånTrafikverket 1130Vadpågår?Vilkainitiativvillviseitransportsektorn,endiskussionmellanolikaaktöA rer Runtomivärldenpågårenmängdinitiativmedavanceradeförarstödellerheltsjälvkörandefordon. Såvälregerings,myndighet,somföretagsleddademonstrationerpågårpåallmännavägarochiof4 fentligarummetimångaländer. Dennasessionsyftartillattvisahursvenskaföretagmedverkarpåolikasätt,menocksåhurregering, myndigheterochkommunermedverkarochpåverkarochframföralltförendiskussionomhurvifår tilldemonstrationeridenverkligatrafiken ettsättattinvolveramedborgarna. MedverkandeipaneldiskussionenärCatharinaElmsäter4Svärdordförandeistyrelsenförprogram4 metautomatedtransportsystems,karinsvensson4schmidtordförandeitrafikutskottet,maria ÅgrenGDförTransportstyrelsen,OrvarHurtigVicePresidentforEricssonsIndustryandSociety, NiklasGustafssonPublicAffairspåVolvo,PeterCarlssonVPofSupplyChainatTeslaMotors,Lars JernbäckerVice President Head of Business Development, Civil Security at Saab AB (ej konfirm.) ModeratorärDr.OvePettersson,f.d.VINNOVA 1300Avslutning AvslutningsordfrånChristerKarlsson,VDITSSweden 1330Mingellunchochavslutning

7 Generalinformation NationellITSKonferensden16417september Thisyear sconferencewillbeheldat Hallen,LindholmenConferenceCentre,Lindholmspiren5, Göteborgon16417September September Registrationandcoffeewillbeservedfrom09.00 Theprogramstartsat09:30andendsat17.30withabuffetmingleandpriceawardceremony 17September Theprogramstartsat08:30andendsat13.30withlunchandmingle. Detailedinformationabouttheconferencecanbefoundhere: Visitingadress: ChalmersKonferens&Restauranger LindholmenSciencePark Lindholmspiren5 Göteborg

8 NationellITSKonferensden16417september Hotel AwardwinninghotelRadissonBluRiversideHotelislocatedonthewaterfrontclosetothemain buildingatlindholmenscienceparkandlindholmenconferencecentre. Documentation Allmaterialwillbepostedaftertheconferenceon: Payment Delegates feeshallbepaidinadvance Changesintheprogram Therecanbechangesintheprogram,keepupdatedon: Ifyouhaveanyquestions: Phone

Nationell ITS Konferens den 16-17 september. The 12 th Swedish National ITS Conference 2015. Better use of space a sustainable focus

Nationell ITS Konferens den 16-17 september. The 12 th Swedish National ITS Conference 2015. Better use of space a sustainable focus The 12 th Swedish National ITS Conference 2015 Better use of space a sustainable focus Gothenburg 16-17 September 2015 2015 svensk nationell ITS konferens. Årets nationella ITS-konferens kommer att genomföras

Läs mer

The 9 th Swedish National ITS Conference 2012. From Action Plans to Action the Swedish Model

The 9 th Swedish National ITS Conference 2012. From Action Plans to Action the Swedish Model The 9 th Swedish National ITS Conference 2012 From Action Plans to Action the Swedish Model 19 September Kista, Stockholm Hosts: Partners: The Swedish National ITS Conference 2012 From Action Plan to Action

Läs mer

SHARED SERVICE CENTER

SHARED SERVICE CENTER inbjudan till konferens i Stockholm den 9-10 maj 2012 TALARE FRÅN KF Shared Services Christer Jönsson ABB Ingrid Wåhlberg Volvo Business Service Elisabeth Rocke Lönsam koncentration av tjänster för optimerad

Läs mer

Välkommen till SKNT:s årskonferens den 9-11 maj 2012

Välkommen till SKNT:s årskonferens den 9-11 maj 2012 Välkommen till SKNT:s årskonferens den 9-11 maj 2012 Välkommen till Linköping och SKNT:s årskonferens den 9-11 maj 2012 Kompetensförsörjning och internationalisering Inriktningen på årets konferens är

Läs mer

Välkommen till SKNT:s årskonferens den 9-11 maj 2012

Välkommen till SKNT:s årskonferens den 9-11 maj 2012 Välkommen till SKNT:s årskonferens den 9-11 maj 2012 Camilla Lejon Bengt Westman Linda Wennerholm Leif Erlandsson Björn Nordén Colin Moon Klas Danerlöv Hans Stråberg Robert Wickman Troed Troedsson Annete

Läs mer

The 8 th Swedish National ITS Conference 2012

The 8 th Swedish National ITS Conference 2012 The 8 th Swedish National ITS Conference 2012 From Action Plans to Action the Swedish Model Stockholm 19 juni 2012 ITS The Swedish Way Årets konferens kommer att dels fokusera på regeringens uppdrag till

Läs mer

The 8 th Swedish National ITS Conference 2012

The 8 th Swedish National ITS Conference 2012 The 8 th Swedish National ITS Conference 2012 From Action Plans to Action the Swedish Model Stockholm 19 juni 2012 ITS The Swedish Way Årets konferens kommer att dels fokusera på regeringens uppdrag till

Läs mer

Attityder till det innovationsstödjande systemet i Kalmar län

Attityder till det innovationsstödjande systemet i Kalmar län Attityder till det innovationsstödjande systemet i Kalmar län Preliminära resultat från pågående undersökning April 2014, Peter Bjerkesjö, Daniel Hallencreutz, Pär Lindquist Kontigo AB Uppdraget Ta fram

Läs mer

EN UNIK MÖJLIGHET. Småland och Blekinge gör gemensam satsning

EN UNIK MÖJLIGHET. Småland och Blekinge gör gemensam satsning EN UNIK MÖJLIGHET. Småland och Blekinge gör gemensam satsning för att marknadsföra regionen och dess näringsliv på en internationell arena. 2010 deltar man i världsutställningen i Shanghai, Expo 2010.

Läs mer

KOMMUNIKATIV PLATTFORM

KOMMUNIKATIV PLATTFORM KOMMUNIKATIV PLATTFORM ITS the Swedish way Samlingsbegrepp Wien 2012 ITS the Swedish way Samhällsbehov Innovativ R&D Affärslösningar ITS i samverkan mellan näringslivet myndigheter och akademi Budskap

Läs mer

Vi är SäkerhetsBranschen!

Vi är SäkerhetsBranschen! Vi är SäkerhetsBranschen! SäkerhetsBranschens årsmöte 24 april 2015 Årsmöte Workshops Seminarier Mingel Underhållning Middag Foto: Rebecca Martyn Träffa våra utställare Studiebesök Barhäng Relax Djurönäset

Läs mer

We are very practical, says Hans Murman about Swedish architects.

We are very practical, says Hans Murman about Swedish architects. We are very practical, says Hans Murman about Swedish architects. Hans Murman, CEO of Murman Arkitekter, has made himself known for an architecture in which national tradition is blended with international

Läs mer

Tänk om du hade kontoret på Lindholmen...

Tänk om du hade kontoret på Lindholmen... Lindholmen Tänk om du hade kontoret på Lindholmen... Förmodligen stöter du på en blivande kund eller samarbetspartner redan på färjan över älven. Till lunch kommer du i samspråk med några branschkollegor

Läs mer

Min sommar räcker inte mycket längre än hit. >> Fredrik Gustafsson - Chefredaktör

Min sommar räcker inte mycket längre än hit. >> Fredrik Gustafsson - Chefredaktör Min sommar räcker inte mycket längre än hit. >> Fredrik Gustafsson - Chefredaktör STARTSIDA ARTIKLAR BRANSCHNYTT REDAKTIONEN ANNONSERA PRENUMERERA EVENEMANGSKALENDERN SENASTE NUMRET SSQ AWARD BRANSCHNYTT

Läs mer

MÖTES- OCH KONFERENS GUIDE, SVERIGE

MÖTES- OCH KONFERENS GUIDE, SVERIGE MÖTES- OCH KONFERENS GUIDE, SVERIGE Välkommen till en helt ny mötesupplevelse! På Carlson Rezidor är vårt fokus att tillhandahålla tillförlitliga, professionella och kundanpassade möteslösningar vi försöker

Läs mer

East Sweden Business Solutions. Effektiv logistik

East Sweden Business Solutions. Effektiv logistik East Sweden Business Solutions Effektiv logistik Välkommen till East Sweden, affärsmiljön med växtkraft! Rätt läge Vad har globala industriföretag som Siemens, Ericsson, Toyota, Saab och Väderstadverken

Läs mer

Novare Leadership Academy

Novare Leadership Academy Novare Leadership Academy katalog 2015-2016 Sveriges främsta utvecklingsprogram och nätverk Young Professionals Young Executives Senior Executives Novare Leadership Academy En plattform för utveckling

Läs mer

The 8 Swedish National ITS Conference 2012

The 8 Swedish National ITS Conference 2012 Nationell ITS Konferens 19 juni 2012 IVAs Konferenscenter, Grev Turegatan 16, Stockholm th The 8 Swedish National ITS Conference 2012 From Action Plans to Action the Swedish Model Stockholm 19 juni 2012

Läs mer

Välkommen alla idébärare, innovatörer och företag inom hälsa och välfärd till en inspirerande heldag i Västerås den 27 maj!

Välkommen alla idébärare, innovatörer och företag inom hälsa och välfärd till en inspirerande heldag i Västerås den 27 maj! Välkommen alla idébärare, innovatörer och företag inom hälsa och välfärd till en inspirerande heldag i Västerås den 27 maj! Vare sig det handlar om att se en unik lösning på ett problem, att möta någon

Läs mer

Novare Leadership Academy

Novare Leadership Academy Novare Leadership Academy katalog 2015-2016 Sveriges främsta utvecklingsprogram och nätverk Young Professionals Young Executives Senior Executives Novare Leadership Academy En plattform för utveckling

Läs mer

Program. Årsmöte. 11-12 november, 2014. Elite Park Avenue Hotel, Göteborg

Program. Årsmöte. 11-12 november, 2014. Elite Park Avenue Hotel, Göteborg Program Årsmöte 11-12 november, 2014 Elite Park Avenue Hotel, Göteborg PROGRAM Tisdagen den 11 november 11.00 Registrering 11.30 Lunch Göteborg Energi bjuder på lunch Moderator Annika Johannesson 13.00

Läs mer

Projektnamn: Innovativum Uppdragsgivare: Ingrid Thuresson, Charlotte Engblom & Philip Bengtsson Projektgruppdeltagare: Sara Nasser, Arianita Rexha &

Projektnamn: Innovativum Uppdragsgivare: Ingrid Thuresson, Charlotte Engblom & Philip Bengtsson Projektgruppdeltagare: Sara Nasser, Arianita Rexha & Projektnamn: Innovativum Uppdragsgivare: Ingrid Thuresson, Charlotte Engblom & Philip Bengtsson Projektgruppdeltagare: Sara Nasser, Arianita Rexha & Jesper Zanton Projektkordinator: Dina Jacobson Innehåll:

Läs mer

Förfrågningsunderlag/! Ramavtal'för$senior'projektledning-vid- Lindholmen*Science*Park!

Förfrågningsunderlag/! Ramavtal'för$senior'projektledning-vid- Lindholmen*Science*Park! FÖRFRÅGNINGSUNDERLAG TJÄNSTER Refnr:LSP9201292 Förfrågningsunderlag/ Ramavtal'för$senior'projektledning-vid- Lindholmen*Science*Park Härmed'inbjuds'ni'att'lämna'anbud'enligt'nedan'angina'förutsättningar'

Läs mer

Photo: Jon Mihkkal Inga. Photo: Kristoffer Unga Pirak INBJUDAN

Photo: Jon Mihkkal Inga. Photo: Kristoffer Unga Pirak INBJUDAN Photo: Jon Mihkkal Inga Photo: Kristoffer Unga Pirak INBJUDAN Branschdagar i Östersund/Staare Fredag-Lördag 22-23:e maj 2015 2015-04-15 Varmt välkommen till Sameslöjdstiftelsens Sámi Duodji branschdagar

Läs mer

Inspiration Days 2015. 14-16 april / Stockholm Waterfront Hotel

Inspiration Days 2015. 14-16 april / Stockholm Waterfront Hotel Inspiration Days 2015 14-16 april / Stockholm Waterfront Hotel Handfasta tips, erfarenhetsutbyte och nätverkande Välkommen till vår användarkonferens för dig som vill lära dig mer om flexitebpms, utbyta

Läs mer

Konferens Recherce & Enterprise

Konferens Recherce & Enterprise Konferens Recherce & Enterprise 2 april 2014, Reims Frankrike Representant för VKL: Nina von Krusenstierna Om konferensen Region Champagne - Ardenne och CARINNA (Institutet för forskning och innovation

Läs mer

Svenskt agerande i EU inom ITSområdet. ITS Rådet 2011-05-18. Christer Karlsson, ITS Sweden Alf Peterson, ITS Sekretariatet

Svenskt agerande i EU inom ITSområdet. ITS Rådet 2011-05-18. Christer Karlsson, ITS Sweden Alf Peterson, ITS Sekretariatet Svenskt agerande i EU inom ITSområdet ITS Rådet 2011-05-18 Christer Karlsson, ITS Sweden Alf Peterson, ITS Sekretariatet Svenskt agerande i EU inom ITS-området Syfte med positionspapper Att driva på och

Läs mer

160 miljoner i EU stöd till tolv projekt i Östra Mellansverige

160 miljoner i EU stöd till tolv projekt i Östra Mellansverige Strukturfondspartnerskapet Östra Mellansverige PRESSINFORMATION Datum 10 juni 2015 Dnr Till media i Uppsala, Örebro, Södermanland, Västmanland och Östergötlands län 160 miljoner i EU stöd till tolv projekt

Läs mer

KICK-OFF ELLER KICK-IN?

KICK-OFF ELLER KICK-IN? KICK-OFF ELLER KICK-IN? Diskobowling och fina krogen i all ära, men de lämnar sällan några bestående avtryck. Vill du däremot bjuda dina medarbetare på en insiktsfull upplevelse som ger mer drag i affärerna

Läs mer

Utställarinformation 2014. ÄR DU på plats när Sveriges offentliga beslutsfattare MÖTS?

Utställarinformation 2014. ÄR DU på plats när Sveriges offentliga beslutsfattare MÖTS? Utställarinformation 2014 ÄR DU på plats när Sveriges offentliga beslutsfattare MÖTS? 5 goda skäl till varför du bör vara på plats när de offentliga beslutsfattarna möts 1 Kommunicera ditt budskap direkt

Läs mer

2013-02-15 13/35. Samtliga nämnder/styrelser Kommunala bolag/stiftelser Landstinget Länsstyrelsen

2013-02-15 13/35. Samtliga nämnder/styrelser Kommunala bolag/stiftelser Landstinget Länsstyrelsen 2013-02-15 13/35 Samtliga nämnder/styrelser Kommunala bolag/stiftelser Landstinget Länsstyrelsen Engelska för kommun och offentlig sektor Utveckla ditt ordförråd i engelska med inriktning på kommun och

Läs mer

LEVERANTÖR AV DET GODA MÖTET INNEHÅLL

LEVERANTÖR AV DET GODA MÖTET INNEHÅLL LEVERANTÖR AV DET GODA MÖTET INNEHÅLL OM TELETECH SNABB LEVERANS I SKANDINAVIEN TOLKUTRUSTNING FÖR MÖTEN OCH KONFERENSER AV-UTRUSTNING FÖR MÖTEN OCH EVENEMANG RÖSTNING UTRUSTNING VIDEOKONFERENS VILL DU

Läs mer

Protokoll Revästs styrelsemöte i Mölndal den 1 december 2003

Protokoll Revästs styrelsemöte i Mölndal den 1 december 2003 Protokoll Revästs styrelsemöte i Mölndal den 1 december 2003 Närvarande: Olof Blomqvist, högskolan Trollhättan/Uddevalla Lisette Daneberg, Sif Göteborg Jörgen Kyle, Göteborgs universitet Thomas Lindén,

Läs mer

Nämnd för arbetsmarknad, näringsliv och attraktivitet 106-119

Nämnd för arbetsmarknad, näringsliv och attraktivitet 106-119 PROTOKOLL 1(6) Diarienummer Plats: Regionens hus, sal A Närvarande: ande: Malin Wengholm (M), Torbjörn Eriksson (KD), Maria Hörnsten (S), Jonas Magnusson (S), Mona-Lisa Hagström-Svensson (S) ersätter Martina

Läs mer

1 5 3 3 4 Lugn Närhet

1 5 3 3 4 Lugn Närhet Grupp Kunskap Drivkraft Lugn Mångfald Byt ut Lägg till 1 5 3 3 4 Lugn Närhet Övriga kommentarer: Utvecka ordet mångfald. Drivkraft Inspiritation 2 6 6 3 2 Lugn Öppenhet Mångfald Internationellt Trivsel

Läs mer

Företag Forskning? Kunskap. Prover. Kompetensbehov FOI

Företag Forskning? Kunskap. Prover. Kompetensbehov FOI Projektets läge Kunskap Företag Forskning? Kompetensbehov Prover FOI Utvecklingscentrum för vatten Vision: Nod i arbetet med vatten från källa till recipient Samla, sammanställa och sprida redan existerande

Läs mer

KB på nytt uppdrag. Välkommen till bibliotekschefsmöte 21-22 nov 2012

KB på nytt uppdrag. Välkommen till bibliotekschefsmöte 21-22 nov 2012 Datum/Date Dnr/Ref.no 2012-10-19 239-KB 756-2012 KB på nytt uppdrag samordning och utveckling inom bibliotekssfären Välkommen till bibliotekschefsmöte 21-22 nov 2012 Möt Elsebeth Tank, som har en lång

Läs mer

Grön IT-lots förstudie

Grön IT-lots förstudie Grön IT-lots förstudie Foto G Almesåker Gunilla Almesåker Christer Svensson 10-11-20 Page 1 Projektdeltagare Professor Sture Hägglund, IDA, LiU, adm. ansvarig Civ. ing. Gunilla Almesåker, projektledare

Läs mer

Program. Spana, lyssna, tala. Kommunikationsdagarna 17-18 mars, 2015. Barkarby Gård, Stockholm

Program. Spana, lyssna, tala. Kommunikationsdagarna 17-18 mars, 2015. Barkarby Gård, Stockholm Program Spana, lyssna, tala Kommunikationsdagarna 17-18 mars, 2015 Barkarby Gård, Stockholm PROGRAM Tisdagen den 17 mars 11.00 Buss Från Cityterminalen 11.00 12.00 Registreringen öppnar Lunch 13.00 Välkommen

Läs mer

Magnus Höjman Supply Chain Professional of the Year 2014

Magnus Höjman Supply Chain Professional of the Year 2014 Magnus Höjman Supply Chain Professional of the Year 2014 Magnus Höjman på Clas Ohlson vann tävlingen och blev årets Supply Chain Professional 2014 i stenhård konkurrens av de övriga fem finalisterna. Juryns

Läs mer

SolutionCLUES startades av Björn Johansson tillsammans med Eva Persson. Vill du veta mer om SolutionCLUES konsulter och vad som kan erbjudas är du

SolutionCLUES startades av Björn Johansson tillsammans med Eva Persson. Vill du veta mer om SolutionCLUES konsulter och vad som kan erbjudas är du 1 2 SolutionCLUES startades av Björn Johansson tillsammans med Eva Persson. Vill du veta mer om SolutionCLUES konsulter och vad som kan erbjudas är du välkommen att titta på vår hemsida: www clues.se Kontaktinformation:

Läs mer

LL C O N S U LT I N G O N S U LT I BRAND

LL C O N S U LT I N G O N S U LT I BRAND T EP LL C O N S U LT I N G N CO C AR NC T EP DE C C AR DE NG LL C O N S U LT I CO BRAND 1 RED MATTERS Förtagskultur hållbart växande CARDELL CONSULTING CONCEPT C AR D ELL CO NSULTIN G CO N CEPT Liv Cardell,

Läs mer

Vår verkstad. Utvecklar människor och affärer.

Vår verkstad. Utvecklar människor och affärer. Vår verkstad Utvecklar människor och affärer. Västerås Science Park är en inspirerande och innovativ miljö och mötesplats för företag i tillväxt där människor, idéer, kunskap och kapital kan mötas och

Läs mer

ITS rådet - en statusrapport om rådets uppgifter samt handlingsplanen 2012-08-23

ITS rådet - en statusrapport om rådets uppgifter samt handlingsplanen 2012-08-23 ITS rådet - en statusrapport om rådets uppgifter samt handlingsplanen 2012-08-23 Uppdraget Utveckla formerna för samarbete mellan myndigheter och näringsliv Ge råd i och påskynda Trafikverkets och andra

Läs mer

Förpackning & Innovation 12-13 mars 2014 Karlstad CCC

Förpackning & Innovation 12-13 mars 2014 Karlstad CCC Förpackning & Innovation 12-13 mars 2014 Karlstad CCC PACSEM 2014 Förpackning & Innovation Gör dig redo för framtidens förpackningsutveckling! Ny cellulosateknik, The Internet of Everything och hållbar

Läs mer

Potential for the Green ICT innovation system A case study from the Gothenburg region

Potential for the Green ICT innovation system A case study from the Gothenburg region Potential for the Green ICT innovation system A case study from the Gothenburg region Emma Franzén David Wallgren Tack till Business Region Göteborg Erik Behm Andreas Göthberg Chalmers tekniska högskola

Läs mer

Stockholm 20 februari 2013

Stockholm 20 februari 2013 Stockholm 20 februari 2013 Den 20e februari 2013 arrangeras för femte året i rad succékonferensen Social Responsibility Day. Bakom konferensen står tidningen Miljöaktuellt och SIS tillsammans med flera

Läs mer

Välkomna *ll frukostmöte!

Välkomna *ll frukostmöte! Välkomna *ll frukostmöte! Dagens agenda 5 mars 07:30 Välkommen *ll Automa*on Center frukosten står framdukad! 07:40 Nyheter inom Automa*on Region Helena Jerregård Processledare 07:45 Spaces for innova*on

Läs mer

Fyra gånger Nolia. Mässor Konferens Event Uthyrning

Fyra gånger Nolia. Mässor Konferens Event Uthyrning Fyra gånger Nolia. Mässor Konferens Event Uthyrning Kreativitet Personlighet Mässor Konferens Event Uthyrning Lust Nyskapande När människor och idéer möts. Det är då det händer. Tankar utbyts, erfarenheter

Läs mer

Nya tider för upphandling med tillgänglighet i fokus! Konferens den 24 november 2010

Nya tider för upphandling med tillgänglighet i fokus! Konferens den 24 november 2010 Konferens Välkommen till en nordisk heldagskonferens i Göteborg onsdagen. Arrangörer för konferensen är Västra Götalandsregionen, Nordiska Högskolan för Folkhälsovetenskap och Handikappförbundens samarbetsorganisation

Läs mer

Urban Transition Forum 19 september 2013

Urban Transition Forum 19 september 2013 Urban Transition Forum 19 september 2013 Dokumentation Av Boel Kjellsdotter, projektkoordinator Urban Transition Öresund www.urban-transition.org Innehåll Urban Transition Forum 19 september 2013... 3

Läs mer

Handlingsplan JCI Sweden 2012

Handlingsplan JCI Sweden 2012 1 Introduktion Handlingsplan JCI Sweden 2012 Detta är handlingsplanen för JCI Swedens nationella organisation under verksamhetsåret 2012. Målet för den nationella organisationen är att samordna, stödja

Läs mer

Ökad produktivitet och förbättrad lönsamhet i framtidens gjuterier

Ökad produktivitet och förbättrad lönsamhet i framtidens gjuterier Inbjudan till VÅRKONFERENS Ökad produktivitet och förbättrad lönsamhet i framtidens gjuterier Torsdagen den 11 mars och fredagen den 12 mars 2010 på Scandic Hotel Elmia, Jönköping Konferens arrangerad

Läs mer

Våga Växa Vinna Under 2008-2010 driver ALMI i Gotlands, Jönköpings, Kalmars och Kronobergs län tillsammans med Science Park Jönköping, Träcentrum och

Våga Växa Vinna Under 2008-2010 driver ALMI i Gotlands, Jönköpings, Kalmars och Kronobergs län tillsammans med Science Park Jönköping, Träcentrum och Våga Växa Vinna Under 2008-2010 driver ALMI i Gotlands, Jönköpings, Kalmars och Kronobergs län tillsammans med Science Park Jönköping, Träcentrum och Swerea SWECAST projektet Våga Växa Vinna. Projektet

Läs mer

Vår anläggning Our venue

Vår anläggning Our venue Vår anläggning Our venue Hitta till Stockholmsmässan Stockholmsmässan ligger i Älvsjö, drygt en mil söder om Stockholm City. Både bussar och pendeltåg stannar vid Älvsjö station, som är Stockholmsmässans

Läs mer

Tack så mycket för att ni anordnar denna viktiga konferens.

Tack så mycket för att ni anordnar denna viktiga konferens. Förslag till inledande tal med rubriken Regeringens plan för klimatanpassning vid konferensen Klimatanpassning Sverige 2015 den 23 september 2015. Temat för konferensen är Vem betalar, vem genomför och

Läs mer

Dags för ännu ett spännande program från Piku AB, med fokus på lönsamma affärer för dig som driver företag inom besöksnäringen!

Dags för ännu ett spännande program från Piku AB, med fokus på lönsamma affärer för dig som driver företag inom besöksnäringen! 1 Tadaaa! Dags för ännu ett spännande program från Piku AB, med fokus på lönsamma affärer för dig som driver företag inom besöksnäringen! Det här är en unik chans för dig som: Vill ha fler besökare och

Läs mer

VÄLKOMMEN TILL SAAB! Järfälla, 24 september 2014

VÄLKOMMEN TILL SAAB! Järfälla, 24 september 2014 VÄLKOMMEN TILL SAAB! Järfälla, 24 september 2014 KORTA FAKTA OM SAAB Både militära och civila produkter Omsättning 2013: 23 750 MSEK Antal medarbetare: ca 14 500 Närvaro i 35 länder med kunder i över 100

Läs mer

Inbjudan till FALK-konferens En återblick in i framtiden 24 26 maj 2005

Inbjudan till FALK-konferens En återblick in i framtiden 24 26 maj 2005 Inbjudan till FALK-konferens En återblick in i framtiden 24 26 maj 2005 Alingsås museum. Foto: Okänd Bästa konferensdeltagare FALK har i år nöjet att tillsammans med Alingsås kommun bjuda in till konferens

Läs mer

Användarträff 2014. 19-20 November

Användarträff 2014. 19-20 November Användarträff 2014 19-20 November Välkommen till Pythagoras användarträff 2014! Så var det dags igen för årets användarkonferens. I år törs vi lova att den är fylld med fler nyheter än något tidigare år.

Läs mer

FÖRELÄSNINGAR OCH KURSER GÖTEBORG HÖSTEN 2013. Föreläsningar som förändrar.

FÖRELÄSNINGAR OCH KURSER GÖTEBORG HÖSTEN 2013. Föreläsningar som förändrar. FÖRELÄSNINGAR OCH KURSER GÖTEBORG HÖSTEN 2013 Föreläsningar som förändrar. Lära för Livet Seminarier Utbildning Talarförmedling Er partner inom individ-, ledarskaps- och teamutveckling Sveriges bästa talare

Läs mer

Mathematical Cryptology (6hp)

Mathematical Cryptology (6hp) Time to sign up for the continuation course Mathematical Cryptology (6hp) 12 lectures (2 hours) + 2 small projects Exercises are done on your own and discussed in class (6*2 hours). Contents: Elliptic

Läs mer

Brand & Risk. Hur kan vi hjälpa dig?

Brand & Risk. Hur kan vi hjälpa dig? Brand & Risk Hur kan vi hjälpa dig? WSP BRAND & RISK Vårt erbjudande Vi erbjuder kvalificerade konsulttjänster inom tjänsteområdena hus och industri, transport och infrastruktur samt miljö. Vår totala

Läs mer

Skolriksdag 27-28 april 2015

Skolriksdag 27-28 april 2015 Skolriksdag 27-28 april 2015 - Regionförbundet i Kalmar län Sida 1 av 2 Skolriksdag 27-28 april 2015 Gemensamt deltagande från Kalmar län Vart annat år arrangerar SKL Skolriksdag för målgruppen förtroendevalda,

Läs mer

Inbjudan. Ny Handledarutbildning i WSP (Work Sheet Process)

Inbjudan. Ny Handledarutbildning i WSP (Work Sheet Process) Inbjudan Välkommen till erfarenhetsutbyte om Ny Handledarutbildning i WSP (Work Sheet Process) Plats: Alfa Laval, Lund Tid: Fredagen den 18 januari 2008 kl 10.00-14.30 Netsurvey är glada över att få lägga

Läs mer

THE. The Human Element. Deltagarnytta

THE. The Human Element. Deltagarnytta THE The Human Element Du får en veckas upplevelser som vill utmana dig att ifrågasätta invanda tankesätt och se ärligt på dig själv och din påverkan på andra. Vi börjar med att fokusera på oss som individer

Läs mer

INBJUDAN TILL ÅRSKONFERENSEN 2014

INBJUDAN TILL ÅRSKONFERENSEN 2014 INBJUDAN TILL ÅRSKONFERENSEN 2014 Svenska stadskärnor VÄLKOMMEN TILL ÅRSKONFERENSEN I VÄSTERÅS DEN 21-22 MAJ 2014 Årets största konferens och bankett håller vi i Västerås, Årets Stadskärna 2013! Här samlas

Läs mer

Konferensanteckningar Minutes

Konferensanteckningar Minutes Financial'challenges'today' 'the'solu2ons' tomorrow'' How'to'find'sustainable'financing'for'social'enterprises 28th%of%November%2011 Louis%de%Geer,%Norrköping Konferensanteckningar Minutes Swedish%/%English

Läs mer

Information kring VG2020 och strategisk styrning

Information kring VG2020 och strategisk styrning Information kring VG2020 och strategisk styrning Lars Jerrestrand lars.jerrestrand@borasregionen.se 0723-666561 1 Varför gör vi det vi gör? Invånarna i Västra Götaland ska ha bästa möjliga förutsättningar

Läs mer

2D vs 3D? Nya gränssnitt för processindustrins kontrollrum En pilotstudie

2D vs 3D? Nya gränssnitt för processindustrins kontrollrum En pilotstudie 2D vs 3D? Nya gränssnitt för processindustrins kontrollrum En pilotstudie Produkt- och produktionsutveckling Chalmers tekniska högskola MariAnne Karlsson 1 2 3 4 Bakgrund Processindustrins kontrollrum

Läs mer

BOLAGSJURISTFORUM 2014

BOLAGSJURISTFORUM 2014 inbjudan till konferens i Stockholm den 25-26 november 2014 VÅRA TALARE Konkurrensverket Per Karlsson TeliaSonera Michaela Ahlberg Chief Ethics and Compliance Officer Setterwalls Agnes Andersson Hammarstrand

Läs mer

Mycket ljus och fin lokal som får en extra känsla av rymd tack vare den härliga ljusgården och bra takhöjd! Skyltläge ut mot Svetsarvägen.

Mycket ljus och fin lokal som får en extra känsla av rymd tack vare den härliga ljusgården och bra takhöjd! Skyltläge ut mot Svetsarvägen. Mycket ljus och fin lokal som får en extra känsla av rymd tack vare den härliga ljusgården och bra takhöjd! Skyltläge ut mot Svetsarvägen. Typ Kontor Storlek 1330 kvm Adress Svetsarvägen 8 Område Solna/Solna

Läs mer

MOLNET REDO FÖR TEMA STRATEGISK KUNSKAP OM FÖRETAGSKOMMUNIKATION LÄS MER PÅ WWW.NOLLDISTANS.SE TELEKOM IDAG PRESENTERAR

MOLNET REDO FÖR TEMA STRATEGISK KUNSKAP OM FÖRETAGSKOMMUNIKATION LÄS MER PÅ WWW.NOLLDISTANS.SE TELEKOM IDAG PRESENTERAR TELEKOM IDAG PRESENTERAR 25 APRIL BONNIER CONFERENCE CENTER I STOCKHOLM STRATEGISK KUNSKAP OM FÖRETAGSKOMMUNIKATION TEMA REDO FÖR MOLNET MOLNTJÄNSTER Vad gömmer sig bakom begreppen? I PRAKTIKEN Ta del

Läs mer

Svensk trä- och skogsindustris framtid i Sverige

Svensk trä- och skogsindustris framtid i Sverige www.avesta.se/traskog Avestasamtalen: Svensk trä- och skogsindustris framtid i Sverige Trä- och skogsindustrin är hörnstenar för svensk export. Tillväxten är hög och landets växande skogar är viktiga kuggar

Läs mer

Innovation Enabled by ICT A proposal for a Vinnova national Strategic innovation Program

Innovation Enabled by ICT A proposal for a Vinnova national Strategic innovation Program Innovation Enabled by ICT A proposal for a Vinnova national Strategic innovation Program Ulf Wahlberg, VP INdustry and Research Relations Ericsson AB Ericsson AB 2012 April 2013 Page 1 Five technological

Läs mer

Den nationella. och innovationsstrategin. Horisont 2020. de stärka varandra? 4 september 2013. Per Engström Lena Svendsen

Den nationella. och innovationsstrategin. Horisont 2020. de stärka varandra? 4 september 2013. Per Engström Lena Svendsen Den nationella innovationsstrategin Horisont 2020 och innovationsstrategin kan de stärka varandra? 4 september 2013 Per Engström Lena Svendsen Global Innovation Index 2013 Sverige i världen Global Competitiveness

Läs mer

Skåne en stark kulinarisk region

Skåne en stark kulinarisk region Program till höstens temadag med Knytkalas: Skåne en stark kulinarisk region Välkommen till en dag med smak av kunskap, inspiration, möten och god mat! Vad kännetecknar en kulinarisk frontregion? Hur kan

Läs mer

Lindholmen Det centrala vattennära läget och alla de spännande företag som finns här ger en internationell prägel.

Lindholmen Det centrala vattennära läget och alla de spännande företag som finns här ger en internationell prägel. Lindholmen Det centrala vattennära läget och alla de spännande företag som finns här ger en internationell prägel. Välkommen till Lindholmen! Lindholmen är känt som Göteborgs mest kunskapsintensiva och

Läs mer

VERKSAMHETSSEMINARIER

VERKSAMHETSSEMINARIER INBJUDAN Rekonrgda må orter! VERKSAMHETSSEMINARIER 2015 Fokus på verksamhetsutveckling MISSA INTE:»SPANARNA«OM TRENDER OCH AKTUELLA ÄMNEN Hej! VÄLKOMMEN TILL VERKSAMHETSSEMINARIERNA 2015! VERKSAMHETSSEMINARIERNA

Läs mer

Klimatrapport 2013. Clarion Hotel Arlanda Airport. Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (6)

Klimatrapport 2013. Clarion Hotel Arlanda Airport. Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (6) Klimatrapport 2013 Clarion Hotel Arlanda Airport Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (6) Företagsuppgifter Clarion Hotel Arlanda Airport, kontaktperson är Sara Dahlberg Denna

Läs mer

Tillsammans släpper vi in framtiden!

Tillsammans släpper vi in framtiden! Konferensen Samverkan Skola - Arbetsliv 15 oktober 2015 på Missionskyrkan i Linköping Tillsammans släpper vi in framtiden! Arbetslöshetsfrågan? Kompetensutveckling? - En konferens som ger verktyg till

Läs mer

Ansökan om driftfinansiering 2016 och framåt

Ansökan om driftfinansiering 2016 och framåt Ansökan om driftfinansiering 2016 och framåt Bakgrund NOSP För att sätta framtiden för Norrköping Science Park måste man titta på vilka förutsättningar som finns i Norrköping och hur spelplanen ser ut.

Läs mer

THE. The Human Element. Deltagarnytta. Eftersom organisationer består av människor

THE. The Human Element. Deltagarnytta. Eftersom organisationer består av människor THE The Human Element Du får en veckas upplevelser som vill utmana dig att ifrågasätta invanda tankesätt och se ärligt på dig själv och din påverkan på andra. Vi börjar med att fokusera på oss som individer

Läs mer

Må bättre på Hennickehammars Herrgård

Må bättre på Hennickehammars Herrgård Må bättre på Hennickehammars Herrgård Hennickehammrs Herrgård väntar på att få välkomna dig! En Värmländsk saga HENNICKEHAMMARS HERRGÅRD är en plats att bli förälskad i. Mjukt inbäddad i den trolska skogen,

Läs mer

THE HUMAN ELEMENT (THE) DELTAGARNYTTA

THE HUMAN ELEMENT (THE) DELTAGARNYTTA THE HUMAN ELEMENT (THE) Programmet The Human Element tar fasta på utvecklingskraften inom människor. En ökad självkänsla leder till en ökad förmåga att använda sig själv i samspelet med andra vilket i

Läs mer

Utvärdering av 2014 års resultatkonferens för vägtrafiksäkerhet

Utvärdering av 2014 års resultatkonferens för vägtrafiksäkerhet Utvärdering av 2014 års resultatkonferens för vägtrafiksäkerhet Om undersökningen Undersökningen skickades ut till totalt 191 personer 114 personer har besvarat enkäten Svarsfrekvensen är 59,7 % Undersökningen

Läs mer

Klimatrapport 2014. Stora Brännbo Konferens och Hotell AB. Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (7)

Klimatrapport 2014. Stora Brännbo Konferens och Hotell AB. Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (7) Klimatrapport 2014 Stora Brännbo Konferens och Hotell AB Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (7) Företagsuppgifter Stora Brännbo Konferens och Hotell AB Kontaktperson är Helena

Läs mer

Karin Hjorth Rybbe Europaprogrammen. Västsverige en stark kunskapsbaserad ekonomi 29 maj 2006

Karin Hjorth Rybbe Europaprogrammen. Västsverige en stark kunskapsbaserad ekonomi 29 maj 2006 Karin Hjorth Rybbe Europaprogrammen Västsverige en stark kunskapsbaserad ekonomi 29 maj 2006 Enheten för europaprogrammen Johan Lindberg 08-454 64 53 johan.lindberg@vinnova.se Europaprogrammen / VINNOVA

Läs mer

Rum för själen. 7-9 oktober 2014 i Växjö Peter

Rum för själen. 7-9 oktober 2014 i Växjö Peter Rum för själen 7-9 oktober 2014 i Växjö Peter Du är på helig mark. Ditt uppdrag är oändligt. Du är en bärare av Guds nåd. Den stund som man får dela vid en sjukhussäng, vid en dödsbädd eller i samtalsrummet

Läs mer

Reseberättelse från IAEVG-konferensen 3-6 oktober 2012 i Mannheim, Tyskland

Reseberättelse från IAEVG-konferensen 3-6 oktober 2012 i Mannheim, Tyskland Reseberättelse från IAEVG-konferensen 3-6 oktober 2012 i Mannheim, Tyskland Att få medverka på en av IAEVG:s årskonferenser har varit en dröm för mig sedan jag började studera studieoch yrkesvägledarprogrammet

Läs mer

Hammarby Sjöstads profil: - ung och dynamisk, - modern och global

Hammarby Sjöstads profil: - ung och dynamisk, - modern och global Hammarby Sjöstad 2020:...att förnya en ny stad Trafiknät Stockholm, den 11 juni 2012 Hammarby Sjöstads profil: - ung och dynamisk, - modern och global One of the world s highest profile examples of Sustainable

Läs mer

Klimatrapport 2014. Clarion Hotel Arlanda Airport. Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (6)

Klimatrapport 2014. Clarion Hotel Arlanda Airport. Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (6) Klimatrapport 2014 Clarion Hotel Arlanda Airport Kontaktinformation: Jens Johansson jens.johansson@uandwe.se 1 (6) Företagsuppgifter Clarion Hotel Arlanda Airport, kontaktperson är Sara Dahlberg Denna

Läs mer

INKÖP AV INDIREKT MATERIAL OCH TJÄNSTER

INKÖP AV INDIREKT MATERIAL OCH TJÄNSTER inköp INKÖP AV INDIREKT inbjudan till konferens i Stockholm den 27-28 september 2011 PRAKTIKFALL FRÅN Ordförande för konferensen Tetra Pak Packaging Solutions Jannica Bondesson Lunds universitet Christer

Läs mer

BUSINESS ARENA MALMÖ 2015

BUSINESS ARENA MALMÖ 2015 BUSINESS ARENA MALMÖ 2015 Clarion Hotel & Congress Malmö Live 7 maj Programöversikt CMYK Positiv/svart, används där färg inte är möjligt Negativ/vit, används mot färgade mörka bakgrunder partners Business

Läs mer

Verksamhetsplan 2015

Verksamhetsplan 2015 Event in Skåne AB Verksamhetsplan 2015 Kontakt +46 (0) 40 675 30 01 event@skane.com eventinskane.com Besöksadress Dockplatsen 26 211 19 Malmö Sweden Postadress 205 25 Malmö Verksamhetsplan 1 Sweden Vision

Läs mer

Butikskommunikation kundbeteende och varuexponering. Sammanställd av Elisabeth Aquilonius

Butikskommunikation kundbeteende och varuexponering. Sammanställd av Elisabeth Aquilonius Butikskommunikation kundbeteende och varuexponering Jag har tänkt att tala om Kundbeteende Butikslayout Varuexponering Kännedom om kunden bidrar till att du enklare kan Förändra miljön så att den passar

Läs mer

Lyckade möten i högteknologisk miljö

Lyckade möten i högteknologisk miljö LINDHOLMEN CONFERENCE CENTRE, LINDHOLMEN SCIENCE PARK Lyckade möten i högteknologisk miljö Telefon- och videokonferens Starboard Högteknologiska projektorer & ljud anläggningar Mässhall med full ljud-

Läs mer