ALLA SANN HAR BLI EN KAN DRÖM DIN LTH > UTBILDNINGAR > 2009 / CIVILINGENJÖRER / HÖGSKOLEINGENJÖRER / ARKITEKTER / INDUSTRIDESIGNERS / BRANDINGENJÖRER

Save this PDF as:
 WORD  PNG  TXT  JPG

Storlek: px
Starta visningen från sidan:

Download "ALLA SANN HAR BLI EN KAN DRÖM DIN LTH > UTBILDNINGAR > 2009 / CIVILINGENJÖRER / HÖGSKOLEINGENJÖRER / ARKITEKTER / INDUSTRIDESIGNERS / BRANDINGENJÖRER"

Transkript

1 LUNDS TEKNISKA HÖGSKOLA > LUNDS UNIVERSITET LTH > UTBILDNINGAR > / CIVILINGENJÖRER / HÖGSKOLEINGENJÖRER / ARKITEKTER / INDUSTRIDESIGNERS / BRANDINGENJÖRER ALLA HAR EN KAN BLI SANN DRÖM DIN

2 3 Lunds tekniska högskola Innehåll Isen är spolad! Sista dag för anmälan 15 april Inledning... 3 Världsledande forskning... 4 LTH i världen... 5 Det här kan du bli... 7 LTH en högskola nära näringslivet... 8 Civilingenjörsutbildningar och specialiseringar...1 Civilingenjörsutbildningar Teknisk fysik...1 Teknisk matematik...14 Teknisk nanovetenskap...16 Elektroteknik...18 Datateknik... InfoCom... Kinainriktningen...4 Maskinteknik...6 Maskinteknik med Teknisk design...8 Industriell ekonomi...3 Väg- och vattenbyggnad...3 Lantmäteri...36 Ekosystemteknik/Environmental Engineering...38 Kemiteknik...4 Bioteknik...4 Riskhantering...44 Samarbete med Ekonomihögskolan...47 Brandingenjörsutbildning...48 Arkitektutbildning...5 Industridesignutbildning...5 Förberedande utbildningar...54 Högskoleingenjörsutbildningar Datateknik...56 Byggteknik med Arkitektur...58 Byggteknik- Järnvägsteknik...6 Byggteknik- Väg och trafikteknik...6 Livsmedelteknik...64 Bra att veta Lund-studenternas stad...66 Campus Helsingborg högskolan vid havet...68 Så här fungerar det på LTH...7 Utlandsstudier...7 Moderna yrkesutbildningar...74 Anmälan och behörighet...75 Bostad...76 Med studenten i fokus...77 Adresser...78 LTH är en del av Lunds universitet. Det innebär att hela universitets resurser är tillgängliga för LTHs studenter. Universitetet är i sin tur en del av Öresundsuniversitetet vilket ytterligare vidgar perspektiven. Öresundsbron har skapat en ännu större närhet till Europa. Den tekniska utvecklingen i samhället har gjort att vi har ett alltmer varierat utbud av utbildningsprogram för att täcka näringslivets behov. Varje utbildningsprogram har dessutom flera olika avslutande specialiseringar som ofta är sprungna ur LTHs framgångsrika forskning. Forskningsanknytningen i dessa kurser är därför naturlig. Utbildningen vid LTH skapar ett mervärde genom att programmen inte bara ger en akademisk examen i form av en Bachelor- eller en Masterexamen utan också en yrkesexamen som civilingenjör, högskoleingenjör, brandingenjör, arkitekt eller industridesigner. LTH har alla de viktigaste utbildningsprogrammen inom teknikområdet och vi är en teknisk högskola med en sällsynt stor bredd på kursutbudet. Studierna planeras och genomförs med stor omsorg. LTH har mycket höga pedagogiska ambitioner med en egen pedagogisk utvecklingsgrupp, en pedagogisk akademi av lärare med stort engagemang för undervisning och ett gediget kvalitetssystem. Utöver detta finns en professionell studieservice. Studier kräver rekreation vilket är lätt att finna i Lund med sitt unika studentliv. På nationer möts studenter från vitt skilda utbildningar och i teknologkårens olika sektioner byggs ett socialt nätverk redan från första dagen. Vi hoppas att du finner en utbildning som ger dig de möjligheter som du önskar av livet. I denna utbildningskatalog har vi spolat isen. Du gör piruetterna. Välkommen och lycka till! Anders Axelsson Rektor LTH Alf Göransson Styrelseordförande LTH

3 4 5 Världsledande forskning Internationellt utbyte LTH i världen LTH och Lunds universitet rankas bland de 1 bästa universiteten i världen och bland de allra bästa i Europa. På vissa forskningsområden är vi i världstoppen. Våra forskare utbyter resultat med kolleger över hela världen och åtnjuter hög internationell status. Det leder också till att flera hundra utländska studenter årligen reser hit och deltar i våra utbildningar. Nästan lika många från LTH blir utbytesstudenter utomlands. Även lärarna har internationella utbytesprogram där de hämtar hem nya fackkunskaper och pedagogiska erfarenheter. Några av LTHs mastersprogram vänder sig speciellt till internationella studenter, inte minst från utvecklingsländer. Dessutom erbjuder LTH några studieprogram där delar av utbildningen är förlagd till Kina. Världsledande forskning På LTH bedrivs forskning av hög internationell klass. Inom många vetenskapsområden är vi världsledande, bland annat inom nanoteknologi, laserfysik, reglerteknik och aerosolteknologi. Lunds universitet har flera gånger fått mest anslag till grundläggande forskning jämfört med andra svenska universitet och högskolor. Den höga kvaliteten kommer dig som student till del på flera sätt. Du vet att utbildningen håller hög kvalitet, att dina lärare är kunniga inom sina ämnesområden och att du alltid har tillgång till den senaste kunskapen. Dessutom har du möjlighet att följa unika forskningsprojekt på nära håll. Exempel på ny teknik som utvecklats ur forskning på LTH är det medicinska ultraljudet, bläckstråleskrivarna, GSM-telefonin och trådlös överföring via Bluetooth och hälsobefrämjande livsmedel som Proviva. Ingen vet vad framtiden bär i sitt sköte men på LTH arbetar forskarna nu för att skapa sensorer som ur en droppe blod på ett ögonblick kan hitta alla dina sjukdomar, nya botemedel mot cancer, datalagring och processande i ännu mindre och snabbare och tillförlitliga format än hittills, handikapphjälpmedel som kan förenas med mänsklig värdighet, laserstrålar som både kan hitta och utplåna tumörer. Vi arbetar för att framtidens design ska bli människo- och naturvänlig, framtidens byggnader energisnåla, vackra och bekväma. Framtidens transportmedel ska drivas av förnybara bränslen.

4 6 7 Utbildning > Framtid Det här kan du bli Vad du vill göra efter dina studier, det har du säkert redan en idé om. Våra utbildningar leder fram till ett antal examina. Oavsett vilken väg du väljer på LTH får du en så gedigen utbildning att du kan välja mellan ett flertal yrken. Här är några tips. Civilingenjör En civilingenjör utvecklar och använder ny kunskap och teknik. Som civilingenjör kan du arbeta med utveckling av nya produkter eller samhällsbyggnad, men även med forskning, projektledning, undervisning eller kommunikation. Oavsett inriktning har alla civilingenjörer förmågan att snabbt hämta in nya kunskaper och kreativt lösa problem ofta på nya sätt. Som civilingenjör är det inte alls otroligt att du hamnar i en ledande position, antingen på ett privat företag eller inom stat och kommun. Svenska civilingenjörer är även uppskattade utomlands. Högskoleingenjör En högskoleingenjör använder och utvecklar känd kunskap och teknik. Satsar du på att bli högskoleingenjör väljer du en utbildning som är efterfrågad. Dina kunskaper i bland annat ekonomi, arbetsmiljö, IT och projekthantering ger dig en bred arbetsmarknad. Högskoleingenjörer hittar du idag inte bara inom de traditionellt tekniska branscherna utan även inom till exempel design, miljö, vård, energi, medier, tillverkning, livsmedel och medicin. Prognoser visar att behovet av högskoleingenjörer kommer att växa än mer de närmaste åren. Arkitekt Om du väljer att bli arkitekt är det sannolikt att du får arbeta med att gestalta byggnader och miljöer som omger oss, såväl övergripande som i minsta detalj. Kanske startar du en egen arkitektbyrå. Numera är arkitektens arbetsfält även vidgat till forskning och utveckling, samhälls- och kretsloppsplanering, fastighetsförvaltning eller projektledning. Arkitekter anlitas också till utredningsarbete åt stat och kommun. Industridesigner Efter avslutade studier kan du arbeta med teknisk och konstnärlig utformning av nyttoprodukter, avsedda att tillverkas i serier. Din förmåga att visualisera idéer och kvaliteter kommer väl till pass. Din uppgift blir också att förena alla de professioner som är engagerade i framtagandet av dina produkter. Vilken sorts produkter du vill arbeta med är öppet. Några exempel är möbler, inredningsdetaljer, tjänster, förpackningar, transportmedel och verktyg. Brandingenjör Har du bestämt dig för att bli brandingenjör blir du del av en ännu ganska liten, men exklusiv, skara. Drygt hälften arbetar inom den kommunala räddningstjänsten. De andra har sökt sig till bland annat konsultföretag, statlig verksamhet och till försäkringsbranschen. Civilingenjör i riskhantering Utbildningen i riskhantering vid LTH är ett avslutande program och är den första och enda i sitt slag i Sverige. Som civilingenjör i riskhantering blir din uppgift att identifiera och bedöma risker för att sedan föreslå åtgärder som minskar dem. Du får även arbeta med ledningssystem som är ett verktyg för att gå från ord till handling så att verksamheten verkligen förändras så att olyckor kan undvikas. Forskare Att bli forskare passar dig som har ett specifikt intresseområde och en aldrig sinande vetgirighet. Forskare blir du genom att efter din grundexamen fortsätta på en forskarutbildning. När du är färdig är du teknologie doktor eller teknologie licentiat. Efter din doktorsexamen blir du efterfrågad för din specialistkunskap av såväl högskola och offentlig sektor som näringslivet.

5 8 Världsledande forskning LTH en högskola nära näringslivet Våra utbildningar förnyas ständigt för att möta de krav som ställs på oss av studenter, näringsliv och samhälle. Därför har kontakten med samhälle och näringsliv alltid varit en naturlig del av vår verksamhet. I Lund finns en mängd världsledande företag, till exempel Alfa Laval, Ericsson, Gambro och Tetra Pak. Det är inte heller någon slump att forskningsbyn Ideon ligger bara ett stenkast från LTH. Här har nya företag baserade på forskningsidéer sedan länge haft möjlighet att växa sig starka och lönsamma. Som student vid LTH hamnar du mitt i en värld av nytänkande, uppfinningsrikedom och entreprenörskap. I vårt närområde arbetar inte mindre än 1. personer inom vetenskapsområden som medicin, teknik, naturvetenskap och ekonomi! Detta sker i en expanderande region som tack vare Öresundsbron och Öresundsuniversitetet snabbt håller på att utveckla kontakterna mellan Skåne och Själland. Du är själv i Köpenhamn på en timme från Lunds centralstation. HUR KOMMUNICERAR NÄSTA GENERATION? Drömmer du om att skapa framtidens media? Bluetooth Det ser väl alla att kung Harald Blåtand på Jellingestenen på Jylland håller en dator i ena handen och en mobiltelefon i den andra. Sven Mattisson, som utvecklade den trådlösa tekniken Bluetooth, om varför tekniken heter som den gör. Mer än varannan mobiltelefon som tillverkas är utrustad med Bluetooth och tekniken finns installerad i en bra bit över två miljarder tekniska prylar.

6 Lunds tekniska högskola / Utbildningar / Lund Civilingenjörsutbildningar och specialiseringar Teknisk fysik Atomär och subatomär fysik Fotonik Nanofysik och elektronik Teoretisk fysik Stokastisk och finansiell modellering Tillämpad matematik och bildmodellering Teknisk-vetenskapliga beräkningar och programmering Förbränning och strömning Medicinsk teknik Reglersystem och sensorer Teknisk matematik Beräkningar och simulering Biologisk och medicinsk modellering Finansiell modellering Miljö, risk och klimat Signaler, bilder och system Teknisk nanovetenskap Nanobiomedicin Nanomaterial Nanoelektronik Nanofysik Elektroteknik Bilder och grafik Design av processorer och system på chips Energi och miljö Kommunikationssystem Medicinsk teknik Produktionsekonomi och entreprenörskap Programvara i system Radio och nanoelektronik Reglerteknik och automation Signaler och sensorer Datateknik Design av processorer och digitala system Programvara i system Bilder och grafik Kommunikationssystem Signaler och systemteknik Informations- och kommunikationsteknik Kommunikationssystem Användarvänlighet och design Datasäkerhet och sårbarhet Signaler och styrsystem Kinainriktningen Maskinteknik Energi Fordon Förbränning och strömning Mekatronik Produktion Produktutveckling Teknisk modellering Teknisk logistik Maskinteknik med teknisk design Industriell ekonomi Logistik och produktionsekonomi Finansiering och risk Affär och innovation Integrerad programvarusystem Produktion och produktionsteknik Produktutveckling och design Väg och vattenbyggnad Anläggningsteknik Fastighetsutveckling Husbyggnadsteknik Industriellt byggande Strukturanalys Trafikplanering Vattenresurshantering Lantmäteri Fastighetsrätt Stadsutveckling Fastighetsutveckling Fastighetsmarknaden Geografisk informationsteknik Landinspektör i Danmark Ekosystemteknik Energisystemanalys Miljösystemanalys Naturvård med ekotoxikologi Processdesign Vattenvård med ekotoxikologi Vattenresurshantering Kemiteknik Material Processdesign Läkemedel Bioteknik Bioprocessteknik Livsmedel Läkemedel Molekylär bioteknik LTH UTBILDNINGAR CIVILINGENJÖRSUTBILDNINGAR SAMARBETE MED EKONOMIHÖGSKOLAN BRANDINGENJÖR ARKITEKT INDUSTRIDESIGNER s. 1 s. 46 s. 48 s. 5 s. 5 Riskhantering

7 / Civilingenjörsutbildning / Lund 1 13 Teknisk fysik > Master of Science in Engineering, Engineering Physics > > Teknisk fysik 3 hp 5 år Tomas Christiansson utvecklingsingenjör, GasOptics Jag valde framförallt att lägga mina studier i en riktig studentstad med en ordentlig teknisk högskola så Lund var egentligen det enda alternativet. Mitt intresse för matematik och fysik gjorde valet av program lätt. Det blev teknisk fysik. Merparten av de kurser som jag läste under studietiden var både roliga och nyttiga. Efter examen fick jag en projektanställning på avdelningen för Atomfysik på LTH. Projektet handlade om att jobba med en kamera som ser osynliga gaser. Efter ca 1,5 år kom verksamheten i avknoppningsföretaget GasOptics igång på allvar och jag kunde fortsätta mitt jobb i företagets regi. Mina arbetsuppgifter är mycket varierande eftersom företaget endast har 1 anställda, jag jobbar dels laborativt med utvärdering av olika kameror, dels med utveckling av nya metoder och algoritmer, men framförallt sysslar jag med bildbehandling och mjukvaruutveckling. Frances Sprei doktorand inom energi och miljö Varför söka till Teknisk fysik vid LTH? Teknisk fysik är den civilingenjörsutbildning som ger dig den bredaste teoretiska grunden. På LTH introduceras kvantmekaniken och dess användningar i nanoteknologin redan första året i utbildningen, vilket gör att du kommer i kontakt med avancerad fysik från första början. Exempel på världsledande forskningsområden i Lund är bland annat atomfysik, där man kan studera hur laserljus utbreder sig i biologisk vävnad eller i en brinnande låga, eller reglerteknik som är avgörande för hur autopiloten i flygplan och båtar fungerar. Årskurs Fysik: Vågor och kvantfenomen : Grundläggande analys och linjär algebra Teknik: Mekanik och programmering Jag var övertygad om att det här med att bli civilingenjör inte var något för mig. Civilingenjörer var ju män i kostym och med portfölj, och jag ville jobba på fält i Afrika. Men så fick jag ett ryck och sökte ändå till teknisk fysik. Och tänk, jag blev ingen man i kostym utan min studietid blev min biljett till Afrika. Jag gjorde mitt examensarbete i Uganda om elektrifiering av landsbygden. Mina studier i fysik gjorde det lätt för mig att ta till mig ny kunskap om elkraftsystem och kurserna matematisk statisk var grunden till den modellering som jag gjorde av mina uppmätta data. Mina fyra månader i Uganda blev en av de bästa upplevelserna i mitt liv och förhoppningsvis har jag också kunnat bidra med ny kunskap för det lokala elbolaget och andra som arbetar med att elektrifiera den afrikanska landsbygden. Jag har satsat på att doktorera inom Energi och Miljö men valde att fokusera på energianvändning i Sverige i stället och hur man kan effektivisera denna för att minska klimatpåverkan. Aron Wahlberg student Jag valde att läsa till civilingenjör i teknisk fysik för att jag alltid har gillat matte, teknik och fysik. Samtidigt är det en väldigt bred utbildning som lämnar många dörrar öppna för framtida vägval. Man får under utbildningen insikter i så många olika tekniska områden. På samma gång har man senare i utbildningen jättebra möjligheter att riktigt spetsa in sig på ett specialområde. Jag gillar dessutom att utbildningen är mycket teoretisk samtidigt som det finns många tillämpningsområden. LTH ligger i Lund, en fantastisk studentstad! Här finns allt man behöver; massor av roligt att göra, för alla smaker och intressen. Som teknisk högskola upplever jag LTH som flexibelt för studenterna; här finns utrymme för studenterna att ändra riktning t ex. Möjligheter till utlandsstudier är ett annat exempel på det som jag själv haft stor, stor glädje utav. Dan Hessman universitetslektor Våra studenter ska tycka att det är kul med matematik och fysik. Vi arbetar mycket med teoretiska modeller för att förklara och förstå verkligheten. Teknisk fysik är ingen renodlad yrkesutbildning och F:are hamnar i praktiken överallt i yrkeslivet. Fler än på andra program går vidare till forskning. Jag var med och utvecklade kursen Kvantfenomen och nanoteknologi, som studenterna läser vid slutet av första året. Syftet är att lyfta fram den moderna fysiken tidigare under programmet än man gjorde förr. Med exempel från nanoteknik kan vi introducera kvantfysiken redan efter ett års mattestudier. Tyngdpunkten i kursen ligger på förståelse och därför har vi mycket gruppdiskussioner i samband med laborationerna. Upplägget har blivit uppskattat och ibland får vi höra: Nu känner jag verkligen att jag valt rätt! 1 Årskurs Årskurs 3 Årskurs 4 & 5 Fysik: Energi och termodynamik, fasta material, vektoranalys : Komplex analys, systemteori, partiella differentialekvationer Teknik : Mekanik, hållfasthetslära, elektronik och mätteknik Fysik: Kvantteori, atom- och kärnfysik : Sannolikhetslära och statistik, vetenskapliga beräkningar Teknik: Elektromagnetiska fält, reglerteknik, beräkningsteknik, ekonomi, hållbar utveckling Specialiseringar inom t ex: Atomär och subatomär fysik Reglersystem och sensorer Nanofysik och elektronik Stokastisk och finansiell modellering Tillämpad matematik och bildmodellering Medicinsk teknik Valfria kurser Utbildningen Under de tre första åren läser du 18 högskolepoäng obligatoriska kurser som lägger grunden för resten av utbildningen. Ämnena kan grovt delas upp i fysik, matematik och teknikämnen, där den sista kategorin innehåller sådant som programmering, mekanik, hållfasthetslära, reglerteknik, elektronik, elektromagnetiska fält, ekonomi och hållbar utveckling. Efter det obligatoriska blocket finns ett stort urval av valfria kurser att välja mellan. Här kan du fortsätta att bredda dig med kurser i till exempel medicinsk teknik, språk och ekonomi, och du har möjlighet att ta med kurser motsvarande 15 högskolepoäng från Lunds universitets övriga fakulteter (juridik, humaniora, medicin, samhällsvetenskap). Genom de valfria kurserna ska du också välja en specialisering inom ett teknikområde som du själv väljer, där LTH har väl underbyggd forskning inom i princip alla ämnen. Många väljer att tillbringa sitt fjärde år utomlands genom ett av universitetets många utbytesprogram. Utbildningen avslutas med ett examensarbete på ungefär en termin, där du får praktisera de kunskaper du fått i kurserna genom att lösa ett stort och avancerat problem, ofta i samarbete med industrin. Specialiseringar Teknisk fysik är en mycket bred utbildning, vilket avspeglas i att du har ett stort urval (tio stycken!) av specialiseringar att välja bland, samtidigt som du har möjlighet att anpassa dessa till dina individuella intressen. Specialiseringarna har lite olika tyngdpunkt på ämnesgrupperna fysik, matematik och teknik, och kan grupperas enligt följande (detaljerad information om de tio olika specialiseringarna finns på programmets hemsida, se ovan): Fysik: Atomär och subatomär fysik, Fotonik, Nanofysik och elektronik, Teoretisk fysik Här får du en fördjupad förståelse av naturens innersta väsen och dess betydelse för vårt samhälle och näringsliv. Du får teoretisk och experimentell insikt i aktuella och framtida teknik- och vetenskapsområden, och lär dig utnyttja dessa i nya tillämpningar. Du kan komma att jobba med att utveckla nya och effektivare energikällor som solceller, integrera kamerasystem i mobiltelefoner, eller genomföra miljömätningar. : Stokastisk och finansiell modellering, Tillämpad matematik och bildmodellering, Teknisk-vetenskapliga beräkningar och programmering Med dessa specialiseringar får du en djup analytisk förmåga och lär dig använda kraftfulla matematiska verktyg, där du använder dator och programmering som naturliga hjälpmedel. Du får en fördjupad förståelse för modellering och simulering, och kan komma att jobba med analys av signaler och bilder inom teknik och medicin såväl som analyser av finansmarknaden. Teknik: Förbränning och strömning, Medicinsk teknik, Reglersystem och sensorer Här får du modellera komplexa system som kräver både fysikalisk och matematisk insikt. Du får gå på djupet med tvärvetenskapliga ingenjörsproblem, som kan leda till såväl avancerade teoretiska modeller som praktiska tillämpningar och produkter. Du kan komma att jobba med att förbättra förbränningsprocesser, utveckla rehabiliteringshjälpmedel och medicinska sensorer, eller reglersystem för stabilisering av flygplan. För samtliga specialiseringar gäller att du kommer i kontakt med starka forskningsmiljöer (vissa är världsledande), och har mycket goda förutsättningar att gå vidare med forskning inom högskolan eller utvecklingsarbete inom industrin. Framtiden Civilingenjörer i teknisk fysik har en oerhört bred arbetsmarknad. En gemensam nämnare är deras allmänna förmåga att snabbt sätta sig in i nya, ofta tvärvetenskapliga, problemställningar och använda kunskaper och insikter från många områden för att lösa dem. En stor del arbetar därför med forskningsoch utvecklingsarbete, både inom företag och universitet. Det är också vanligt att tekniska fysiker arbetar som entreprenörer i egna företag. Teknologie kandidatexamen Civilingenjör Mastersexamen

8 / Civilingenjörsutbildning / Lund Teknisk matematik > Master of Science in Engineering, Engineering Mathematics > > Teknisk matematik 3 hp 5 år Caroline Lundqvist trainee, Vattenfall En stor fördel med Teknisk är att man börjar med mycket matte och sedan läser kurser i allt från mekanik till ekonomi och biologi innan det är dags att välja specialisering. Detta innebär att det enda du behöver vara säker på för att ansöka är att du gillar matte, sedan är det gott om tid att välja bland de olika inriktningarna. Mitt föll på finans, vilket är ett relativt nytt och väldigt spännande område. Tack vare LTH:s breda samarbete med en rad utländska universitet fick jag även möjligheten att läsa ett år i Tyskland. Idag är jag anställd på Vattenfall Sales Nordic och deltar i Vattenfall International Trainee Programme. Detta innebär stor variation i arbetsuppgifter under de kommande 1 månaderna då jag har det unika tillfället att gå runt på olika enheter och på så sätt få en bra inblick i hela organisationen. Dessutom innehåller programmet två perioder av utlandsstationering samt seminarieveckor med hela traineegruppen i bland annat teambuilding och ledarskap. Min uppgift i hemorganisationen är att analysera risker i samband med prissättning av elkontrakt, i syfte att kunna sätta mer konkurrenskraftiga priser. Här kommer mina finansmattestudier till god användning tillsammans med det analytiska tänket som präglar LTHs utbildningar. Varför söka till Teknisk matematik vid LTH? Du är intresserad av matematik och vill läsa mer matematik än på andra civilingenjörsprogram. Du får en bred bas av tillämpningsämnen som du kan använda matematik på. Detta ger stora valmöjligheter i arbetslivet. Du får en specialistkompetens som matematiker inom något teknikområde. Du utvecklar din problemlösningsförmåga och din förmåga att arbeta matematiskt med många olika typer av problem, även sådana som från början inte är formulerade i matematiska termer. Hanifeh Khayyeri doktorand på Trinity College, Dublin Årskurs För mig är min utbildning på LTH ovärderlig och som civilingenjör i teknisk matematik är man mycket eftertraktad och imponerande på arbetsmarknaden. Utbildningens bredd har gett mig möjligheten att få arbete inom ett varierat fält och färdigheten att snabbt kunna sätta mig in i nya uppgifter. Idag doktorerar jag på Trinity College i Dublin inom vävnadsteknik. I min forskning studerar jag hur man med hjälp av ett mekaniskt stimuli kan uppmuntra stamceller till att bilda en önskad vävnad, till exempel ben. Att förstå sådana processer är väsentligt för analys av exempelvis läkning av benbrott och broskskador, kardiovaskulära fel och vid tillverkning av kirurgiska implantat. Inom mitt fält beskrivs biologiska processer med hjälp av matematiska modeller och för att beräkna de mekaniska laster som cellerna utsätts för tillämpas matematiska beräkningsmetoder. Området är till hög grad multidisciplinärt och jag har stor nytta av min civilingenjörsutbildning då jag behöver tillämpa såväl matematik som hållfasthetslära, termodynamik och mekanik på biologi. Jacob Gumpert student På LTH har jag för första gången känt mig totalt självständig, både inom studier och som individ. Där finns en otrolig gemenskap och öppenhet bland studenterna. Här märks också att kunskap är viktigt, varje läsår ger otroliga insikter. Som student på teknisk matematik har jag glädjen att få se både det djupt teoretiska inom ämnet, samtidigt som de olika inriktningarna ger mig möjligheten att möta det breda tekniska kunnandet. Eftersom vi lär oss matematiken för att ha den som ett verktyg, känner man sig väl förberedd inför nästan alla akademiska utmaningar. Men samtidigt ingår den matematiska allmänbildning som behövs för att kunna kalla sig matematiker. Jag vet inte varför jag valde att utbilda mig till civilingenjör. Jag visste att det var en bra utbildning, men jag kände mig osäker om det skulle passa mig. Jag valde att testa. Det är nog bland de bästa valen jag gjort. Jag trivs mycket bra. Karl Åström professor Detta är ett program för dem som tycker om matematik och som vill se hur den kan användas på många olika sätt. en har blivit allt viktigare inom nya områden som biologi, kemi och finans. Samspelet mellan matematik och andra ämnen belyses t ex genom kurserna i matematisk modellering och matematisk kommunikation. Programmet startade vid LTH (först i landet) och det har visat sig finnas en stor grupp kreativa studenter som är intresserade av detta. Vi har också fått en större spridning från hela landet och en stor andel tjejer. Problemlösning och arbete i grupp präglar utbildningen, där vi också lagt vikt vid presentationsteknik, muntligt och skriftligt. Avslutande inriktningar mot biologi, finans, beräkningar/simulering, miljö och systemanalys ges genom ett samarbete inom hela universitetet. 1 Årskurs Årskurs 3 Årskurs 4 & 5 Matematisk mod. Matematisk Statistik Matematisk mod. Numerisk analys Specialiseringar inom: Beräkning och simulering Biologisk och medicinsk modellering Finansiell modellering Miljö, risk och klimat Signaler, bilder och system Utbildningen är teknikens och vetenskapens språk och har alltid varit ett kärnämne för en civilingenjör. Den snabba datorutvecklingen gör att matematiken i dag blivit än viktigare, t ex för att effektivt analysera information och göra simuleringar. genomsyrar vardagslivet, ofta utan att man tänker på det, med allt från Google och väderprognoser till prissättning av optioner på börsen. Det finns idag många nya områden, t ex inom bioinformatik, IT, medicin och ekonomi, där det behövs avancerad matematik som ofta ännu inte är färdigutvecklad. Under de första sex terminerna byggs stommen för utbildningen. Redan från första terminen läser du mycket matematiska ämnen och de fortsatta studierna bygger på detta. Centrala är också datavetenskap och systemvetenskaper. Därutöver får du en bred bas av ämnen inom teknik, naturvetenskap och ekonomi där matematik kan användas. Det är på detta växelspel som programmets motto syftar: som teknologi. Naturligtvis kan man även fördjupa sig ytterligare i matematisk teori. Specialiseringar Specialiseringarna inom Teknisk matematik är var för sig mycket breda, och tillsammans täcker de (nästan) all sorts ingenjörskonst där analys och simuleringar har betydelse. Varje specialisering hålls samman av i stora stycken gemen- sam matematik. Detta hjälper till att skapa bra överblick över breda fält, vilket också är en viktig specialistkompetens för en teknisk matematiker. Beräkning och simulering Här byggs en bred bas av generella verktyg för modellering och beräkning för komplexa system och fenomen i naturen och industrin. Specialiseringen skapar möjlighet att från den matematisk-beräkningstekniska sidan profilera sig inom ett brett fält av teknikområden t ex elektroteknik, maskinteknik, mekanik, kemi, strömning, fysik, byggnadsteknik. Biologisk och medicinsk modellering Inom denna specialisering sysslar man med matematisk modellering, simulering och beräkning inom biovetenskaperna, av intresse för bl a läkemedels- och medicinsk industri samt sjukvård. Ett aktuellt område är bioinformatik, där det idag finns ett stort behov av nya matematiska metoder för att söka och känna igen mönster i stora informationsmängder, t ex databaser av gener. Finansiell modellering Matematiska och statistiska modeller och metoder spelar en allt viktigare roll inom ekonomisk verksamhet vid t ex banker och försäkringsbolag. Inom denna specialisering byggs en bred bas inom ekonomiska områden åtkomliga för kvantitativ modellering och analys. Miljö, risk och klimat Risker i tekniska system har sedan lång tid varit ett fält där matematik och statistik kommit till stor användning. Specialiseringen mot risk, miljö och klimat breddar verksamhetsfältet till några andra områden där matematisk modellering och analys blivit viktiga verktyg. Bildtolkning i fjärranalys, extremvärden i klimatmodeller och simulering av biologiska system är några exempel. Signaler, bilder och system I denna specialisering byggs en bred bas av matematiskt-systemvetenskapliga verktyg och teori. Dessa har breda användningsområden inom system uppträdande inom industri och forskning, och har kontaktytor även mot de andra specialiseringarna inom Teknisk matematik. Framtiden Som civilingenjör i Teknisk matematik är du eftertraktad på arbetsmarknaden och kan få intressanta jobb över ett brett fält av arbetsgivare och branscher. Du kan se fram emot ett omväxlande arbete där du utvecklar eller forskar kring avancerade tekniska produkter, system och teori. De tekniska problemområdena kommer att skifta under din yrkeskarriär men den breda träning i matematiska arbetssätt som utbildningen ger dig kommer att göra dig varaktigt attraktiv på arbetsmarknaden. Många kommer att arbeta i team där de bidrar med matematisk specialistkunskap bland specialister inom andra områden. För detta är du väl förberedd genom utbildningens bredd och den träning i kommunikation och modellering som du fått. Matematisk modellering Programmering Fysik och Mekanik Ekonomi Programmering Reglerteknik Teknologie kandidatexamen Programmering Elektroteknik Signalbehandling Biologi och Hållbar utveckling Civilingenjör Valfria kurser Mastersexamen Björn Carlin mjukvaruingenjör, Google, Schweiz Jag tyckte Lund verkade vara en spännande studentstad och lockades av det rika nationslivet. Dessutom tyckte jag det lät intressant att läsa Teknisk matematik som startade samma år. Det var heller inte fel att ha möjligheten att läsa en del av kurser på de icke-tekniska fakulteterna, eftersom LTH är del av Lunds universitet. Jag har länge varit intresserad av matematik, och tyckte om att kunna fördjupa mig i det. Det var förstås så att vissa kurser var mer minnesvärda än andra, men valfriheten var stor och framförallt mot slutet av utbildningen fanns det möjlighet att fördjupa sig i vad man själv ville. Nu arbetar jag som mjukvaruingenjör på Google i Zürich, Schweiz. Jag jobbar med att utveckla mjukvara för att vi ska få ut mesta möjliga nytta av det nätverk vi har mellan våra datacenter runt om i världen. Den enorma skalan på nätverket gör att nya problem uppstår och ofta kräver kreativa tekniska lösningar.

9 / Civilingenjörsutbildning / Lund Teknisk nanovetenskap > Master of Science in Engineering, Engineering Nanoscience > > Teknisk nanovetenskap 3 hp 5 år Sania Ibragimova doktorand vid Aquaporin/ Danmarks Tekniske Universitet Mitt första besök i Lund lämnade intryck av en mysig välkomnande stad. Dessa första intryck gjorde mig positiv till att plugga i Lund. Men beslutet grundades naturligtvis mer på att jag hittade flera attraktiva utbildningar i Lund, att Lunds universitet har ett rykte som ett av Sveriges främsta universitet och att Lund är en studentstad, präglad av studentlivet. För mig har utbildningen präglats av väldigt engagerade lärare, tvärvetenskaplighet och en nära anknytning till spjutspetsforskning. Lärarna som man träffar är framstående forskare inom sina områden och de har inspirerat mig! Nanovetenskapen är verkligen cool! Det är vi som kommer att introducera smart materials och nanorobotar. Jag är industriell doktorand på Aquaporin och Danmarks Tekniske Universitet. Företaget utvecklar ett vattenfiltreringsmembran som använder naturens egna vattenfilter aquaporiner och ska ge 1 % rent vatten. Min forskning är inriktad på stabilisering och skydd av membranet och är en del av ett europeiskt forskningsprojekt som ska ta fram framtidens renaste vatten. Varför söka till Teknisk nanovetenskap vid LTH? Den enda utbildningen i Sverige som ger både en civilingenjörs- och en mastersexamen i Teknisk nanoveten skap. En utbildning för dig som är intresserad av biologi, medicin och fysik och vill tillämpa nanoteknik för att skapa framtidens material eller elektronik. Genom ett tvärvetenskapligt samarbete inom Lunds universitet får du ett helhetsperspektiv på nanoteknik, där specialkomponerade kurser i biologi, biokemi och medicin bidrar till att bredda din utbildning. Veronica Karlsson forskningsingenjör Bonesupport AB, Lund Årskurs Nanovetenskap: Introduktion Fysik: Termodynamik, våglära, optik och atomfysik Kemi: Allmän, oorganisk och organisk kemi Teknik: Programmering : Endimensionell analys och linjär algebra Jag gillade den problemlösningsinriktade inlärningen och den röda tråd som löpte genom hela utbildningen. Jag använder dagligen flera av alla de verktyg, för att angripa och lösa problem av helt olika karaktär, som jag fått med mig från mina år på LTH. Lärarna på LTH är generellt väldigt engagerade i både sina ämnesområden och sina studenters utveckling. Många av dem arbetar dessutom med världsledande forskning inom olika ämnesområden. Det är en häftig känsla att få höra en föreläsare berätta om sin forskning ena dagen och sedan kunna läsa en artikel om samma persons framsteg i Ny Teknik nästa dag. Nu är jag anställd som forskningsingenjör på Bonesupport AB, ett medicinsk-tekniskt företag på Ideon i Lund. Här arbetar jag med att utveckla injicerbart syntetiskt benmaterial. Mina arbetsuppgifter är ganska varierande och jag jobbar både praktiskt i labbet och teoretiskt med att analysera data och läsa artiklar för att planera den fortsatta utvecklingen. Mårten Werner trainee, Verdispar Så här i backspegeln tycker jag att utbildningen har gett mig väldigt värdefulla kunskaper. Just bredden, blandningen av olika naturvetenskapliga discipliner, har bidragit till att utveckla mitt analytiska tänkande och närt min naturliga nyfikenhet. Men resan fram till examen har varit krokig eftersom mina intressen svängt under utbildningens gång, från kemi till ekonomi, tillbaka till kemi... När det blev dags för exjobb så ville jag slå två flugor i en smäll och göra det utomlands. Efter mycket planerande och fixande åkte jag till Singapore och gjorde där ett examensarbete inom drug delivery, som kunde knytas till ämnet materialkemi här på nanoutbildningen. Efter min examen har jag nu i vintras börjat som trainee i Stockholm på en norsk fondkommissionsfirma. Här får jag nytta av den träning i analytiskt tänkande som utbildningen i teknisk nanovetenskap gett mig. Jag har dessutom specialkompetens för att göra bedömningar av tekniska, särskilt nanovetenskapliga branscher. Johan Andersson universitetslektor Jag är biolog och forskar om människans anpassning till olika miljöer, särskilt när det gäller syreupptagning. I nanoprogrammet är jag ansvarig för grundkursen i människans fysiologi och jag undervisar också i mer avancerade, valbara kurser för dem som väljer inriktningen nanobiomedicin. Fysiologin är en grundläggande vetenskap som är nödvändig om man t ex vill förstå hur läkemedel tas upp och fungerar. Vi studerar allt från den subcellulära nivån till hela organismen, via enskilda celler, vävnader och organ, ofta i laborationer. Teknik, biologi och läkemedel kopplas samman i det här programmet. Nanotekniken kan också ha som mål att koppla samman skadade nerver, skapa sensorer för t ex lab på chip eller finna metoder att kopiera kroppens sinnen. Nanostudenterna är mycket roliga att undervisa. De kan mycket matematik och är diskussionsvilliga. Det gör att jag som lärare måste vara väl förberedd. 1 Årskurs Årskurs 3 Årskurs 4 & 5 Biologi: Cellens biologi Fysik: Kvantfenomen och nanoteknologi Medicin: Människans fysiologi Material: Elektroniska material, Funktionella material Ellära och elektronik : Flerdimensionell analys, Tillämpad matematik Nanovetenskap: Analys på nanoskalan, Komponent-teknologi, Projekt nanoingenjör : Statistik Teknik: Reglerteknik, Sensorer Hållbar utveckling med nanoperspektiv Alternativobli. kurser Specialiseringar inom t ex: Nanobiomedicin, Nanomaterial, Nanofysik, Nanoelektronik Valfria kurser Utbildningen Som enda tekniska högskola i landet startade LTH 3 ett utbildningsprogram som idag ger både en civilingenjörs- och en mastersexamen i Teknisk nanoveten skap. Genom tvärvetenskapligt samarbete inom Lunds universitet erbjuder vi ett helhets perspektiv på nanoteknik, där specialkomponerade kurser i biologi, biokemi och medicin bidrar till att bredda den grund som fysik, matematik och kemi ger. Inom de fem åren får du studera både teori och lära dig använda tekniker inom na notekno login. Efter tre år får du skapa dig en profil mot yrkesrollen som nano vetare inom en av fyra specialiseringar. Målet med utbildningen är att utbilda civilingenjörer som känner sig tilltalade av att sudda ut gränserna mellan traditionella kunskapsområden som medicin, biologi, fy sik, kemi, materialvetenskap och elektronik. Redan från dag ett återspeglas denna tvärvetenskapliga karaktär i utbildningen. Det betyder att utbildningen i teknisk na novetenskap attraherar motiverade studenter med en mycket bred intressesfär. Specialiseringar På Teknisk nanovetenskap kan du välja att specialisera dig inom någon av våra fyra specialiseringar: Nanobiomedicin, Sam Madjidian student nanomaterial, nanoelektronik eller nanofysik. Speciali seringarna ger spetsen i utbildningen efter de inledande tre årens breda grund block. Oavsett vilken av specialiseringarna du väljer kan din framtida arbets marknad komma att vara både industrin och akademin. Väljer du nanobiomedicin kan du välja att förbereda dig för jobb inom t ex läke medelsindustrin. Du kan också komma att arbeta med utveckling av andra typer av medicinska produkter eller material för medicinska ändamål. Nanobiomedicin grän sar alltså till specialiseringen inom nanomaterial. Har du valt denna, är det möjligt att du t ex hamnar inom industri som utvecklar starkare och lättare material för allt från tennisracket till flygplan. En specialisering inom nanoelektronik kan leda till att du får arbeta med utveckling av elektronik för nästa generations datorer; kompo nenter designade för hög hastighet och låg energikonsumtion. Nanofysik specia liseringen är bred och kan leda till arbete inom allt från grundläggande halvledarfysik till mer teoretisk modellering av nanostrukturer. Men om du vill kan du kombinera fysiken med biologin även i din specialisering och på så sätt komma att arbeta med något så spännande som nanobiomekanik! Framtiden Nanotekniken har identifierats som ett nyckelområde för svensk industris framtid. Det finns redan åtskilliga exempel på nanoteknik inom dagens industri, och i vissa fall är det först på senare tid man uppmärksammat att det man sysslat med i många år faktiskt är nanoteknik. Till exempel används nanopartiklar i slitstarka däck, i må lar färg och cement, som UV-filter i solkräm och, vilket är det äldsta exemplet av alla, för att färga glas. Nanostrukturerade ytor som inte repas har börjat dyka upp i stek pannor, liksom nanodesignade trådar i byxor på vilka inte ens ketchup fastnar. Efter examen kan du se fram emot ett omväxlande arbete där du, ofta i en inter na tionell miljö, arbetar med att utveckla forskningsnära, avancerade tekniska pro duk ter, system och metoder inom biologi, medicin, fysik, kemi, elektronik eller mate rial vetenskap. Du kan t ex komma att arbeta som specialist eller forskare i ett fö retag inom biomedicin, informationsteknik eller materialteknik. Du kan välja att arbeta med forskning och undervisning vid ett svenskt eller utländskt universitet, be driva konsultverksamhet eller kanske vara med om att starta ett eget innovations företag. Du kommer med din tvärvetenskapliga utbildning att vara attraktiv på ar betsmarknaden! Det bästa med LTH är den tunga kompetensen som finns här. Det bedrivs mycket spetsforskning på LTH och att man som student får ta del av det absolut senaste inom ens intresseområden är väldigt inspirerande. För min del är har det bästa med utbildningen varit dess tvärvetenskapliga utformning då jag är intresserad av medicin, kemi, fysik och det mesta däromkring. Jag valde att utbilda mig till civilingenjör eftersom jag är en nyfiken person som tycker om naturvetenskap och teknik. Teknologie kandidatexamen Civilingenjör Mastersexamen

10 / Civilingenjörsutbildning / Lund 18 1 Elektroteknik > Master of Science in Engineering, Electrical Engineering > > Elektroteknik 3 hp 5 år Charlotte Klippel selektivplaneingenjör, E.ON Elnät Elektroteknikutbildningen har förberett mig mycket bra inför arbetslivet. Under själva utbildningen gav grundkurserna mig en varierad och bra bredd så att jag sedan kunde välja det djup som jag var mest intresserad av. Jag valde att läsa industriella styrsystem (automation och elkraft) som djup och i mina valfria poäng valde jag att läsa ett par ekonomikurser. Efter min examen 5 började jag arbeta på E.ON Elnät. Där arbetar jag huvudsakligen med att se till att fel i elnätet kopplas bort på ett korrekt sätt utan att människor blir skadade och att så få kunder som möjligt blir strömlösa. Det innebär bland annat att jag gör en hel del beräkningar och utredningar. I nuläget görs mycket nybyggnationer och förändringar i elnätet dels på grund av att vi kablar mycket som en följd efter stormen Gudrun och dels för att regeringen har bestämt att det ska satsas på vindkraft. Så det finns många nya intressanta utmaningar framför oss. Varför söka till Elektroteknik vid LTH? Elektroteknik är eftertraktad kunskap! Efter utbildningen kan du vara med att påverka framtidens teknik inom t ex miljö, energi, medicin, underhållning och kommunikation. Fantastisk arbetsmarknad! Det är stor brist på civilingenjörer i Elektroteknik. En teoretisk utbildning i kombination med mycket laborationer och projekt. Stor valfrihet inom utbildningen! Hela 1 olika specialiseringar, som är starkt knutna till forskargrupper som flera bedriver världsledande forskning inom t ex regler teknik, nanoelektronik, medicinsk teknik och kommunikation. Magnus Särnqvist utvecklingsingenjör, Svep Design Center AB Årskurs Elektronik Programmering Fysik Jag läste ett allmänt tekniskt program på gymnasiet och tyckte att elektroniken var det som verkade mest spännande och valde därför att söka ingenjörsutbildningar. Eftersom jag ville uppleva studentlivet och ändå få en bra utbildning så var Lund det självklara första valet. Det finns gott om varierande inriktningar att välja på inom programmet och jag valde att läsa elektronikkonstruktion. Idag jobbar jag som utvecklingsingenjör inom elektronik med hårdvara och hårdvarunära programmering. Arbetet består av VHDL-programmering på programmerbar logik, schematiska lösningar och kretskortsdesign. Arbetet innefattar alla områden där elektronik är inblandat t ex mobiltelefoner, datorer, ljudsystem, sensorsystem för industrirobotar, medicinska mätinstrument m m. Jag tycket att det bästa med mitt jobb är blandningen mellan praktiskt och teoretiskt arbete. En dag sitter jag framför datorn och programmerar och nästa sitter jag och testar applikationer praktiskt i t ex trådlös bildöverföring. Johan Nilsson universitetslektor Elektroteknik innebär för mig en spännande kombination av hårdvara och mjukvara och möjlighet att kombinera intressen inom fysik och elektronik. Elektrotekniken behövs överallt i dagens samhälle och är så till vida en bred och generell utbildning med många val av inriktningar. Inte minst är elektrotekniken är en förutsättning för den som vill utveckla energieffektiva och miljövänliga system. Jag handleder en del studenter på den inledande kursen i Elektroteknik, ansvarar för en obligatorisk kurs i tredje årskursen och håller i några avancerade kurser bl a i mikrofluidik. Idag finns elektrotekniken överallt och verkar ha blivit självklar. Men det finns ju så mycket kvar att göra, inte minst för dem som liksom mig är intresserade av medicinsk teknik. Sead Smailagic student Jag tycker att det bästa med utbildningen är att man äntligen får nytta av den där matten. Där matematik används för att formulera och lösa problem i verkligheten. Sen finns det en hel del praktiska tillfällen i form av labbar och olika projekt, som jag finner otroligt nyttiga. Dessutom så har Elektroteknik ett brett kursutbud vilket gör att valet av inriktning och profilering är i det närmaste obegränsad, allt ifrån ren programmering till analog IC- design. Jag kände en stark vilja att plugga något tekniskt och förhoppningsvis kunna kombinera det med min största hobby, som är musik och ljud- design i allmänhet, så Elektroteknik lät lockande. Nu när det väl närmar sig slutet hoppas jag att utbildningen skall i första hand leda till ett bra och stimulerande jobb, sen att civilingenjörer är i regel välbetalda gör inte saken sämre. Energi och miljö Arbetet för en hållbar utveckling innehåller många högteknologiska utmaningar och kräver ingenjörer med djupa kunskaper om energi, speciellt elenergi, med förwww.elektro.lth.se 1 Årskurs Årskurs 3 Årskurs 4 & 5 Analog elektronik Digital och datorteknik Komponentfysik Fysik Ekonomi Programmering Teknologie kandidatexamen Elektromag. fältteori Mätteknik Elenergiteknik Reglerteknik Digital signalbehandling Datorkom munikation Projektkurs Ingenjörsmässig analys Civilingenjör Specialiseringar inom t ex: Bilder och grafik, Design av processorer & system på chips, Energi och miljö, Kommunikationssystem, Medicinsk teknik, Produktionsekonomi & entreprenörskap, Programvara i system, Reglerteknik och automation, Radio och nanoelektronik, Signaler och sensorer Valfria kurser Mastersexamen Utbildningen Elektroteknik är den del av fysikämnet som i någon form handlar om elektricitet. Det kan röra sig om allt från de minsta elektroniska komponenterna i datorer och mobiltelefoner till generering och användning av elkraft. Du får en stark teoretisk grund av matematik och fysik och samtidigt en god träning i att konstruera, mäta och programmera. I de obligatoriska kurserna får du bl a lära dig att konstruera oscillatorer, filter och förstärkare. Du lär dig mäta, behandla och överföra signaler i olika former och blir duktig på att programmera och att använda simulerings verktyg. Efter grundblocket har du ett stort urval av forskningsnära inriktningar att välja bland. Specialiseringar Bilder och grafik Bilder och grafik är en snabbt växande teknik för kommunikation mellan människor och datorer som t ex låter oss umgås i Second Life och andra interaktiva 3D-världar på Internet. Design av processorer och system på chips Här får du lära dig att konstruera både digitala och analoga system genom att använda avancerad kiselteknologi där miljarder transistorer tillsammans bygger upp ett system på ett enda chip. ståelse för energisystems miljöpåverkan. Kommunikationssystem Här behandlas flera olika aspekter på fungerande kommunikation, allt från nätens arkitektur och uppbyggnad till de elektromagnetiska vågornas egenskaper inom systemen, t ex internet, datanät, mobil kommunikation och WLAN. Medicinsk teknik Den här specialiseringen ger en stark kunskapsgrund för den som i framtiden vill arbeta på företag inom medicinsk teknik, som sjukhusingenjör eller med forskning inom medicinsk teknik. Produktionsekonomi och entreprenörskap Omvärldens förändringstakt och komplexitet ökar vilket ställer höga krav på att civilingenjörer måste utveckla en förmåga till att kombinera sitt djupa tekniska kunnande med den affärsmässiga utmaningen. Programvara i system Nästan alla elektrotekniska system styrs av datorer med tillhörande programvara. En elektroingenjör med specialkompetens inom programmering och utveckling av stora programsystem är mycket eftertraktad på arbetsmarknaden. Radio och nanoelektronik För att kunna överföra allt större datamängder så krävs mer bandbredd och effektivare nyttjande av frekvensspektrumet. Storleken på traditionella komponenter blir mindre och mindre, men hur små transistorer kan vi tillverka? Mats Lindhoff forsknings- och teknologichef,sony Ericsson Reglerteknik och automation Återkoppling och framkoppling av system, har universell tillämpbarhet och har lett till att reglerteknik och automation är en viktig ingrediens i t ex CD-spelare, elektronik, kommunikationsnätverk, fordon, samt inom tillverknings- och processindustrin. Signaler och sensorer Denna specialisering handlar om att kunna mäta olika fysikaliska storheter på bästa sätt och hur den uppmätta signalen kan behandlas för att önskad information ska kunna utvinnas. Tillämpningar finns inom många olika områden som bl a innefattar kommunikation, medicin och biologi. Kinainriktning Programmet erbjuder även en särskild Kinainriktning. Se sid 4 eller se/kinainriktningen Framtiden En civilingenjörsutbildning i elektroteknik ger dig nyckeln till det högteknologiska samhället. I arbetslivet kommer du att arbeta tillsammans med många andra yrkesgrupper, tjäna bra och få stora möjligheter att resa mycket eller arbeta utomlands. Vissa E-civilingenjörer blir tekniska specialister, andra gör chefskarriär och några stannar kvar inom universitetet för att forska. Många företags ledare är just nu mycket oroliga för att det inte utbildas tillräckligt många ingenjörer inom detta teknikområde. Det finns behov av både de som vill jobba väldigt tekniknära och de som är duktiga på att planera och se tekniken i ett vidare perspektiv. I mitt examensarbete vid LTH var jag 185 med och utvecklade Ericssons första ficktelefon, NMT, som jag sedan som anställd fick industrialisera. Sedan har det fortsatt med GSM-telefoner, uppbyggnad av ett nytt labb i USA och nu sitter jag och funderar på sådant som när vi ska ha TV i telefonerna. Mitt jobb nu är att titta tre-fyra år fram i tiden, hur ser mobiltelefonerna ut 1? Utbildningen på LTH gav mig en fantastisk bas med naturvetenskap och matematik men sedan måste man alltid förkovra sig i fackkunskaperna. Just nu ser framtiden ljus ut. De som är intresserade av att jobba utomlands bör söka jobb på något av Sveriges internationella företag, varför inte Sony Ericsson?

11 / Civilingenjörsutbildning / Lund 1 Datateknik > Master of Science in Engineering, Computer Science and Engineering > > Datateknik 3 hp 5 år Mikael Tellhe Technical Director,TAT, USA Det som var bra med LTH är att kurserna i allmänhet håller hög standard vad gäller innehåll. Det är också väldigt bra att man får möjlighet att studera utomlands som utbytesstudent. Jag fick möjlighet att läsa en termin på University of Waterloo i Kanada och det gjorde definitivt att jag fick blodad tand för att jobba utomlands. Efter examen startade jag ett företag, The Astonishing Tribe, tillsammans med 5 kompisar (4 andra LTHare). Vi arbetar med teknik och design för användargränssnitt i mobiltelefoner, dvs de menyer och knappar som finns på mobilskärmen. Nu har det gått 5 år och idag jobbar ca 1 personer på företaget, vi har kontor i Malmö, Göteborg, Suwon (Syd Korea) och San Diego (USA). Jag bor nu i San Diego och jobbar med forskning och utveckling, fortfarande för vårt företag. Linda Gunnäng Development Engineer, Ericsson AB Varför söka till Datateknik vid LTH? För dig som vill vara med och utveckla de system av program och hårdvara som alla människor kommer att använda i framtiden. Du får en bredd i din utbildning på LTH som gör att du som civilingenjör i datateknik kan arbeta inom många områden och därmed har stor valfrihet i ditt yrkesval. Inom LTH finns forskning på internationellt sett mycket hög nivå inom många datateknikrelaterade områden som t ex, programvaruutveckling, datasäkerhet, telekommunikation, reglerteknik och signalbehandling. Detta garanterar kvalitet och relevans i undervisningen. Jag har alltid varit teknisk intresserad och då jag efter gymnasiet inte var övertygad om vad jag ville jobba med i framtiden ville jag välja en bred utbildning. Någon form av ingenjörutbildning föll sig då naturligt, även om jag på gymnasiet läst natur-natur och inte teknisk inriktning. Att det blev datateknik var lite av en slump. Jag tyckte datorer var intressant men hade aldrig kommit i kontakt med programmering av något slag. Det var därför mest av nyfikenhet som jag valde att ge mig på en datateknikutbildning. Jag tänkte att detta skulle vara kul att kunna! Idag jobbar jag på Ericsson AB i Lund och har i höst varit här i tre år. Jag trivs jättebra, både med arbetskamrater och arbetsuppgifter. Det finns bra möjlighet till varierande arbetsuppgifter och att avancera uppåt i organisationen, om detta är något som intresserar en. Själv sitter jag i dagsläget som projektledare/teamledare för en grupp programvaruutvecklare. Klas Nilsson universitetslektor Jag hade själv valt att läsa Datateknik om den linjen hade funnits 178. I stället blev det Maskinteknik med kompletteringar i riktning mot mekatronik och arbete i industrin med robotutveckling. Våra studenter ska ha intresse för teknik men de behöver inte kunna det. De ska gilla matematik och inte tycka illa om datorer. Framför allt kan det ge spännande jobb i många branscher att kombinera datorer och programmering med andra områden. LTH ligger långt framme i programvaruhantering. Christofer Bach student Det bästa med utbildningen i Datateknik måste vara att det inte finns någon direkt gräns vad man kan jobba med. Du kan jobba med allt från bilar, flygplan och stora datorsystem till mobiler, robotar m m. Man är inte bunden till datorprogram, som många kan tro. När man pluggar på Datateknik får man både väldig mycket teori, som man ju behöver, och mycket praktik. Och det finns alltid hjälp att få på övningar och under kursernas gång. När jag var liten ville jag bli forskare. Jag kände att jag ville utveckla och jobba med teknik som datorer och mobiltelefoner och komma på nya lösningar till dessa. Så civilingenjör blev ett självklart val då man just får utveckla nya produkter. Årskurs 1 Årskurs Årskurs 3 Årskurs 4 & 5 Programvaruinriktade kurser Elektronik & hårdvara Programvaruinriktade kurser Hårdvaruinriktade kurser Programvaruinriktade kurser Tillämpningsinriktade kurser Specialiseringar inom: Design av processorer och digitala system Programvara i system Bilder och grafik Kommunikationssystem Signaler och systemteknik Valfria kurser Utbildningen Under de tre första åren får du en kvalificerad teknisk utbildning med en hel del matematik och grundläggande tekniska ämnen, men tidigt ägnas också en stor del av utbildningen åt utveckling av datorprogram och åt datorteknik samt tillämpningar. Datorn utnyttjas redan från början som ett naturligt arbetsredskap. Ett viktigt område inom datatekniken är inbyggda system, vilket innebär att datorn ingår som en del i en produkt (en mobiltelefon, en bil, i medicinsk utrustning etc). För att utveckla sådana system krävs den bredd i kunskaperna som du får som ci vilingenjör i datateknik på LTH. Under de sista två åren skaffar du dig en egen profil på din utbildning genom att välja en specialisering och bestämma ett intressant ämne för ditt examensarbete. I din examen kan du till viss del ta med kurser från hela Lunds universitet, så du har rika möjligheter att komplettera din utbildning med icke-tekniska ämnen. Specialiseringar Datateknikutbildningen ger dig kunskaper som gör att du efter civilingenjörsexamen har mycket stor valfrihet i ditt yrkesval, oavsett vilken av de fem specialiseringarna nedan du väljer att fördjupa dig inom. För varje specialisering gäller att du får mycket goda möjligheter att arbeta med utvecklingsarbete inom industrin eller forskning inom högskolan. Design av processorer och digitala system, där du lär dig konstruera avancerade högpresterande datorer och hela system av datorer. Såväl programvaruaspekter som hårdvaruaspekter för bästa prestanda ingår. Det kan gälla allt från enskilda VLSI-kretsar till kompletta datorsystem med programvara och hård vara i samverkan. Programvara i system, där du lär dig utveckla stora programvarusystem. Kurserna behandlar alla delar av utvecklingen, från hur man ställer krav på systemen till hur man utvecklar dem med avancerade programmeringstekniker, samt hur man testar dem. Bilder och grafik, där du lär dig avancerade metoder hur man snabbt och effektivt kan analysera, konstruera samt behandla digitala bilder. Snabba algoritmer, speciell programvara samt implementeringsmetoder för bästa prestanda är exempel på innehåll. Kommunikationssystem, där du lär dig hur avancerade högpresterande kommunikationssystem är konstruerade. Dagens system med höga bithastigheter kräver spjutspetsteknik beträffande såväl programvara som hårdvara. Alla delsystem som bygger upp ett modernt kommunikationssystem förklaras. Signaler och systemteknik, där du lär dig att konstruera system för avancerade tillämpningar där datorer och program utgör fundamentala komponenter. I kurserna lär du dig spjutspetsteknik för ett flertal avancerade datatekniska lösningar, system och tillämpningar. Framtiden I stort sett alla produkter som utvecklas av svensk industri innehåller datorer, eller är beroende av datorer i produktionen. Detta innebär att det finns ett stort behov av civilingenjörer i datateknik. Eftersom datorer används inom så många olika områden som t ex processindustrin, telekomindustrin, media- och underhållningsbranschen och medicinska tillämpningar så har du stor valfrihet i ditt yrkesval. Kinainriktning Programmet erbjuder även, tillsammans med Elektroteknik och Informationsoch kommunikationsteknik, en särskild Kinainriktning som genomsyrar hela utbildningen. Det innebär att du under de två första åren läser kinesiska och kinesisk kultur parallellt med dina teknikstudier. Höstterminen i årskurs 3 är förlagd till Kina. Dessutom erbjuds du möjlighet till ytterligare en utbytestermin senare under utbildningen samt praktikplats och examensarbete i Kina. Kurserna inom kinesiska och kinesisk kultur ligger inom den breddande delen av din utbildning. Se mer på sidan 4 eller kinainriktningen Tillämpningsinriktade kurser Tillämpningsinriktade kurser Breddande kurser Fysik Breddande kurser Teknologie kandidatexamen Civilingenjör Mastersexamen

12 / Civilingenjörsutbildning / Lund 3 Informations- och kommunikationsvetenskap > Master of Science in Engineering, Information and Communication Engineering Technologies > > Patrik Stigborg seismisk applikationsutvecklare, Shell i Haag Kurserna på utbildningen höll väldigt hög kvalitet, något jag märkte då jag fick chansen att läsa kurser på andra skolor. De utbildningsansvariga var oerhört duktiga på att hjälpa studenterna att göra det de ville, och därigenom se till att utbildningen är utmanande och framför allt kul! Nu jobbar jag i Haag på Shells kontor för Exploration and Production. Min nuvarande roll är inom R&D som seismisk applikationsutvecklare, där jag utvecklar ett program som räknar ut hastigheterna av seismiska vågor genom jorden, information som senare används för att hitta kolväten. Positionen är min andra i det Young Graduate programmet som finns på Shell, som innebär fullt ansvar på en riktig position, fast med extra stöd från managers, mentorer, kurser och speciella träningar. Mitt första 1,5 år hos Shell jobbade jag som systemadministratör i en enormt stor och komplex Unix- Linux omgivning över hela världen. Programmet varar under tre år, under vilka man får testa på -3 olika positioner inom olika områden. Jag tycker mitt jobb är oerhört kul och utmanande och trivs jättebra där jag är! Informations- och kommunikationsteknik 3 hp 5 år Varför söka till Informations- och kommunikationsteknik vid LTH? Du får en bred kunskap av hela kommunikationskedjan i ett modernt data- och telekommunikationssystem, från hur informationen överförs, via hur noder kopplas ihop till nätverk, till hur människan tar till sig informationen. Utbildningen ger en djup förståelse över hur de ingående delarna i ett data- och telekommunikationssystem fungerar och påverkar varandra. Du får kunskaper som gör att du kan förstå, och även vara med och utveckla, framtidens kommunikationssystem. Oscar Ljunggren Software Engineer, Networks In Motion Årskurs Telekommunikationsorienterade kurser Jag är mycket nöjd med min utbildning, det kändes spännande att läsa aktuella kurser om t ex internetprotokoll och mobila teknologier. Jag visste inte exakt vad jag skulle göra efter min utbildning, men Infocom är en bred utbildning som gav många möjligheter att välja jobb efter studierna. En annan stor fördel var möjligheten att väldigt enkelt åka utomlands och studera genom Erasmus. Jag åkte iväg och hade en mycket rolig och lärorik termin vid Eidgenössische Technische Hochschule i Zürich. De första två åren efter mina studier jobbade jag på Tactel. Där jag ingick i ett projekt åt SonyEricsson och utvecklade en javaapplikation. Strax före sommaren flyttade jag och min sambo upp till Stockholm, och jag har nu börjat jobba på Networks In Motion (NIM). NIM är ett amerikanskt företag som utvecklar navigationsmjukvara till mobiltelefoner. Mina huvudsakliga arbetsuppgifter är programmering i JME (java), något som jag tycker är väldigt roligt, både på grund av allt problemlösande och att det är kreativt. Daniel Appelgren student Det bästa med LTH är den gemenskap och samarbete som finns inom och mellan programmen. Man dras in i ett gemenskapstänkande där man lär sig att samarbeta med sin omgivning för att tillsammans klara av utbildningen. LTHs geografriska närhet till Öresundsregionen är ingen nackdel då denna region erbjuder stor variation av jobb för en civilingenjör. Det bästa med utbildningen är att den ständigt strävar efter att vara uppdaterad med utvecklingen i världen. Utbildningen förser studenterna med bred baskunskap men den formas varje år av omvärldens framsteg inom IT och Telekommunikation så att studenternas kunskap är aktuell till deras examen. Orsaken till att jag valde att bli civilingenjör är att jag gillar att vara en problemlösare. Som civilingenjör tränas man för att hamna i utmanande situationer med problem som skall lösas. Detta problemlösande samt variationen av arbetsuppgifter en civilingenjör kan få i arbetslivet lockade mig till civilingenjörsutbildningen. Ulf Körner professor Telekommunikation handlar om at bygga broar mellan människor. Det är en teknik som är positiv för människan. Framtidens telecom kommer att vara lika centralt som behovet att prata med varandra alltid har varit, även om det skapas allt fler olika former och medel att kommunicera. Här lär man sig tekniken bakom mobil kommunikation, Internet, trådlösa nätverk och all annan telekommunikation. Många blev skrämda av IT-bubblan som sprack fast den gällde ju främst alldeles för högt ställda ekonomiska förväntningar. Vi använder olika former för kommunikation i allt högre grad. Branschen är nu åter i stark expansion. Jämfört med många andra program kommer Telecom-ämnena in tidigt i undervisningen. en är mer utspridd över åren. Undervisningen är också mer projektorienterad än vanligt. 1 Årskurs Årskurs 3 Årskurs 4 & 5 Telekommunikationsorienterade kurser och statistik Programmet erbjuder även, tillsammans med Datateknik och Elektroteknik, en särskild Kinainriktning som genomsyrar hela utbildningen. Det innebär att du under de två första åren läser kinesiska och kinesisk kultur parallellt med dina teknikstudier. Höstterminen i årskurs 3 är förlagd till Kina. Dessutom erbjuds du möjlighet till ytterligare en utbytestermin senare under utbildningen samt praktikplats och examensarbete i Kina. Kurserna inom kinesiska och kinesisk kultur ligger inom den breddade delen av din utbildning. Se mer på s. 4 eller Telekommunikationsorienterade kurser Specialiseringar inom t ex: Kommunikationssystem Användarvänlighet och design Datasäkerhet och sårbarhet Signaler och styrsystem Utbildningen Telekommunikationsområdets starka utveckling, inte minst inom mobiltelefoni och Internet, innebär att informations- och kommunikationsteknik används inom allt fler områden. Det är en snabbt expanderande marknad som ställer höga krav på den bakomliggande tekniken nya produkter och tjänster använder komplex teknik för att uppfylla konsumenternas önskemål. Som civilingenjör inom informations- och kommunikationsteknik får du en stark telekom-profil, efterfrågad av industrin. Du får en mycket god förståelse för hela kommunikationskedjan. Allt från hur informationen bearbetas och skickas från en nod, t ex dator eller mobiltelefon, till en annan och hur kommunikationsnäten, t ex Internet och mobilnät, är uppbyggda för att hantera detta informationsflöde, till hur användaren interagerar med tekniken, genom design och kunskap om människans beteende, för att ta del av informationen på bästa sätt. Utbildningen består av ett block av obligatoriska kursen om 18 högskolepoäng. Dessa ger en bred basförståelse för hur ett modernt kommunikationssystem är uppbyggt och fungerar. Det täcker också in de baskunskaper, i t ex matematik och programmering, som behövs för att tillgodogöra sig utbildningen. Specialiseringar Programmets huvudinriktning är mot telekommunikation, med följande specialiseringar: Kommunikationssystem ger förståelse för hur ett modernt data- och telekommunikationssystem är uppbyggt och hur de ingående olika delarna fungerar. Du får en djup förståelse för hur t ex Internet fungerar och hur informationen faktiskt kommer fram dit den skall. Du får också förståelse för vad information är och hur den kan skickas från ett ställe till ett annat. Användarvänlighet och design ger insikter i hur användaren möter informationen. Du får förståelse för hur information uppfattas beroende på hur den presenteras. Du lär dig och hur ett gränssnitt byggs upp till exempel på en skärm, både designmässigt och praktisk, för att det skall bli naturligt att använda. Datasäkerhet och sårbarhet handlar om olika säkerhetsproblem i data- och telekommunikationslösningar. Du får en djup överblick över olika typer av säkerhetsrisker i ett kommunikationssystem. Det gäller både rent datasäkerhetsmässigt med exempelvis skydd mot intrång, men även robustheten i nätet som är en viktig aspekt. Signaler och styrsystem ger förståelse för hur signaler kan modelleras och behandlas matematiskt. Du lär dig sambandet mellan tid och frekvens och lär dig hur exempelvis ett digitalt filter kan konstrueras. Du får också kunskap i hur olika system i verkligheten kan modelleras och därigenom kontrolleras via t ex en dator. Framtiden Som civilingenjör inom Informationsoch kommunikationsteknik har du en bred förståelse över olika aspekter inom data- och telekommunikation. Du ser hur helheten av systemet byggs upp av de olika delarna och hur de påverkar varandra, hur olika tekniker i överföringen kan påverka kvaliteten i applikationerna som möter oss dagligen. Det gör att du dels kan arbeta inom direkta tillämpningar inom mobil eller fast kommunikation, men även inom en rad andra områden. Telekommunikation är idag en grundpelare inom i stort sett all kommunikation oavsett vilket ämnesområde det gäller, och många av dem har sina applikationer som ställer speciella krav på exemeplvis nätuppbyggnad eller kvalitet i överföringen. Kinainriktning Programvaruutveckling Programvaruutveckling Breddande ingenjörskurser Valfria kurser Breddande ingenjörskurser Fysik Hårdvaruteknik Teknologie kandidatexamen Civilingenjör Mastersexamen

13 / Civilingenjörsutbildning / Lund 4 5 Kinainriktningen > > > Kinainriktningen 3 hp 5 år Jonathan Lindell student Det bästa med LTH är gemenskapen, en gemenskap som börjar med en högklassig nollning som gör att man känner sig varmt välkommen. Det är vistelsen i Kina som gör utbildningen speciell och ger extra motivation till studierna. Kina är idag en av de mest spännande platserna i världen och den här utbildningen kan förhoppningsvis leda till lika spännande jobb. Efter gymnasiet studerade jag under ett år det kinesiska språket mandarin vid Lunds universitet. När jag sedan läste om Kinainriktningen som skulle starta vid LTH kändes valet av utbildning givet, då det passade två av mina intressen; teknik och Östasien. Naturligtvis behövs inga förkunskaper i språket eller om kulturen på Kinainriktningenalla är nybörjare. Varför söka till Kinainriktningen vid LTH? En unik utbildning som kombinerar teknik och språk. Du får en värdefull inblick i kinesisk kultur och tillgång till en av världens mest expansiva jobbmarknader. Du får läsa minst två terminer vid kinesiska toppuniversitet. Du erbjuds sommarpraktik på svenska företag i Kina. Stefan Höst universitetslektor Jag är programledare för Informations- och kommunikationsteknik, ett av de tre program på LTH som erbjuder en Kinainriktning. Det ska bli spännande att se den här inriktningen ta form med helt nya inslag i civil ingenjörs utbildningen. Minst en termin ska studenterna läsa i Kina, men det kan också bli två eller tre terminer med ett eventuellt examensarbete i Kina. Det verkar som om många av våra nya studenter är intresserade av resor. Det verkar också som om inriktningen intresserar lite fler flickor än vad vi på E, D och C har haft de senaste åren. Bakom satsningen finns ett starkt tryck och ett starkt stöd från företag. Det finns över svenska företag i Kina och de behöver fler civilingenjörer med inriktning mot elektroteknik, data och telekommunikation. Inte minst behövs det ingenjörer som kan arbeta i ett så annorlunda samhälle som det kinesiska, eller i andra utomeuropeiska länder. Språkstudierna inom Kinainriktningen leder till att studenterna kan klara enklare muntlig kommunikation, såsom vardagssamtal. De ska dessutom känna till seder, bruk och traditioner. Är du intresserad av Kina, världens folkrikaste nation och mest expansiva marknad? Vill du utbilda dig för ett internationellt jobb inom högteknologi? Då ska du satsa på LTHs Kinainriktning! Svenska företag satsar enormt mycket i Kina. Till det behövs det duktiga civilingenjörer som både har en teknikutbildning i toppklass och förståelse för hur det är att arbeta i en annorlunda kultur och miljö. Kinainriktningen är öppen för dig som studerar till civilingenjör i Datateknik, Elektroteknik eller Informa tionsoch kommunikationsteknik. När du söker till LTH väljer du Kinainriktningwww.lth.se/kinainriktningen Årskurs 1 Årskurs Årskurs 3 Årskurs 4 & 5 en och avgör sedan själv vilket av dessa tre program du vill gå. Kinainriktningen omfattar normalt alla dina år på LTH. Under de första två åren läser du kurser i kinesiska och Kinas kultur och samhällsliv parallellt med dina teknikstudier i Lund. Kurserna ges av Språk- och Litteraturcentrum, avdelningen för kinesiska, vid Lunds universitet och är skräddarsydda för inriktningen. Under höstterminen ditt tredje år på programmet läser du såväl språk som teknikkurser i LTHs regi, vid Zhejiang University i Hangzhou ett kinesiskt tekniskt universitet av toppklass. Det är viktigt att få erfarenhet av hur det är att arbeta i Kina. Därför erbjuds du praktikplats på ett svenskt företag i Kina under sommaren mellan ditt tredje och fjärde år. Under de sista åren bygger du vidare med språkstudier i Lund och tillbringar ytterligare minst en termin vid ett av Lunds universitets kinesiska partneruniversitet. Som kronan på verket kan du göra ditt examensarbete i Kina. För att trivas på Kinainriktningen måste du vara beredd att anta krävande utmaningar både när det gäller språkoch teknikstudierna. Du måste också vara beredd att anpassa dig till en ny kultur under dina utlandsstudier. Obligatoriskt block Obligatoriskt block Kinakunskap och kinesiska Specialisering Signalbehandling Reglerteknik Obligatoriskt block Obligatoriskt block Obligatoriska kurser Kinesiska Kinakunskap Teknologie kandidatexamen Civilingenjör Mastersexamen

14 / Civilingenjörsutbildning / Lund 6 7 Maskinteknik > Master of Science in Engineering, Mechanical Engineering > > Maskinteknik 3 hp 5 år Thomas Ovesson inköpschef, Haldex Hydraulics Jag arbetar idag som inköpschef på Haldex Hydraulics i Skånes Fagerhult. Vi tillverkar hydraulaggregat till bland annat entreprenadmaskiner, truckar och bakgavellyftar. Jag valde maskinteknik för att jag gillar att meka och dona och har alltid varit mycket tekniskt intresserad. Jag tyckte att de flesta kurserna på maskin var intressanta och lärorika. Efter 4,5 års studier fick jag anställning på Haldex Hydraulics som konstruktör. Efter tre år som konstruktör fick jag erbjudande om att bli 6 Sigma Black Belt. Som Black Belt arbetar du mycket med statistik och kvalitet och det är jättekul. Efter Black Belt jobbet började jag jobba med inköp. Maskinteknik är en bred utbildning och det har jag haft mycket nytta av. En civilingenjör är duktig på att snabbt lära sig något för att sedan använda kunskaperna för att lösa problem oavsett var de finns! Varför söka till Maskinteknik vid LTH? Här förenas klassiska ingenjörsämnen med bland annat teknisk design, ekonomi och miljö. Du får en efterfrågad kompetens inom en mängd branscher som t ex: design, produktutveckling, dimensionering, tillverkning, energianvändning samt distribution och återvinning. Vår utbildning fokuserar på ett meningsfullt lärande. De olika ämnena följer och kompletterar varandra på ett logiskt sätt. Vi för en öppen dialog mellan lärare och studenter. Årskurs Mekanik, statik Ritteknik Industriell ekonomi Logistik Introduktion till maskinteknik Karin Blennow produktutvecklare, IKEA Efter utbildningen började jag jobba på IKEA som produktutvecklare. Jobbet innebär att jag är affärsansvarig för en del av sortimentet world wide, dvs jag ser till att det som inte säljer tas ut och att rätt saker kommer in. Under själva nyutvecklingen jobbar jag med antingen designers eller direkt med leverantörerna och till min hjälp har jag inköpare, logistiker och flera tekniker. Med IKEA har jag även fått chansen att jobba med inredning på varuhusen i Moskva, Ryssland. Utbildningen på LTH var ibland tung, men efter examen har jag ofta reflekterat över hur mycket jag har haft användning för. Jag har haft störst nytta av problemlösningsförmågan som jag övade upp under åren vid LTH. Förmågan att inhämta ett större komplext problem och sedan snabbt bena upp och lösa det. Den färdigheten och med lite sunt förnuft kommer man långt med och kan appliceras på flera olika företag och områden! Emma Lörd student Det finns massor av bra saker med att plugga både i Lund och på LTH. Studentlivet i Lund gör att man lätt träffar nya människor och det finns mycket att engagera sig i på sin fritid. Även på LTH finns det mycket att engagera sig inom och man får snabbt nya kompisar under nollningen, som man sedan kan plugga och ha kul ihop med. Man har också stora möjligheter att studera utomlands vilket jag gjorde under ett år i Vancouver, Kanada. Ett riktigt kul år med en massa nya upplevelser. Det som är det bästa med maskinteknik är att det är en utbildning med väldigt bred grund och att man sedan kan välja om man vill fortsätta att ha en bred utbildning eller verkligen vill specialisera sig på något mindre. Jag valde att läsa till civilingenjör för att jag alltid varit tekniskt intresserad och visste att det är en utbildning som ger många möjligheter. Carin Andersson universitetslektor Maskinteknik är programmet för dig som vill ha stora valmöjligheter vad gäller din framtida yrkesverksamhet. Det är en yrkesförberedande utbildning som ger stora möjligheter till varierande jobb med olika aspekter av produktframtagning inom en mängd branscher. Du kommer att ställas inför komplexa uppgifter där det krävs att du tillsammans med andra utnyttjar din kreativa förmåga för att hitta lösningar och skapa nya eller förbättrade produkter. M-ingenjören är med och bygger vårt samhälle. Utmärkande för utbildningen är att den ger praktiskt tillämpbar kunskap via våra inriktningar. Industrikontakten är stark i form av gästföreläsningar, övnings-case etc. Vi hänger därför med utvecklingen. Maskinteknik det största programmet vid LTH passar lika bra för tjejer som killar. 1 Årskurs Årskurs 3 Årskurs 4 & 5 Hållfasthetslära Mekanik, dynamik Fysik Konstruktionsmaterial Termodynamik Strömningslära Programmering Tillverkningsmetoder Reglerteknik Elektroteknik Tillämpad matematik Matematisk statistik Maskinelement Energi och miljö Utvecklingsmetodik Specialisering inom t ex Energi Fordon Förbränning och strömning Mekatronik Produktion Produktutveckling Teknisk logistik Teknisk modellering Valfria kurser Utbildningen Utbildningen erbjuder en bred bas som ger dig möjlighet att välja mellan ett antal specialiseringar inom olika områden. Som civilingenjör i Maskinteknik kan du bli både specialist och problemlösare och kan påverka hur vårt framtida samhälle kommer att se ut. Maskiningenjörens breda kompetens gör att du blir attraktiv på arbetsmarknaden. Drygt första halvan av utbildningstiden ägnas åt grundläggande naturvetenskapliga och tekniska ämnen. Den specialisering du sedan väljer ger dig djupa kunskaper och färdigheter inom något av nedanstående maskintekniska specialområden, kompletterade med valfria kurser. Specialiseringar Energi är specialiseringen som ger dig kunskap om energiomvandlingsanläggningar med komponenter, som t ex kraftverk och ång- och gasturbiner och färdigheter att använda avancerade beräkningsverktyg. Miljöaspekter är integrerade i alla led av specialiseringen, från kunskap om förbränning med låga emissioner till uthållig energiförsörjning och förnuftig energianvändning. Fordon är specialiseringen som ger dig kunskaper att utveckla morgondagens person- och lastfordon för att uppnå samhällets mål avseende hållbar utveckling. Vilka drivmedel och motorlösning- ar finns i framtidens bilar? Kunskaper inom dimensionering och formgivning av de komponenter och system som bygger upp ett fordon är viktiga för fordonsutvecklaren. Förbränning och strömning är specialiseringen där du bl a får möjlighet att använda avancerade datorbaserade simuleringsverktyg för att analysera värmeöverföring, strömning och förbränning. Du lär dig om fenomen och komponenter som är väsentliga inom termiska system, att analysera och beräkna mekanismer och förlopp samt projektera och formge komponenter. Mekatronik är specialiseringen som kombinerar ämnen som maskinkonstruktion, elektronik och avancerad datorstyrning. Hur konstrueras motorstyrningen i en modern kamera eller en robot till hjälp för handikappade? Hur konstruerar man en automatisk gräsklippare eller elektrisk styrning av bilen? Mekatronikingenjören utnyttjar flera kompetenser och kan därför skapa nya och smarta produkter. Produktion omfattar tillverkningsteknik, utformning av produktionssystem och automation, materialteknik, ekonomisk styrning och produktionsledning. Specialiseringen ger dig de kunskaper som krävs för att kunna utveckla ett företags konkurrenskraft och framgångsrikt leda produktionen i företag på såväl nationell som internationell nivå. Produktutveckling är specialiseringen för dig som vill bli konstruktör, en roll som är både dynamisk och spännande. En produktutvecklare arbetar både med utformning och dimensionering och tar utifrån ett kundbehov fram helt nya produkter eller utvecklar redan existerande produktkoncept till bättre prestanda. Arbetet utförs oftast i team av experter från olika ämnesområden. Teknisk modellering är specialiseringen där du får ägna dig åt avancerade tekniska beräkningar inom hållfasthetslära och strukturdynamik. Varför kollapsade byggnaden World Trade Center? Hur konstruerar man en lättare bil med mindre material och ändå bättre hållfasthet vid kollisioner? Utvecklingen inom området har i hög grad medverkat till den teknologiska utvecklingen, t ex inom flyg- och bilindustrin, där avancerade beräkningsverktyg används för att utföra t ex komplexa simuleringar. Teknisk logistik är en specialisering som ger dig verktygen för att effektivisera processer för material-, informationsoch betalningsflöden inom och mellan företag. Som logistiker kan du arbeta med allt från inköp till distribution, inom företag eller som konsult, nationellt och internationellt. Teknologie kandidatexamen Civilingenjör Mastersexamen

15 / Civilingenjörsutbildning / Lund 8 Maskinteknik med teknisk design > Master of Science in Engineering, Mechanical Engineering with Industrial Design > > Maskinteknik med teknisk design 3 hp 5 år Anders Arnqvist interaktionsdesigner, Interaktionsbyrån AB Utbildningen blandar mycket av det som intresserar mig både av formgivning och bakomliggande teknik, att bättre förstå uppkomsten av produkter och hur de ska kommunicera till användaren. Beläget mitt emellan arkitektur och industridesign är de bästa av förutsättningar för ett nära samarbete i yrkeslivet. Och ser man till var jag befinner mig idag stämmer det rätt bra. Jag jobbar som interaktionsdesigner för Interaktionsbyrån i Göteborg. Vi jobbar huvudsakligen med design och utveckling av användargränssnitt med fokus på upplevelsen. På interaktionsbyrån handlar mycket om smart teknik och produkter som lämnar avtryck hos användaren. Vårt arbete är ofta på strategisk nivå vilket innebär att vi kan komma in redan under produktplaneringen. I Göteborg finns många stora kunder och branschen är het för den som kan och vill. Anna Selarp konstruktör,sony Ericsson Varför söka till Maskinteknik med teknisk design vid LTH? Maskinteknik med teknisk design vid LTH är unik i sitt slag i Sverige. Programmet kommer att ge dig kunskap och färdighet i utveckling och formgivning av produkter. Du får ett helhetsperspektiv på produktutvecklingsprocessen där design som uttrycksmedel är ett väsentligt inslag. Inslaget av teknik är fortfarande stort varför du får en stabil ingenjörsgrund att stå på. Programmet har en studiemiljö med god sammanhållning bland nöjda studenter. Maskinteknik med teknisk design är en utmärkt blandning av teknik och design då man står med ett stort ben inom maskinteknik och ett lite mindre ben inom industridesign. Utbildningen är för dem som vill ha mer teknikkunskap än Industridesignern eller den som vill vara maskiningenjör med kunskap och förståelse inom design. Idag jobbar jag på Sony Ericsson i Lund som konstruktör. Som konstruktör har man ansvar för några olika delar i telefonen och får konstruera dem, se till att verktygen blir godkända och följa upp detaljerna så att inga problem uppstår. Man har ganska ofta kontakt med ansvariga designers. Mitt arbete är väldigt inspirerande och det är kul att få jobba med produkter som man själv tycker om. Många företag har en bristande kommunikation mellan design- och teknikavdelningar vilket en civilingenjör i maskinteknik med teknisk design kan underlätta med vår förståelse. Vilken sida man själv väljer i slutänden är av mindre betydelse. Karl-Axel Andersson adjungerad universitetslektor Programmet vänder sig till dem som vill ägna sig åt produktutveckling och design. Här tränar och studerar man mer teknik än rena industridesigners gör. Om man gillar att hitta på nya grejer och vill träna sin kreativitet så kan det vara rätt utbildning. De som har lekt med meccano, de som har experimentlusta eller gillar att teckna, bör kolla in programmet. Arbetsmarknaden finns fast kanske inte bara i Sverige. Det är en civilingenjörsutbildning med ett rejält inslag av estetiska uppgifter och design metodik. Man tillägnar sig olika redskap för att kommunicera med andra i produkt utvecklingen. Funktion går hand i hand med hur man upplever en produkt. Studenterna är duktiga och hälften är tjejer. Klasserna är tightare än vanligt med ca 3 studenter. Första året läses dock gemensamt med maskinteknik. Maria Sperlingsson student Det bästa med LTH är att det ligger i Lund som är en väldigt trevlig studentstad att studera i. Det finns ett bra kursutbud på LTH och man kan även ta kurser på Lunds universitet i andra ämnen som språk eller ekonomi om man är intresserad av det. Det finns även mycket roligt att engagera sig i på fritiden som spex och nationer. Det bästa med Teknisk design är alla de intressanta inriktningskurserna. Man jobbar bland annat mycket i projekt de sista åren där man lär sig hur produktutvecklingsprocessen går till. Det är väldigt roligt att få prova på både mer designinriktad och konstruktionsinriktad utveckling. Eftersom klasserna är så små är det väldigt trevlig stämning och man lär känna folk bättre än i de stora klasserna som är vanliga på LTH. Jag valde att läsa till civilingenjör eftersom jag tror att det ger mig stora möjligheter att få ett intressant och utvecklande jobb. Vår tillvaro blir alltmer komplex och tekniskt avancerad. Vi ställer allt större krav på att produkter och arbetsredskap av olika slag inte bara ska ha en bra teknisk funktion de ska också ha en attraktiv utformning, vara begripliga och lätta att använda, vara ergonomiskt riktigt utformade och bra ur miljösynpunkt. För att åstadkomma detta krävs ett helhetsperspektiv på produktframtagningsprocessen och en humanistisk syn på tekniken och dess användning ett perspektiv där människans behov och förmåga och samhälleliga krav sätts i centrum. Teknisk design är en civilingenjörsutbildning som blandar naturvetenskap och teknik med ett stort utbud av designrelaterade kurser av olika slag. En utbildning för dig som är kreativ och nyfiken och intresserad av teknik, matematik och design. Med design menas här den process som utöver den tekniska funktionen tillför produkten estetiska värden. Detta för att ge användaren av produkten en bättre förståelse för hur produkten eller tjänsten ska användas. Andra värden som beaktas i designprocessen är till exempel den ergonomiska utformningen, ett företags marknadsprofil i förhållande till produkten samt att en synergi uppnås med produktens tekniska funktion. Utbildningen Utbildningen spänner över många olika teknikområden och inslaget av designrelaterade kurser är stort, vilket ger utbildningen en unik profil. I början av utbildningen läser du grundläggande ämnen inom naturvetenskap och maskinteknik. På våren i årskurs 1 börjar inslagen av teknisk designkurser parallellt med kurser inom andra ämnesområden. Under utbildningen genomför du flera projekt. I projekten får du tillfälle att tillämpa och fördjupa dina kunskaper och färdigheter och träna upp din förmåga att arbeta kreativt och systematiskt med att utveckla och utforma produkter. Du kommer att kunna välja mellan en rad olika spännande arbeten inom olika branscher, i Sverige och utomlands. Du kan arbeta som bl a produktchef, projektledare, produktutvecklare, designer, forskare och lärare. Med en bred kunskapsbas inser du vikten av design som konkurrensmedel i produktutvecklingsarbetet och kan lätt kommunicera med olika avdelningar. Årskurs 1 Årskurs Årskurs 3 Årskurs 4 & 5 Hållfasthetslära Reglerteknik Estetik Termodynamik Elektroteknik Tribologi Energi och miljö Matematisk statistik Valfria kurser Mekanik, statik Ritteknik Industriell ekonomi Verkstadsintroduktion Strömningslära Tillverkningsmetoder Mekanik, dynamik Konstruktionsmaterial Transmissioner Designmetodik Designprojekt Introduktion till maskinteknik Designerns yrkesredskap Utvecklingsmetodik Teknologie kandidatexamen Civilingenjör Mastersexamen

16 / Civilingenjörsutbildning / Lund 3 31 Industriell ekonomi > Master of Science in Engineering, Industrial Engineering and Management > > Industriell ekonomi 3 hp 5 år Camilla Strömbeck Supply Manager, Tetra Pak LTH var självklart eftersom studentlivet i Lund är svårslaget och studentstaden Lund har allt som en student kan önska sig. Dessutom har LTH bra rykte och utbildningarna verkade ha ett bra upplägg. Jag tog min examen i januari 6 och började direkt jobba på Sandvik i Svedala. Jag började min bana på Sandvik som inköpare av våra reservdelar och fick därigenom mycket kontakter med leverantörer i hela världen. Jag blev sedan ansvarig för att se till att våra kunder får de reservdelar som de behöver runt om i världen, vilket även innebar personalansvar. Idag jobbar jag som Supply Manager på Tetra Pak vilket innebär att jag förhandlar avtal med leverantörer och ser till att samarbetet med leverantörerna fungerar på ett bra sätt. Som ingenjör jobbar man mycket med människor och det är oerhört givande. Varför söka till Industriell ekonomi vid LTH? En god bas i matematik och en unik inriktning mot Finans och Risk. God nationell och internationell arbetsmarknad. Möjlighet till egen näringslivsmentor under studietiden. Avtal med många välrenommerade universitet i världen. Årskurs Ekonomi Industriell ekonomi Företagsorganisation Entreprenörskap Teknik Mekanik Fysik Energi Miljöteknik Analys Algebra Maria Petterson managementkonsult, Capgemini Consulting Jag är glad att jag valde att utbilda mig till industriell ekonom! Det har öppnat många dörrar för mig. Jag har alltid gillat matte och naturvetenskap men tyckte inte att det räckte utan jag ville också skaffa mig god ekonomisk kunskap eftersom det krävs om man ska lyckas i affärslivet. Resultatet av min utbildning blev att jag har koll på teknik samtidigt som jag har business tänk och det var precis vad jag var ute efter. Jag arbetar idag som managementkonsult vilket innebär i korta ordalag att man stödjer företagsledningar på olika nivåer med strategi- och lönsamhetsfrågor. Mer konkret kan det till exempel innebära att hjälpa ett företag att integrera ett nyligen förvärvat företag. Eller att ge ett företag råd i hur stödprocesser såsom HR och ekonomi kan effektiviseras och samtidigt vara mer affärsstödjande. Ett annat exempel på projekt kan vara att hjälpa företag att sätta sin säljstrategi, dvs att definiera vilka produkter som ska erbjudas till vilka marknadssegment och hur man ska gå tillväga för att nå marknaden. Andreas Norrman universitetslektor Det här är ett program för dem som vill hålla flera dörrar öppna både mot olika teknikfördjupningar och mot ekonomi. Man får en generalistbredd inom ekonomi och ledning samtidigt som det ingenjörsmässiga problemlösandet skolas. Under tredje året fördjupar man sig i en valfri teknikprofil och i fjärde året väljer man en specialisering. Våra studenter är ofta ambitiösa och duktiga. De går ofta till stora industrier, till handelsföretag eller så blir de konsulter. Andra går till banker och finanssektorn. En blandning av hårda och mjuka ämnen är karaktäristiskt för programmet. Under framför allt senare delen av utbildningen kommer näringslivet in genom gästföreläsningar och grupp arbeten ute i företag. Projektarbeten och muntliga redovisningar är viktiga moment, precis som i näringslivet. Viggo Wedborn student För mig är I-programmet i Lund en utmärkt och välansedd utbildning som verkligen öppnar många dörrar nu när jag står inför min examen. Som I:are är jag inte begränsad av en specifik bransch eller nationella gränser, i princip kan jag hitta en relevant roll för mig i alla typer av företag, både i Sverige och internationellt. Idag är jag mycket nöjd med mitt val av Industriell ekonomi och att jag valde just Lund. Här kryllar det av studenter från hela Sverige och det är lätt att hitta nya vänner. Vid sidan av skolan finns det något för alla, även för de som ser lite skeptiskt på alla studentupptåg, Malmö och Köpenhamn är bara en kvart respektive 45 minuter bort! Matematisk modellering ger dig inte bara kunskaper i modellering, optimewww.i.lth.se 1 Årskurs Årskurs 3 Årskurs 4 & 5 Ekonomi Mikroekonomi Marknadsföring Handel Globailsering Industriell ekonomi Teknik Logistik Programmeringsteknik Beräkningsteknik Matematisk statistik Funktionsteori Systemteori Transformer Ekonomi Finansiell ekonomi Optimering Simulering Teknik Miljösystemanalys/ management Hållbar utveckling Industriell produktion Reglerteknik Teknikprofil Industriell produktframtagning Energi- och miljöteknik Matematisk modellering System- och programvaruutveckling Specialisering: Logistik och produktionsekonomi Finansiering och risk Affär och innovation Produktion och produktionsteknik Produktutveckling och design Integrerade programvarusystem Egen specialisering Utlandsstudier Valfria kurser Industriell ekonomi är en bred, kvalificerad och internationellt konkurrentkraftig utbildning baserad på integrationen mellan matematik, teknik, ekonomi och ledarskap. Som civilingenjör i Industriell ekonomi är du attraktiv genom din mångfacetterade kompetens och förmåga att initiera och leda industriella projekt. Arbetsområden är bl a produktionsledning, finansiering och riskanalys, investeringsbedömning, strategi, företagsutveckling, marknadsföring samt produktutveckling. Speciellt för utbildningen i Lund är möjligheten att inrikta sig mot matematisk modellering och finansiell ekonomi samt ett mentorsprogram i samarbete med näringslivet. Utbildningen Utbildningen omfattar 3 hp, varav ca 15 hp är obligatoriska baskurser, ca 3 hp inom valfri teknikprofil, ca 45 hp inom valfri specialisering samt 3 hp examensarbete. Parallellt läser du valfria fördjupnings- eller breddkurser samt helt valfria kurser, t ex juridik, språk och/eller miljöteknik. De första tre åren består av grundläggande kurser i matematik, teknik, ekonomi och ledarskap. I årskurs 3 väljer du en av följande teknikprofiler: Industriell produktframtagning ger dig grundläggande kunskaper i materialteknik och tillverkningsmetoder. Energi- och miljöteknik ger dig grundläggande kunskaper i traditionell och förnybar energi- och förbränningsteknik samt energi- och miljösystemanalys. ring och statistik utan också verktygen att implementera kraftfulla modeller på verkliga system. System- och programvaruutveckling utvecklar dina kunskaper i programmerings-, dator- och digitalteknik samtidigt som du lär dig metoder för utveckling av mycket stora tekniska system. Du har också möjlighet att utforma din egen teknikprofil. Du kombinerar då kurser ur LTHs breda kompetens med kompetens vid de universitet runt om i världen som Lunds universitet har avtal med. Specialiseringar Under de avslutande två åren utvecklar du djupa kunskaper inom ett vetenskapsområde med god forskningsbas vid LTH. Logistik och produktionsekonomi handlar om att leda, styra och planera produktionsprocesser och materialflöden med goda resultat, med avseende på resursutnyttjande, kvalitet, tidseffektivitet och försäljningspris. Finansiering och risk handlar om finansiella tillgångar i företag, t ex balansering av avkastning och risk, prissättning av finansiella tillgångar eller beskrivning av options- eller elmarknaden. Affär och innovation handlar om hur före tag marknadsför, köper produkter och tjänster samt utvecklar teknikstrategier. Du ska kvantitativt och kvalitativt kunna analysera marknader, lägga upp strategier och skapa goda relationer till affärspartners. Integrerade programvarusystem handlar om att leda och genomföra utveckling av stora programvarusystem som är integrerade i allt fler produkter, t ex inom telecom, automation, sjukvård och fordon. Produktion och produktionsteknik omfattar tillverkningsteknik, utformning av produktionssystem, automation, materialteknik, ekonomisk styrning och produktionsledning. Att utveckla ett företags konkurrenskraft och leda produktionen i företaget såväl nationellt som internationellt. Produktutveckling och design handlar om konstruktion, ofta i team med olika experter. Produktutveckling innebär både utformning och dimensionering och kundanpassning av helt nya eller utveckling av redan existerande produktkoncept till bättre prestanda. Efter utbildningen Efter utbildningen kan du arbeta nationellt och internationellt. Du kan tillämpa hela kedjan från idéformulering, modellering, konstruktion, tillverkning, kvalitetssäkring, drift och underhåll till produktion och distribution av produkter och tjänster. Du arbetar t ex som affärsutvecklare, produktionsledare, systemutvecklare, kvalitetsingenjör, marknadsförare, management konsult, investment banking, riskanalytiker, logistikchef eller företagsledare. Många av LTHs Industriella ekonomer arbetar i länder som Danmark, England, Tyskland, Österrike och Belgien. Det är stor efterfrågan såväl nationellt som internationellt på civilingenjörer med goda ledaregenskaper som kan verka i gränsområdet mellan teknik och ekonomi. Teknologie kandidatexamen Civilingenjör Mastersexamen

17 / Civilingenjörsutbildning / Lund 3 33 Väg- och vattenbyggnad > Master of Science in Engineering, Civil Engineering > > Väg- och vattenbyggnad 3 hp 5 år Torbjörn Berggren konstruktör, Tyréns Byggprojektering Jag valde att studera i Lund eftersom jag ville komma till en riktig studentstad, vilket verkligen besannades! LTH blev ett naturligt val eftersom jag i framtiden ville vara kreativ och skapa saker. Det bästa med LTH är gemenskapen, sammanhållningen och att alla hjälper alla. Under studietiden var jag bland annat engagerad i sektionen och arbetade som studentambassadör, två saker som jag haft stor nytta av i arbetslivet. Idag arbetar jag som byggnadskonstruktör på Tyréns i Malmö. Vi tar fram konstruktionslösningar, ritningar och hållfasthetsberäkningar där samtal med entreprenörer, arkitekter och byggnadsarbetare tillhör vardagen. Aktuella projekt just nu är till exempel nya Malmö Stadion och Emporia köpcentrum i Hyllie. Mitt specialområde har blivit småhus. Det ger mig en bra överblick, så här i början av arbetlivet, då jag får hålla i mina egna projekt och därmed kan påverka allt från grund till tak. Maria Malm nationell projektingenjör, E.ON Elnät Sverige AB Varför söka till Väg- och vattenbyggnad vid LTH? Leder till en examen som ger dig möjlighet att påverka hur vårt framtida samhälle ska se ut och fungera, från stadsplanering och byggande till naturresursplanering och praktisk miljövård. Du får under studietiden kontakt med företrädare för din framtida arbetsmarknad liksom en inblick i denna genom olika inslag i kurserna. Du läser en bredd av ämnen vilket gör att du får god bas att stå på inför framtiden. Vid LTH finns landets bästa kompetens inom husbyggnadsteknik, vattenresursplanering och trafikplanering. Årskurs Mekanik Fysik Byggnadsteknik Avdelning Anläggning/Projekts uppdrag inom E.ON Elnät är att upphandla entreprenadprojekt och styra dessa projekt från beslutat till färdig anläggning. Min uppgift som projektingenjör är att leda och medverka i affärsutvecklande projekt, medverka i upphandlingar, följa upp och analysera nyckeltal och verksamhetsmål. Vår organisation är nationell från Skåne i söder till mellersta Sverige vilket medför att jag reser mycket i tjänsten. Därtill medverkar vi i internationella utvecklingsprojekt inom E.ON koncernen. Det är ett utmanande och omväxlande arbete. Innan jag kom till E.ON arbetade jag på NCC. Jag hade en traineetjänst på NCC Construction Sverige AB med placering på Citytunneln E11 Malmö C Nedre. Där fick jag möjlighet att jobba mer ute i produktionen som arbetsledare för internationell arbetskraft. Jag fick arbeta med temporära stödkonstruktioner, grundläggning, geoteknik, injektering, reparationer av gjutskador, armering, form osv. Som civilingenjör öppnas många dörrar och valmöjligheter! Ebrahim Parhamifar lärare Väg och vatten är en utbildning som verkligen är bred och passar många. Man kan arbeta med husbyggen, vägar, vattenrening eller trafik för att nämna de vanligaste områdena. Man kan jobba i Sverige eller internationellt, i företag eller myndigheter och offentlig sektor eller som sin egen konsult. Valfriheten är enorm och arbetsmarknaden aldrig dålig. Pedagogiskt provar vi många former: laborationer, projektarbeten, föreläsningar, räkneövningar i mindre grupper, problem baserat lärande i ett team, precis som i verkligheten. Edvin Aldnervik student Det bästa med Väg- och vattenprogrammet är att man får en unik inblick inom samhällsbyggandet på flera plan. De första,5 åren får vi en bred grund, vilken ger en verktyg till att förstå olika processer och tillvägagångssätt inom byggande, infrastruktursystem och samhällsplanering. Senare i utbildningen inriktar man sig mot något område. Under studietiden tror jag att man tilldelas en viktig spetskompetens och samtidigt en bred kunskap kring områden som angränsar till ens område. Man tilldelas en ovärderlig helhetssyn. Utöver detta lär man sig att ständigt angripa och lösa nya problem och anta nya utmaningar. Jag hade förhållandevis enkelt för mig inom de tekniska och naturvetenskapliga ämnena under gymnasiet och tänkte att jag skulle läsa något inom detta. Jag ville gå en utbildning som jag kunde vara säker på gav mig en stabil grund till arbetslivet. Jag ville helt enkelt inte läsa bara för att, utan för att verkligen få med mig någonting. Civilingenjörsstämpeln innebar för mig, då som nu, en garanti för viss kvalitet. 1 Årskurs Årskurs 3 Årskurs 4 & 5 Byggnadskonstruktion Vatten och miljö Anläggningsteknik Trafik Statistik Specialiseringar inom t ex: Anläggningsteknik Fastighetsutveckling Husbyggnadsteknik Industriellt byggande Strukturanalys Trafikplanering Vattenresurshantering Utbildningen De första tre åren innehåller ämnen som ger dig en bas inom största delen av en Väg- och vattenbyggares arbetsområde. Under de avslutande två åren av utbildningen skaffar du dig en kunskapsprofil genom ditt val av specialiserade kurser och examensarbete. Det finns även goda möjligheter till utlandsstudier samt studier inom andra ämnen, t ex språk, juridik och arkitektur. Du kommer under hela studietiden att bygga upp din problemlösningsförmåga och förmåga att kommunicera dina idéer och slutsatser till omgivande samhälle. Specialiseringar Vid Väg- och vatten på LTH sker forskning inom många ämnen inom samhällsbyggnadsområdet, ofta ämnesövergripande och i samarbete med industrin. Detta kommer du framförallt att kunna utnyttja under de avslutande åren när du ska fördjupa dina kunskaper inom ett eller flera områden. Specialiseringarna är i vissa fall gemensamma med andra program vid LTH. Anläggningsteknik handlar om planering och utformning av infrastruktur, främst större anläggningskonstruktioner. Som anläggningsprojektör arbetar du med att planera och konstruera olika typer av anläggningar med krav på design, hållfasthet, beständighet, miljö, hållbar utveckling och alla andra anspråk som finns på dagens infrastruktur. Fastighetsutveckling innehåller ett spektrum av ämnesområden som byggteknik, byggproduktion, fastighetsföretagande, fastighetsekonomi och hållbar utveckling. Detta gör att du i framtiden kan leda och medverka i fastighetsutvecklingsprojekt både som beställare och entreprenör, samt inom fastighetsföretagande. Husbyggnadsteknik omfattar ämnesområden som inomhusmiljö, konstruktion, materialteknik och akustik. Efter avslutad specialisering kan du vara med och utforma olika typer av byggnader med hänsyn till de krav som finns på dagens byggnader: hållfasthet, beständig het, god inomhusmiljö och energieffektivitet. Industriellt byggande ger fördjupade kunskaper i produktionsledning och organisation inom en industriell byggoch materialhanteringsprocess. Som civilingenjör specialiserad på industriellt byggande kommer du att vara attraktiv för jobb inom entreprenad-, konsultoch byggmaterialtillverkande företag. Strukturanalys omfattar mekanik, konstruktion och materialteknik och ger dig en god grund för att i framtiden arbeta med och utveckla avancerade beräkningsmetoder. Arbetsmarknaden finns både inom traditionella V-verksamheter, främst konsultbolag, men även inom andra områden, exempelvis inom materialindustri och mekanisk industri. Trafikplanering omfattar ämnesområden som trafik, vägbyggnad och stadsplanering. Som trafik- och samhällsplanerare får du arbeta med mycket varierande arbetsuppgifter och spännande frågeställningar, exempelvis väg- och järnvägsplanering på nationell och regional nivå samt trafikplanering i städer. Vattenresurshantering ger kunskaper om grundvatten, ytvatten och VAteknik och förbereder för arbete med både tekniska och naturliga vattensystem. Människans vattenhantering är avgörande för många av de stora miljöfrågorna och samtidigt en förutsättning för en bra samhällsutveckling. All undervisning sker på engelska inslaget av internationella studenter är stort. Framtiden Samhället har behov av civilingenjörer som har kompetens att delta i planering, byggande och förvaltande av byggnader och anläggningar, transportsystem och samhällen. Detta gäller såväl nationellt som internationellt vilket innebär att du har en bred framtida arbetsmarknad. Din arbetsplats kan finnas både inom privat såväl som offentlig sektor, den kan finnas hos mindre konsultfirmor eller stora entreprenadföretag. Oavsett var du arbetar i framtiden kommer du att ha stora möjligheter att få ett intressant arbete där din insats kan göra en skillnad. Byggprocessen och ekonomi Fördjupande kursval Valfria kurser Teknologie kandidatexamen Civilingenjör Mastersexamen

18 Lunds tekniska högskola VAR GÅR GRÄNSEN FÖR MODERN TEKNIK? Sagt om LTH Drömmer du om att utveckla framtidens tekniska innovationer? Jag gillade min tid i Lund. Jag träffade många likasinnade och kommer att ha minnen för livet samt ett bra nätverk av bekanta som jag kommer att fortsätta hålla kontakten med under lång tid framöver. Johanna / doktorand Bläckstråleskrivaren Berättelsen om utvecklingen av bläckstråleskrivaren på LTH handlar inte om dagens skrivare utan om den modell som hade sin storhetstid i början av -talet. Anledningen till att det började här berodde på att Hellmuth Hertz, mannen bakom det diagnostiska ultraljudet, behövde en metod att snabbare skriva ut sina ultraljudsbilder. Samtidigt fanns det en annan uppfinnare från Lund, läkaren Rune Elmqvist, som hade utvecklat en bläckstrålemetod för att registrera EKG, en galvanometer. Denna metod hade Hertz koll på och genom att han fick idén att ladda bläckdropparna elektriskt skapades bläckstråleskrivaren. Johan Nilsson, docent och universitetslektor vid elektrisk mätteknik, doktorerade på en avhandling om bläckstråleteknik 13. Att LTH är en av Sveriges bästa tekniska högskolor med gott rykte även internationellt kändes bra och dessutom hade jag hört mycket positivt om Lund som studentstad! Maria / civilingenjör Efter gymnasiet hade jag bestämt mig för att gå på en väletablerad högskola med gott rykte och många valmöjligheter för ett spännande studentliv. Louise / civilingenjör Det är så mycket som är bra och positivt med LTH. En respekterad lärarkår, ett stort utbud av utbildningar i världsklass och en otrolig gemenskap mellan studenterna. LTH har ett gott internationellt rykte vilket ger goda möjligheter till att skapa kontakter med skolor och företag runtom i värden. Rasmus / student Det jag tycker är bäst med LTH är att det erbjuds hög kvalitet på utbildningarna. LTH har också ett gott anseende, vilket man kan ha nytta av i det framtida yrkeslivet. Sedan är både studenter och lärare oftast väldigt engagerade, vilket leder till en stimulerande studietid både i och vid sidan av pluggandet. Edvin / student Det bästa med LTH är gemenskapen. Både den gemenskap som finns studenter emellan, men även den gemenskap som finns mellan studenter och lärare på högskolan. Pontus / student

19 / Civilingenjörsutbildning / Lund Lantmäteri > Master of Science in Engineering, Surveying and Land Management > > Lantmäteri 3 hp 5 år Peter Ringberg förrättningslantmätare, Lantmäteriet Som förrättningslantmätare ansvarar jag för att en grundläggande del av Sveriges infrastruktur, fastighetsindelningen, fungerar rättssäkert. Jag jobbar med olika typer av lantmäteriförrättningar. Rent konkret handlar det bland annat om att utreda rättsförhållanden, hålla sammanträden med berörda sakägare, samråda med andra myndigheter samt utföra inmätnings- och utsättningsarbeten ute i fält. En av utmaningarna är att ta hand om mer komplexa ärenden, där många fastighetsägare är berörda och har motstridiga yrkanden. Förutom förrättningshandläggning har jag deltagit i utvecklingsprojekt för myndighetens e-tjänster och representerat Lantmäteriet utomlands. Under 7 deltog jag i ett biståndsprojekt med GIS-inriktning på plats i Filippinerna. Utbildningen på LTH har gett mig en stabil grund att stå på. Jag upplevde den vara mer bred än specialinriktad. Just mixen av teknik, juridik och ekonomi gör dig mycket eftertraktad på såväl den privata som offentliga arbetsmarknaden. Varför söka till Lantmäteri vid LTH? En blandning av teknik, ekonomi och juridik. Det enda renodlade civilingenjörsprogrammet i lantmäteri i Sverige. Mycket god arbetsmarknad. Konkreta ämnen ger ett verklighetsnära perspektiv. Jämn fördelning mellan killar och tjejer. Årskurs Lena Berg Grimslätt fastighetsvärderare, Sveriges Bostadsfinansierings AB (SBAB) Efter ett år som föräldraledig är jag tillbaka i arbete och jobbar just nu som fastighetsvärderare på SBAB i Göteborg. När företag och bostadsrättsföreningar vill låna pengar av oss värderar vi de fastigheter som utgör säkerhet för lånet. Det är allt från värdering av hyreshus, kontors-, handels- och logistikfastigheter. Ett omväxlande arbete som kräver både teknisk och juridisk kunskap om fastigheter, samt god kännedom om fastighetsmarknaden. Som värderare kunde jag inte ha bättre utbildning än lantmäteriutbildningen - sen är det ju ett plus att den går att läsa i studentstaden Lund! Tidigare har jag jobbat som fastighetsutvecklare på Skanska Fastigheter. År som innefattade fastighetsförvaltning och projektutveckling. Även på Skanska hade jag stor användning av min lantmäteriutbildning. Martin Palm fastighetsekonomisk konsult, Bryggan Fastighetsekonomi Tiden på utbildningen motsvarade mina förväntningar och höjdpunkten för min del var helt klart möjligheten till utbytesstudier. Jag bedrev ett års studier i Kanada (Toronto) vilket gav mig kunskaper, minnen och erfarenheter för resten av livet. Idag arbetar jag som konsult på Bryggan Fastighetsekonomi AB. Bryggan är ett nätverk av konsulter med specialistkunskaper inom såväl ekonomiska, juridiska och tekniska problemställningar som har koppling till fastigheter och fastighetsägande. Mina arbetsuppgifter har tyngdpunkt på större beståndsvärderingar samt marknadsanalys. Att jobba som fastighetsekonomisk konsult innebär att ens uppdragsgivare förväntar sig att man besitter breda baskunskaper kombinerat med spetskompetens. Därför är arbetet väldigt entusiasmerande, varierande och stimulerande. Tjänsten erbjuder även möjlighet till att bli auktoriserad fastighetsvärderare enligt kriterier bestämda av Samfundet för fastighetsekonomi. Ingemar Bengtsson universitetslektor Jag är doktor och lärare i nationalekonomi och ganska ny här på LTH. Min uppgift är att leda de obligatoriska kurserna fastighetsekonomi och fastighetsvärdering, som omfattar en tematermin på tredje året med ett innehåll av nationalekonomi, företagsekonomi och fastighetsvärdering. Förutom föreläsningar arbetar studenterna i projektarbeten där de analyserar kommuner, värderar kommersiella fastigheter och småhus. Mitt specialintresse är rättsekonomi om samspelet mellan institutioner, regler och ekonomiskt utfall. Utmärkande för lantmäteriutbildningen (och yrket) är blandningen av teknik, ekonomi och juridik. Möjligheterna till internationellt arbete är goda då svenskt lantmäteri har mycket att erbjuda tredje världen. 1 Årskurs Årskurs 3 Årskurs 4 & 5 Utbildningen Lantmäteri är utmärkt för dig som vill läsa såväl teknik, juridik som ekonomi. I utbildningen kombineras fastighetsekonomi och fastighetsrätt med samhällsplanering, byggämnen och geografisk informationsteknik, samt grundläggande civilingenjörsämnen (matematik, statistik och programmering). Vi utvecklar förståelsen av fastighet som en juridisk enhet. Du gör ekonomiska analyser, lär dig om rättigheter i fastigheter, samhällets regler om byggande och markanvändning. Vidare studerar du tekniska förutsättningar för byggande och förvaltning av byggnader. Du lär dig samla in mätdata, jobba med databaser, och programmera samt att arbeta i geografiska informationssystem (GIS). Forskning sker i de olika ämnena du läser, t ex hur geografiska informationssystem kan användas på Internet, digitala koordinater som grund för fastighetsgränser, säkerställda obligationer på fastighetsmarknaden, om oro på fastighetsmarknaden med stora prisändringar, effektiv fastighetsförvaltning och attraktiva stadsmiljöer Specialiseringar I den fastighetsrättsliga specialiseringen får du lära dig lagar och praxis om markanvändning, fastighetsindelning och utbyggnad av tätorter. Detta hjälper dig att lösa de problem som uppstår när man ändrar markanvändningen. Det kan exempelvis vara vid byggande av enstaka hus eller ett nytt bostadsområde på åkermark. Turning Torso i Malmö är ett spännande exempel. Det krävs fastighetsrättslig kunskap även när nya vägar eller järnvägar ska anläggas, t ex utbyggnaden av Citytunneln i Malmö. I specialiseringen Stadsutveckling läser du mer ämnen inom fysisk planering, stadsbyggnad och gestaltning. Även trafiktekniska lösningar och planering av kollektivtrafik ingår i några kurser. Du läser många kurser tillsammans med arkitekt- och väg-&vattenstudenter. Fastighetsutveckling attraherar många studenter. Du lär dig fastighetsekonomi, hur du värderar och förvaltar fastigheter. Vilken är den bästa lösningen? Riva och bygga nytt, renovera eller finns det ett tredje alternativ? Kanske präglas din lösning av miljötänkande samtidigt som den också måste vara ekonomiskt försvarbar. Du kan komplettera med en kurs i fastighetsförmedling för att även få behörighet som fastighetsmäklare. I specialiseringen Fastighetsmarknaden läser du kurser inom fastighetsutveckling, men välja sedan fler kurser inom nationalekonomi och matematisk statistik. Du lär dig att göra analyser av fastighetsmarknadens svängningar och tendenser. Inom Geografisk informationsteknik fokuserar du på hur man bygger upp och använder geografiska data som exempelvis digitala kartor, fastighetsregister, satellitbilder och miljöinformation Exempel på tekniker som studeras är satellitpositionering (t ex GPS), geografiska informationssystem (GIS) och satellitbaserad fjärranalys (d v s fotografier tagna från satelliter). Geografisk informationsteknik är idag vanlig inom samhällsplanering, miljöanalys och kommersiella tillämpningar. En särskild specialisering är att läsa kurser i Danmark under 1,5 år. Du läser då tillsammans med de danska landinspektørstudenterna, i Aalborg eller i Köpenhamn, för att även få en dansk examen, dvs en dubbelexamen som civilingenjör i lantmäteri och landinspektør. Framtiden Arbetsmarknaden är mycket ljus, med mycket låg arbetslöshet. De flesta civilingenjörsutbildningar har liknande framtidsutsikter. Inom lantmäteriområdet ser vi också att det långsiktigt kommer att finnas en stor brist. Utbildningen är mångsidig och färdigutbildade är attraktiva inom många arbetsområden. Arbete inom den privata sektorn är idag lika vanligt som arbete i stat och kommun. En del arbetar utomlands. Juridik Miljö, bygg- & anläggningsteknik Matematisk statistik Geografiska informations-system Mät- & kartteknik Fastighetsteknik Programmering Teknologie kandidatexamen Fastighetsekonomi Fastighetsvärdering Fastighetsbildning Valbara kurser Civilingenjör Specialiseringar inom : Fastighetsrätt Stadsutveckling Fastighetsutveckling Fastighetsmarknaden Geografisk informationsteknik Landinspektør Valfria kurser Mastersexamen Kristian Isberg student Jag valde lantmäteriprogrammet för att jag var intresserad av stadsplanering och kartor. Det dröjde inte länge förrän jag insåg att möjligheterna var mycket större än så, allt relaterat till fastigheter är vår potentiella arbetsmarknad. Upplägget på programmet är unikt, vi studerar i tematerminer tätt tillsammans med samma klasskamrater genom hela utbildningen vilket gör sammanhållningen på lantmäteriprogrammet till något speciellt. Att studera utomlands var något som jag alltid sett fram emot och jag tog chansen att åka som utbytesstudent två terminer till University of Auckland på Nya Zeeland. Att studera på andra sidan jorden i ett land med en annan mentalitet och med mängder av äventyrsaktiviteter var enormt stimulerande. Under mitt ubytesår insåg jag även att utsikterna för arbete utomlands är mycket goda!

20 / Civilingenjörsutbildning / Lund 38 3 Ekosystemteknik/Environmental Engineering > Master of Science in Engineering, Environmental Engineering > > Ekosystemteknik/ Environmental Engineering 3 hp 5 år Maria Hellström Project Manager Sustainability, Sony Ericsson Varför söka till Ekosystemteknik/Environmental Engineering vid LTH? Utbildningen i Ekosystemteknik ger en unik bredd där samspelet mellan teknik, naturvetenskap och miljö står i fokus. Att vara tekniker och samtidigt ha förståelse för naturen och dess mekanismer gör att vi Ekosystemtekniker har en exklusiv och efterfrågad kompetens på arbetsmarknaden! Den stora potentialen att skräddarsy sitt eget avslutningsår gjorde i mina ögon programmet än mer attraktivt eftersom det skapar möjligheter till fördjupning i ett annars brett program. Utbildningen har även den stora fördelen att kunna utnyttja lärarkompetens från hela LTH. Dessutom är det trevligt att läsa en teknisk utbildning där det är jämn fördelning mellan tjejer och killar! Idag arbetar jag som Project Manager Sustainability på Sony Ericsson i Lund. Min uppgift är att driva projektet Supply Chain Greenhouse som syftar till att minimera miljö- och klimatpåverkan från Sony Ericssons produkters hela livscykel. Jag har dessutom ansvar för att säkerställa att förhållandena på Sony Ericssons fabriker följer de sociala krav som företaget ställer på sina underleverantörer. Arbetet är mycket varierat och utvecklande och jag är väldigt glad att jag valde att läsa en utbildning som gett mig möjligheten till att jobba med något som känns så relevant! Det är väldigt tillfredsställande att kunna gå hem för dagen och veta att man gjort en insats för vår miljö! En bred utbildning där samspelet mellan teknik, naturvetenskap och miljö är ett genomgående tema. Mångfald i kursupplägg och examinationsformer. Flera kurser ges med engelska som undervisningsspråk. Jämn fördelning bland kvinnor och män på utbildningen. God stämning och sammanhållning bland studenter. Årskurs Fysik och kemi Ekologi Geovetenskap Ingrid Cornander hållbarhetskonsult, Hyder Consulting, Sydney Min första riktiga kontakt med arbetsmarknaden fick jag på sommaren, efter mitt tredje år på Ekosystemteknik Jag praktiserade då på ett miljökonsultföretag i Los Angeles. Detta gav mersmak på utlandsarbete så efter att ha avslutat mitt fjärde år skrev jag mitt examensarbete på ett energiföretaget i Sydney I oktober 4 började jag på miljökonsultföretaget Nolan-ITU i Sydney. Företaget är väldigt specialiserat och vi arbetar till största del med avfall och hållbarhetsfrågor med myndigheter, företag och organisationer som kunder. Projekten jag arbetat med har inneburit beräkningar och projektioner av avfalls- och återvinningsmängder liksom analyser och utredningar av anläggningar för farligt avfall och miljöutredningar för förpackningar. Vidare har jag arbetat med livscykelanalyser av olika anläggningsalternativ för behandling av farligt avfall, beräkningar av miljövinst av återvinning samt massbalanser för en anaerob komposteringsanläggning för osorterat hushållsavfall. Det är ett väldigt varierande och givande arbete i en spännande och annorlunda miljö. Nolan-ITU blev i september 5 uppköpt av Hyder Consulting. Mina uppgifter på Hyder är i stort samma som tidigare men sammanslagningen innebar också möjligheter att arbeta med miljöledning och miljökonsekvensanalyser Tobias Karmstig miljöingenjör, Eolus Vind AB För mig var det naturligt att studera vidare inom områdena natur/miljö/teknik, eftersom det var dessa ämnesområden som jag fann mest intressanta och spännande på gymnasiet. Att det i framtiden sannolikt kommer att finnas stor efterfrågan på ingenjörer med kunskaper inom dessa områden, var också någonting som hade betydelse för mitt val av utbildning. Efter grundkurser, fördjupningskurser inom miljösystemanalys samt efter ett examensarbete som behandlade miljöarbetet vid Friidrotts-EM år 6, tog jag så ut min civilingenjörsexamen i december 6. Sedan januari 7 arbetar jag som miljöingenjör på Eolus Vind AB. Bolaget har som affärsidé att etablera, förvalta och sälja vindkraftsanläggningar. Jag ansvarar bland annat för att undersöka och utvärdera möjliga etableringsplatser, att ta fram miljökonsekvensbeskrivningar samt att handha kontakter med myndigheter, allmänhet, media etc. Det faktum att Ekosystemteknik är en väldigt bred utbildning har jag upplevt som en tillgång i mitt arbete. Vidare så har jag i mitt arbete stor nytta av de fördjupningskurser som jag läst. Sammantaget så tror jag inte att något annat utbildningsprogram hade kunnat ge mig bättre förutsättningar för att göra ett bra arbete som miljöingenjör, än vad som Ekosystemteknik gett mig. Ingemar Clementsson student Kunskapen och ideérna som finns inom högskolan är det bästa med LTH. Det finns möjlighet att syssla med så många intressanta ämnesområden och människor. Det bästa med Ekosystemteknik är att det ger en civilingenjörskompetens samtidigt som att programmet är gränsöverskridande vad det gäller ämnesområden. Plus att man känner att man får verktygen för att faktiskt kunna göra något på riktigt. Jag valde att utbilda mig till civilingenjör för att lära mig använda tekniska lösningar på ett smart sätt. 1 Årskurs Årskurs 3 Årskurs 4 & 5 Mekanik Kemi Molekylär cellbiologi Teknologie kandidatexamen och statistik Strömmninglära och masstransport Miljösystem och ekonomi Reglerteknik Självständigt arbete för kandidatexamen Civilingenjör Specialiseringar inom t ex: Energisystem Miljösystemanalys Processteknik/kemi Vattenresurhantering Naturvård med ekotoxikologi Vattenvård med ekotoxikologi Valfria kurser Mastersexamen Utbildningen Utbildningen består av en grundläggande del på tre år och en fördjupande del om två år. I den grundläggande delen kombineras ämnen som kemi, ekologi, geologi, mikrobiologi, hydrologi och miljösystem med både teknikämnen och basämnen i civilingenjörsutbildningen matematik, statistik och fysik. Träningen i systematisk problemlösning blir alltmer avancerad för varje årskurs. Under den avslutande, fördjupande delen har studenterna stor frihet att utforma sin egen specialisering genom att själva välja kurser inom LTH och övriga delar av Lunds universitet. Många studenter läser kurser eller gör sitt examensarbete utomlands. Specialiseringar Studenten utformar sin egen fördjupning i samråd med programledningen. Det breda kursutbudet vid LTH och Lunds universitet ger unika möjligheter och följande specialiseringar finns: Energisystemanalys För att skapa uthålliga energisystem krävs förutom kunskaper om miljöproblemen i sig även insikter i både energi- och miljöteknik och samhällsfrågor. Energisystemanalys ger en bra bakgrund för att arbeta med energifrågor och du har möjlighet att fördjupa dig både mot systemanalys och teknik. Nina Reistad universitetslektor Miljösystemanalys Kunskap och skicklighet i att hantera metoder inom miljömanagement som Livscykelanalys, Miljöledning och Miljö konsekvensbeskrivning efterfrågas inom offentlig förvaltning och i näringslivet. Specialiseringen bygger vidare på studenternas tidigare kunskaper om miljö- och hållbarhetsfrågor och ger teoretisk och praktisk kunskap om metoderna. Naturvård med ekotoxikologi Naturen påverkas av samhällets utveckling och användningen av miljögifter. Specialiseringen ger kunskaper för att analysera och åtgärda de problem som kan uppkomma. Ekotoxikologin presenterar ett helhetsperspektiv på miljögifter med allt från spridning till effekter på celler, organismer och ekosystem. Processdesign En effektiv tillverkningsprocess är en förutsättning för framställning av alla konkurrenskraftiga produkter, från färger och läkemedel till baskemikalier. Processdesign ger de kunskaper och färdigheter som krävs för arbete med processfrågor inom drift, produktutveckling och industriellt miljöskyddsarbete. Vattenvård med ekotoxikologi Den akvatiska miljön påverkas av samhällets utveckling och användningen av miljögifter. Specialiseringen ger, förutom ett helhetsperspektiv på miljögifter, kunskaper om vatten som naturresurs och träning i hantering av vattenvårdsproblem. Vattenresurshantering Människans vattenhantering är avgörande för många av de stora miljöfrågorna och samtidigt förutsättning för en bra samhällsutveckling. Vattenresurshantering ger kunskaper om grundvatten, ytvatten och VA-teknik och förbereder för arbete med både tekniska och naturliga vattensystem. All undervisning sker på engelska inslaget av internationella studenter är stort. Framtiden Efter examen som civilingenjör i Ekosystemteknik / Environmental Engineering har du många intressanta möjligheter. Du kan välja att jobba för privata eller offentliga arbetsgivare, hos små konsultföretag eller på stora industriföretag, i kommuner eller forskningsinstitut. Forskarbanan står öppen och det finns stora möjligheter att arbeta internationellt. Miljöteknik och hållbar utveckling kommer under en lång framtid att vara viktiga områden och som civilingenjör i ekosystemteknik kommer du att kunna göra betydelsefulla insatser. Det är fantastiskt stimulerande att arbeta med en utbildning som är särskilt lyckad i så många avseenden. Miljöfrågorna är vår tids största tekniska utmaning. Att civilingenjörer i Environmental Engineering är eftertraktade visar att behovet är stort av tekniker som är specialister och som samtidigt ser helheter. Våra civilingenjörer arbetar i den privata och offentliga sektorn och i andra länder. Vi lärare har haft stora möjligheter att arbeta både med utbildningens innehåll och former. Vi lägger stor vikt vid att studenterna utvecklar en god förmåga att också använda beräkningsverktyg, modellera och simulera, kommunicera, skriva och presentera.

Kemi vid Lunds universitet SOPHIE MANNER STUDIEREKTOR KILU

Kemi vid Lunds universitet SOPHIE MANNER STUDIEREKTOR KILU Kemi vid Lunds universitet SOPHIE MANNER STUDIEREKTOR KILU ÅTTA FAKULTETER Och mer än 30 världsledande forskningsområden Åtta fakulteter på tre campus Ekonomihögskolan Humanistiska och teologiska fakulteterna

Läs mer

LTHs UTBILDNINGS- KATALOG 2008

LTHs UTBILDNINGS- KATALOG 2008 Lunds Tekniska Högskola LTHs UTBILDNINGS- KATALOG 2008 www.lth.se Välkommen till Lund Utbildningen vid Lunds Tekniska Högskola, LTH, utvecklas ständigt för att möta nya krav som ställs av studenter, näringsliv

Läs mer

Civilingenjör i teknisk design, 300 hp

Civilingenjör i teknisk design, 300 hp 1 (7) Utbildningsplan för: Civilingenjör i teknisk design, 300 hp Master of Science in Engineering - Industrial Design Engineering, 300 credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer

Läs mer

Utbildningsplan Civilingenjör Teknisk fysik och elektroteknik för läsåret 2015/2016

Utbildningsplan Civilingenjör Teknisk fysik och elektroteknik för läsåret 2015/2016 Utbildningsplan Civilingenjör Teknisk fysik och elektroteknik för läsåret 2015/2016 Master Programme in Engineering Physics and Electrical Engineering Utbildningsplanen är reviderad 2014-11-06 av Enhetschef

Läs mer

Lunds Tekniska Högskola LUNDS UNIVERSITET

Lunds Tekniska Högskola LUNDS UNIVERSITET Lunds Tekniska Högskola LUNDS UNIVERSITET Lunds universitet - i världsklass Grundat 1666 47 000 studenter Nästan 3 000 forskarstuderande 6 800 anställda Omkring 650 professorer 800 universitetslektorer

Läs mer

Lunds Tekniska Högskola LUNDS UNIVERSITET

Lunds Tekniska Högskola LUNDS UNIVERSITET Lunds Tekniska Högskola LUNDS UNIVERSITET Ett universitet i världsklass Grundat 1666 47 000 studenter 7 200 anställda - 820 professorer - 4 030 lärare/forskare och doktorander Omsättning 6,9 miljarder

Läs mer

Civilingenjör i elektroniksystem, 300 hp

Civilingenjör i elektroniksystem, 300 hp 1 (7) Utbildningsplan för: Civilingenjör i elektroniksystem, 300 hp Master of Science in Electronics Engineering, 300 higher education credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer

Läs mer

Fakulteten för teknik och naturvetenskap. Utbildningsplan. Matematisk modellering

Fakulteten för teknik och naturvetenskap. Utbildningsplan. Matematisk modellering Fakulteten för teknik och naturvetenskap Utbildningsplan Matematisk modellering Programkod: Programmets benämning: Högskolepoäng/ECTS: 120 Beslut om inrättande: NANAT Inriktningar FSGR, RESI, TIMA Matematisk

Läs mer

Civilingenjör Teknisk fysik. Master of Science in Engineering Physics

Civilingenjör Teknisk fysik. Master of Science in Engineering Physics Dnr: HNT 2016/337 Fakulteten för hälsa, natur- och teknikvetenskap Utbildningsplan Civilingenjör Teknisk fysik Programkod: Programmets benämning: Högskolepoäng/ECTS: Beslut om inrättande: Undervisningsspråk:

Läs mer

Fakulteten för teknik- och naturvetenskap. Utbildningsplan TGHEL, TGHME, TGHML

Fakulteten för teknik- och naturvetenskap. Utbildningsplan TGHEL, TGHME, TGHML Fakulteten för teknik- och naturvetenskap Utbildningsplan Programkod: Beslut om inrättande: Programmets benämning: TGHEL, TGHME, TGHML Utbildningsplanen är fastställd av fakultetsnämnden för teknik- och

Läs mer

HÖGSKOLEINGENJÖRSEXAMEN BACHELOR OF SCIENCE IN ENGINEERING

HÖGSKOLEINGENJÖRSEXAMEN BACHELOR OF SCIENCE IN ENGINEERING Lokal examensbeskrivning Dnr: 540-420-10 Sid 1 (5) HÖGSKOLEINGENJÖRSEXAMEN BACHELOR OF SCIENCE IN ENGINEERING INRIKTNING: ELEKTRONIK SPECIALISATION: ELECTRONIC ENGINEERING 1 Fastställande Denna examensbeskrivning

Läs mer

Civilingenjör i teknisk design, 300 hp

Civilingenjör i teknisk design, 300 hp 1 (7) Utbildningsplan för: Civilingenjör i teknisk design, 300 hp Master of Science in Engineering - Industrial Design Engineering, 300 Higher Education Credits Allmänna data om programmet Programkod Tillträdesnivå

Läs mer

Automationsingenjör, 180 hp

Automationsingenjör, 180 hp 1 (5) Utbildningsplan för: Automationsingenjör, 180 hp Automation Engineering, 180 Credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer TAUMG Grundnivå MIUN 2013/2104 Högskolepoäng

Läs mer

Lunds Tekniska Högskola 2015 LUNDS UNIVERSITET

Lunds Tekniska Högskola 2015 LUNDS UNIVERSITET Lunds Tekniska Högskola 2015 LUNDS UNIVERSITET Lunds universitet Grundat 1666 42 000 studenter 7 500 anställda - 830 professorer - 4 300 lärare/forskare och doktorander Omsättning 7,8 miljarder 1/3 utbildning,

Läs mer

Antal behöriga sökande 1a hand

Antal behöriga sökande 1a hand Behöriga sökande och antagna till samtliga programutbildningar HT2008, urval 2 Sorterat efter lärosäte Till många utbildningar används andra urvalsgrupper än de nationella. Här har dock alla dessa fått

Läs mer

Antal behöriga sökande 1a hand. Antal behöriga sökande urvalsgrupp. Antal behöriga sökande 1a hand. Antal platser inkl. överintag

Antal behöriga sökande 1a hand. Antal behöriga sökande urvalsgrupp. Antal behöriga sökande 1a hand. Antal platser inkl. överintag Behöriga sökande och antagna till samtliga programutbildningar HT2008, urval 1 Sorterat efter lärosäte Till många utbildningar används andra urvalsgrupper än de nationella. Här har dock alla dessa fått

Läs mer

Fakulteten för ekonomi, kommunikation och IT. Utbildningsplan. Högskoleingenjörsprogrammet i datateknik TGDDI

Fakulteten för ekonomi, kommunikation och IT. Utbildningsplan. Högskoleingenjörsprogrammet i datateknik TGDDI Fakulteten för ekonomi, kommunikation och IT Utbildningsplan Högskoleingenjörsprogrammet i datateknik Programkod: Programmets benämning: Inriktningar: TGDDI Högskoleingenjörsprogrammet i datateknik Study

Läs mer

Maskiningenjör - produktutveckling, 180 hp

Maskiningenjör - produktutveckling, 180 hp 1 (6) Utbildningsplan för: Maskiningenjör - produktutveckling, 180 hp Mechanical Engineering - Product Development, 180 Credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer TMPRG

Läs mer

Tekniskt basår CAMPUS HELSINGBORG LUNDS TEKNISKA HÖGSKOLA

Tekniskt basår CAMPUS HELSINGBORG LUNDS TEKNISKA HÖGSKOLA Tekniskt basår CAMPUS HELSINGBORG LUNDS TEKNISKA HÖGSKOLA Tekniskt basår på Campus Helsingborg riktar sig till dig som inte har förkunskaper för att läsa en teknisk högskoleutbildning. Du läser i fräscha

Läs mer

Tekniskt basår CAMPUS HELSINGBORG LUNDS TEKNISKA HÖGSKOLA

Tekniskt basår CAMPUS HELSINGBORG LUNDS TEKNISKA HÖGSKOLA Tekniskt basår CAMPUS HELSINGBORG LUNDS TEKNISKA HÖGSKOLA Tekniskt basår på Campus Helsingborg riktar sig till dig som inte har förkunskaper för att läsa en teknisk högskoleutbildning. Du läser i fräscha

Läs mer

Sportteknologi maskiningenjör inom innovativ produktutveckling, 180 hp

Sportteknologi maskiningenjör inom innovativ produktutveckling, 180 hp 1 (6) Utbildningsplan för: Sportteknologi maskiningenjör inom innovativ produktutveckling, 180 hp Sports Technology Mechanical Engineering within Innovative Product Development, 180 Credits Allmänna data

Läs mer

TEKNIKPROGRAMMET Mål för programmet

TEKNIKPROGRAMMET Mål för programmet TEKNIKPROGRAMMET Mål för programmet Teknikprogrammet är ett högskoleförberedande program och utbildningen ska i första hand förbereda för vidare studier i teknikvetenskap och naturvetenskap men också i

Läs mer

Civilingenjör i industriell ekonomi, 300 hp

Civilingenjör i industriell ekonomi, 300 hp 1 (8) Utbildningsplan för: Civilingenjör i industriell ekonomi, 300 hp Master of Science in Industrial Engineering and Management, 300 credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer

Läs mer

Elkraftingenjör, 180 hp

Elkraftingenjör, 180 hp 1 (6) Utbildningsplan för: Elkraftingenjör, 180 hp Electric Power Engineering, 180 Credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer TEKRG Grundnivå MIUN 2010/1733 Högskolepoäng

Läs mer

Masterprogram i kemi 2015/2016

Masterprogram i kemi 2015/2016 Masterprogram i kemi 2015/2016 120 HP UPPSALA CAMPUS 100% Uppsala universitet erbjuder en högklassig utbildning i kemi på avancerad nivå, nära kopplad till världsledande forskning. Tack vare denna forskningsanknytning

Läs mer

Civilingenjör Teknisk fysik och elektroteknik Inriktning: Beräkningsteknik och fysik Antagna Höst 2014

Civilingenjör Teknisk fysik och elektroteknik Inriktning: Beräkningsteknik och fysik Antagna Höst 2014 UTBILDNINGSPLAN LÄSÅRET 2016/2017 Civilingenjör Teknisk fysik och elektroteknik Inriktning: Beräkningsteknik och fysik Antagna Höst 2014 BESLUTSDATUM 2015-11-02 DIARIENUMMER 12-15 BESLUTSFATTARE Enhetschef

Läs mer

U T B I L D N I N G S P L A N

U T B I L D N I N G S P L A N Dnr: 1053/2008-515 Utbildningsnämnden för grundnivå och avancerad nivå inom matematik, naturvetenskap och teknik U T B I L D N I N G S P L A N erprogrammet, 180 högskolepoäng Programme in Physics, 180

Läs mer

Teknikprogrammet (TE)

Teknikprogrammet (TE) Teknikprogrammet (TE) Teknikprogrammet (TE) ska utveckla elevernas kunskaper om och färdigheter i teknik och teknisk utveckling. Efter examen från programmet ska eleverna ha kunskaper för högskolestudier

Läs mer

Civilingenjör i teknisk kemi, 300 hp

Civilingenjör i teknisk kemi, 300 hp 1 (7) Utbildningsplan för: Civilingenjör i teknisk kemi, 300 hp Master of Science in Chemical Engineering, 300 Credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer TCTKM Grundnivå

Läs mer

Elkraftingenjör, 180 hp

Elkraftingenjör, 180 hp 1 (5) Utbildningsplan för: Elkraftingenjör, 180 hp Electric Power Engineering, 180 Credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer TEKRG Grundnivå MIUN 2010/1733 Högskolepoäng

Läs mer

På gång: Utbildningar i kemiteknik vid Karlstads universitet. Christophe Barbier Karlstad University 11 juni 2013

På gång: Utbildningar i kemiteknik vid Karlstads universitet. Christophe Barbier Karlstad University 11 juni 2013 På gång: Utbildningar i kemiteknik vid Karlstads universitet Christophe Barbier Karlstad University 11 juni 2013 Karlstad 2013 Omorganisation 2 fakulteter Humaniora & samhällsvetenskap + Hälsa, Natur-

Läs mer

ITinstitutionen bit för bit

ITinstitutionen bit för bit ITinstitutionen bit för bit Institutionen för informations teknologi: världs ledande med en unik bredd och ett djupt vetenskapligt kunnande INSTITUTIONEN FÖR INFORMATIONS TEKNOLOGI unik bredd och unikt

Läs mer

Fakulteten för ekonomi, kommunikation och IT. Utbildningsplan. Högskoleingenjörsprogrammet i datateknik

Fakulteten för ekonomi, kommunikation och IT. Utbildningsplan. Högskoleingenjörsprogrammet i datateknik Fakulteten för ekonomi, kommunikation och IT Utbildningsplan Högskoleingenjörsprogrammet i datateknik Programkod: Programmets benämning: TGDDI Högskoleingenjörsprogrammet i datateknik Study Programme in

Läs mer

Energiingenjör, 180 hp

Energiingenjör, 180 hp 1 (5) Utbildningsplan för: Energiingenjör, 180 hp Energy Engineering, 180 Higher Education Credits Allmänna data om programmet Programkod Tillträdesnivå Diarienummer TENIG Grundnivå MIUN 2009/1510 Högskolepoäng

Läs mer

Utbildningsplan för högskoleingenjörsprogrammen. 180 högskolepoäng Uppsala universitet

Utbildningsplan för högskoleingenjörsprogrammen. 180 högskolepoäng Uppsala universitet TEKNAT 2008/319 Utbildningsplan för högskoleingenjörsprogrammen 180 högskolepoäng Uppsala universitet 2009/2010 Utbildningsplanen är fastställd av teknisk-naturvetenskapliga fakultetsnämnden 2009-03-16

Läs mer

Utbildningsplan för kandidatprogram i fysik, 180

Utbildningsplan för kandidatprogram i fysik, 180 GÖTEBORGS UNIVERSITET Naturvetenskapliga fakultetsnämnden Utbildningsplan för kandidatprogram i fysik, 180 högskolepoäng Grundnivå Bachelor of Science in Physics 1. Beslut om fastställande Utbildningsplan

Läs mer

INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, 120 POÄNG Programme for Project Management in Engineering, 120 points

INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, 120 POÄNG Programme for Project Management in Engineering, 120 points UTBILDNINGSPLAN INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, 120 POÄNG Programme for Project Management in Engineering, 120 points Utbildningsplanen är fastställd av fakultetsnämnden för medicin, naturvetenskap

Läs mer

Civilingenjör Maskinteknik. Programmets benämning: Master of Science in Mechanical Engineering

Civilingenjör Maskinteknik. Programmets benämning: Master of Science in Mechanical Engineering Dnr: HNT 2016/332 Fakulteten förhälsa, natur- och teknikvetenskap Utbildningsplan Civilingenjör Maskinteknik Programkod: Programmets benämning: TACMA Civilingenjör Maskinteknik Master of Science in Mechanical

Läs mer

Programmets benämning: Master of Science in Computer Engineering

Programmets benämning: Master of Science in Computer Engineering Dnr: HNT 2016/335 Fakulteten för hälsa, natur- och teknikvetenskap Utbildningsplan Civilingenjör Datateknik Programkod: Programmets benämning: TACDA Civilingenjör Datateknik Master of Science in Computer

Läs mer

Grundutbildning vid EIT. Lunds universitet

Grundutbildning vid EIT. Lunds universitet Grundutbildning vid EIT Lunds universitet Organisatoriskt 431 helårsstudenter i uppdrag 2010 71 kurser under 2010/2011 19 heltidsekvivalenter lärare (fördelat på totalt 93 lärare) 3 kursadministratörer

Läs mer

Högskoleingenjör i maskinteknik

Högskoleingenjör i maskinteknik 1(7) Högskoleingenjör i maskinteknik 180 hp Mechanical Engineering, B Sc in Engineering 6IMAS Gäller från: Fastställd av Fastställandedatum LINKÖPINGS UNIVERSITET 2(7) Förkunskapskrav Grundläggande behörighet

Läs mer

INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, INRIKTNING AUTOMATISERINGSTEKNIK, DATATEKNIK OCH ELEKTROTEKNIK, 120 POÄNG

INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, INRIKTNING AUTOMATISERINGSTEKNIK, DATATEKNIK OCH ELEKTROTEKNIK, 120 POÄNG UTBILDNINGSPLAN INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, INRIKTNING AUTOMATISERINGSTEKNIK, DATATEKNIK OCH ELEKTROTEKNIK, 120 POÄNG Programme for Project Management in Engineering, 120 points Fastställande

Läs mer

Lunds Tekniska Högskola

Lunds Tekniska Högskola Demografisk enkät inför studiestart Lund Män september 2012 William Grevatt & Associates Lund - Män Number of Surveys: 755 2. Hemorten ligger i: Skåne 53% Blekinge 3% Småland 8% Halland 5% Göteborg med

Läs mer

80009 Högskoleingenjörsutbildning i elektroteknik med automat 43 LU Civilingenjörsutbildning i medicin och teknik 1 2

80009 Högskoleingenjörsutbildning i elektroteknik med automat 43 LU Civilingenjörsutbildning i medicin och teknik 1 2 Program som studenten är antagen till Program som X antal studenter som blev antagna till det andra program helst ville bli antagen till (prio=1) Tolkning: Av de 62 som i urvalet blev antagna till Högskoleingenjörsprogrammet

Läs mer

UTBILDNINGSPLAN. Masterprogram i matematik och modellering, 120 högskolepoäng. Master programme in Mathematics and Modelling, 120 ECTS Credits

UTBILDNINGSPLAN. Masterprogram i matematik och modellering, 120 högskolepoäng. Master programme in Mathematics and Modelling, 120 ECTS Credits Dnr: 1026/2006-510 Fakultetsnämnden för matematik, naturvetenskap och teknik UTBILDNINGSPLAN Masterprogram i matematik och modellering, 120 högskolepoäng Master programme in Mathematics and Modelling,

Läs mer

Utbildningsplan Civilingenjör Maskinteknik för läsåret 2007/2008

Utbildningsplan Civilingenjör Maskinteknik för läsåret 2007/2008 Utbildningsplan Civilingenjör Maskinteknik för läsåret 2007/2008 MSc Programme in Mechanical Engineering Utbildningsplanen är fastställd 2006-11-16 av Dekanus Teknisk Fakultetsnämnd. Antagen H07 Denna

Läs mer

Naturvetenskapsprogrammet (NA)

Naturvetenskapsprogrammet (NA) Naturvetenskapsprogrammet (NA) Naturvetenskapsprogrammet (NA) ska utveckla elevernas kunskaper om sammanhang i naturen, om livets villkor, om fysikaliska fenomen och skeenden och om kemiska processer.

Läs mer

CIVILINGENJÖRSEXAMEN MASTER OF SCIENCE IN ENGINEERING

CIVILINGENJÖRSEXAMEN MASTER OF SCIENCE IN ENGINEERING Lokal examensbeskrivning Dnr: 541-2072-10 Sid 1 (5) CIVILINGENJÖRSEXAMEN MASTER OF SCIENCE IN ENGINEERING INRIKTNING: TEKNISK DATAVETENSKAP SPECIALISATION: COMPUTING SCIENCE AND ENGINEERING 1 Fastställande

Läs mer

Utbildningsplan Civilingenjör Maskinteknik för läsåret 2015/2016

Utbildningsplan Civilingenjör Maskinteknik för läsåret 2015/2016 Utbildningsplan Civilingenjör Maskinteknik för läsåret 2015/2016 Master Programme in Mechanical Engineering Utbildningsplanen är reviderad 2014-12-16 av Enhetschef för utbildnings- och forskningsenheten.

Läs mer

Beslut om fastställande: - - Behörighetskrav: -

Beslut om fastställande: - - Behörighetskrav: - Dnr: HS 2014/146 Fakulteten för humaniora och samhällsvetenskap Utbildningsplan IT-design Programkod: SGITD Beslut om fastställande: - - Programmets benämning: IT-design Study programme in IT-Design Högskolepoäng:

Läs mer

Högskoleingenjörsutbildning i elektroteknik, Södertälje Degree Programme in Electrical Engineering 180,0 högskolepoäng

Högskoleingenjörsutbildning i elektroteknik, Södertälje Degree Programme in Electrical Engineering 180,0 högskolepoäng Utbildningsplan Högskoleingenjörsutbildning i elektroteknik, Södertälje Degree Programme in Electrical Engineering 180,0 högskolepoäng Gäller för antagna till utbildningen fr o m HT10. Utbildningens mål

Läs mer

Utbildningsplan för Matematiska vetenskaper, masterprogram (N2MAT), 120 hp

Utbildningsplan för Matematiska vetenskaper, masterprogram (N2MAT), 120 hp Dnr G 2015/309 NATURVETENSKAPLIGA FAKULTETEN Utbildningsplan för Matematiska vetenskaper, masterprogram (N2MAT), 120 hp 1. Utbildningsprogrammets benämning och omfattning Matematiska vetenskaper, masterprogram,

Läs mer

UTBILDNINGSPLAN. Högskoleingenjörsutbildning i elektroteknik, 120 poäng. Electrical Engineering Programme, 180 ECTS

UTBILDNINGSPLAN. Högskoleingenjörsutbildning i elektroteknik, 120 poäng. Electrical Engineering Programme, 180 ECTS Dnr: 207/2005-510 Grundutbildningsnämnden för matematik, naturvetenskap och teknik UTBILDNINGSPLAN Högskoleingenjörsutbildning i elektroteknik, 120 poäng Electrical Engineering Programme, 180 ECTS Ansvarig

Läs mer

Examensarbeten och utlandsstudier inom civilingenjörsutbildning vid LTH 2000-2004

Examensarbeten och utlandsstudier inom civilingenjörsutbildning vid LTH 2000-2004 Examensarbeten och utlandsstudier inom civilingenjörsutbildning vid LTH 2000-2004 Sammanställning av enkätundersökning som underlag inför Högskoleverkets programutvärdering 2005 Gerd Olsson Per Warfvinge

Läs mer

INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, 120 POÄNG Programme for Project Management in Engineering, 120 points

INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, 120 POÄNG Programme for Project Management in Engineering, 120 points UTBILDNINGSPLAN INGENJÖRSPROGRAMMET FÖR PROJEKTLEDNING, 120 POÄNG Programme for Project Management in Engineering, 120 points Utbildningsprogrammet inrättades den 31 november 2001 av fakultetsnämnden för

Läs mer

Högskoleingenjörsutbildning i maskinteknik, Södertälje Degree Programme in Mechanical Engineering 180,0 högskolepoäng

Högskoleingenjörsutbildning i maskinteknik, Södertälje Degree Programme in Mechanical Engineering 180,0 högskolepoäng Utbildningsplan Högskoleingenjörsutbildning i maskinteknik, Södertälje Degree Programme in Mechanical Engineering 180,0 högskolepoäng Gäller för antagna till utbildningen fr o m HT08. Utbildningens mål

Läs mer

Avdelningen för informations- och kommunikationssystem Fakulteten för naturvetenskap, teknik och medier

Avdelningen för informations- och kommunikationssystem Fakulteten för naturvetenskap, teknik och medier 1 (6) Utbildningsplan för: Datateknik, 180 hp Computer Science Allmänna data om programmet Programkod Tillträdesnivå Diarienummer TDATG Grundnivå 2007/127 Högskolepoäng 180 Ansvarig avdelning Ansvarig

Läs mer

Utbildningsprogram vid Avdelningen för Energi-, Miljö- och Byggteknik

Utbildningsprogram vid Avdelningen för Energi-, Miljö- och Byggteknik Utbildningsprogram vid Avdelningen för Energi-, Miljö- och Byggteknik Avdelningen har huvudansvar för programmen: Civilingenjör i Energi- och Miljöteknik Högskoleingenjör i Byggteknik Högskoleingenjör

Läs mer

Utbildningsplan för Masterprogram i matematiska vetenskaper (N2MAT)

Utbildningsplan för Masterprogram i matematiska vetenskaper (N2MAT) GÖTEBORGS UNIVERSITET Naturvetenskapliga fakultetsnämnden Utbildningsplan för Masterprogram i matematiska vetenskaper (N2MAT) 120 högskolepoäng Avancerad nivå Two-year Masters Program in Mathematical Sciences

Läs mer

Lunds Tekniska Högskola

Lunds Tekniska Högskola Demografisk enkät inför studiestart Helsingborg october 2009 William Grevatt & Associates Helsingborg Number of Surveys: 256 2. Hemorten ligger i: Skåne 79% Blekinge 2% Småland 3% Halland 2% Göteborg

Läs mer

Fakultetsnämnden för naturvetenskap och teknik Institutionen för datavetenskap, fysik och matematik

Fakultetsnämnden för naturvetenskap och teknik Institutionen för datavetenskap, fysik och matematik Dnr: HL/2009 0168 Utbildningsplan Fakultetsnämnden för naturvetenskap och teknik Institutionen för datavetenskap, fysik och matematik Datateknik, högskoleingenjör, 180 högskolepoäng Computer Engineering

Läs mer

Masterprogram i biomedicin

Masterprogram i biomedicin 1 Medicinska fakultetsstyrelsen Masterprogram i biomedicin 120 högskolepoäng (hp) Nivå A LADOK VABME Programbeskrivning Masterprogrammet utgörs av kurser inom huvudområdet biomedicin. Programmet har en

Läs mer

CIVILINGENJÖRSEXAMEN DEGREE OF MASTER OF SCIENCE IN ENGINEERING

CIVILINGENJÖRSEXAMEN DEGREE OF MASTER OF SCIENCE IN ENGINEERING Sida 1 av 5 CIVILINGENJÖRSEXAMEN DEGREE OF MASTER OF SCIENCE IN ENGINEERING Fastställande Denna bilaga till den lokala examensordningen är beslutad av Rektor 2008-12-15 och uppdateras fortlöpande, efter

Läs mer

Blandade omdömen av utbildning i ingenjörs- och teknikvetenskap vid Umeå universitet

Blandade omdömen av utbildning i ingenjörs- och teknikvetenskap vid Umeå universitet Sid 1 (17) Blandade omdömen av utbildning i ingenjörs- och teknikvetenskap vid Umeå Civilingenjör- bioteknik energiteknik, interaktionsteknik och design teknisk datavetenskap teknisk fysik Högskoleingenjör-

Läs mer

Utbildningsplan för Matematiska vetenskaper, masterprogram (N2MAT), 120 hp

Utbildningsplan för Matematiska vetenskaper, masterprogram (N2MAT), 120 hp Dnr G 2016/574 NATURVETENSKAPLIGA FAKULTETEN Utbildningsplan för Matematiska vetenskaper, masterprogram (N2MAT), 120 hp Mathematical Sciences, Master s Programme, 120 credits Avancerad nivå/ Second cycle

Läs mer

Utbildningsplan. Maskiningenjör - produktutveckling BSc in Mechanical Engineering - Product Development 180 högskolepoäng

Utbildningsplan. Maskiningenjör - produktutveckling BSc in Mechanical Engineering - Product Development 180 högskolepoäng Utbildningsplan Maskiningenjör - produktutveckling BSc in Mechanical Engineering - Product Development 180 högskolepoäng Ladokkod: TGMAI Version: 1.0 Utbildningsnivå: Grundnivå Fastställd av: Forsknings-

Läs mer

program söndag 23 mars måndag 24 mars

program söndag 23 mars måndag 24 mars program söndag 23 mars måndag 24 mars Välkommen till Öppet hus 2014 Idag kommer du träffa studenter, lärare, studievägledare och ingenjörer som alla finnas här för att du ska få all information och inspiration

Läs mer

80009 Högskoleingenjörsutbildning i elektroteknik med automat 33 LU Civilingenjörsutbildning i elektroteknik 4 12

80009 Högskoleingenjörsutbildning i elektroteknik med automat 33 LU Civilingenjörsutbildning i elektroteknik 4 12 Program som studenten är antagen till Program som X antal studenter som blev antagna till det andra program helst ville bli antagen till (prio=1) Tolkning: Av de 54 som i urvalet blev antagna till Högskoleingenjörsprogrammet

Läs mer

Datavetenskapliga programmet, 180 hp

Datavetenskapliga programmet, 180 hp HÖGSKOLAN I GÄVLE UTBILDNINGSPLAN GRUNDNIVÅ DATAVETENSKAPLIGA PROGRAMMET Programkod: TGDAK Inriktningskod IT-arkitekt: ITAR Inriktningskod visiomatik: VISI Fastställd av NT-nämnden 2006-09-21 Reviderad

Läs mer

Högskoleingenjörsutbildning i datateknik, 180 högskolepoäng. Computer Engineering Programme, 180 Higher Education Credits

Högskoleingenjörsutbildning i datateknik, 180 högskolepoäng. Computer Engineering Programme, 180 Higher Education Credits Dnr: 1048/2007-515 Utbildningsnämnden för grundnivå och avancerad nivå inom matematik, naturvetenskap och teknik Högskoleingenjörsutbildning i datateknik, 180 högskolepoäng Computer Engineering Programme,

Läs mer

Fakulteten för ekonomi, kommunikation och IT. Utbildningsplan SGITD. IT-Designprogrammet. Study programme in IT-Design

Fakulteten för ekonomi, kommunikation och IT. Utbildningsplan SGITD. IT-Designprogrammet. Study programme in IT-Design Fakulteten för ekonomi, kommunikation och IT Utbildningsplan IT-Designprogrammet Programkod: Programmets benämning: Inriktningar: SGITD IT-Designprogrammet Study programme in IT-Design Affärssystem och

Läs mer

Utbildningsplan för Matematikprogrammet (N1MAT) Bachelor s Programme in Mathematics Grundnivå

Utbildningsplan för Matematikprogrammet (N1MAT) Bachelor s Programme in Mathematics Grundnivå Naturvetenskapliga fakulteten Dnr G 2015/59 Utbildningsplan för Matematikprogrammet (N1MAT) Bachelor s Programme in Mathematics Grundnivå 1. Utbildningsprogrammets benämning och omfattning Programmet benämns

Läs mer

Fakulteten för ekonomi, kommunikation och IT. Utbildningsplan SGITD. IT-design. Study programme in IT-Design

Fakulteten för ekonomi, kommunikation och IT. Utbildningsplan SGITD. IT-design. Study programme in IT-Design Fakulteten för ekonomi, kommunikation och IT Utbildningsplan IT-design Programkod: Programmets benämning: Inriktningar: SGITD IT-design Study programme in IT-Design Affärssystem och ekonomi (AFEK) Programvarudesign

Läs mer

CIVILINGENJÖRSEXAMEN MASTER OF SCIENCE IN ENGINEERING

CIVILINGENJÖRSEXAMEN MASTER OF SCIENCE IN ENGINEERING Lokal examensbeskrivning Dnr: 541-2076-10 Sid 1 (5) CIVILINGENJÖRSEXAMEN MASTER OF SCIENCE IN ENGINEERING INRIKTNING: TEKNISK KEMI SPECIALISATION: ENGINEERING CHEMISTRY 1 Fastställande Denna examensbeskrivning

Läs mer

Utbildningspolitiskt program

Utbildningspolitiskt program Utbildningspolitiskt program Innehållsförteckning Skolan 4 Högre utbildning 5 Forskning och forskarutbildning 6 Kompetensutveckling 7 Utbildningspolitiska programmet / 2008-05-09 Skolan Allt börjar i skolan.

Läs mer

Utbildningsplan Civilingenjör Maskinteknik för läsåret 2016/2017

Utbildningsplan Civilingenjör Maskinteknik för läsåret 2016/2017 Utbildningsplan Civilingenjör Maskinteknik för et 2016/2017 Master Programme in Mechanical Engineering Utbildningsplanen är reviderad 2016-05-31 av Chef för Utbildnings- och forskningsenheten. Denna utbildningsplan

Läs mer

U T B I L D N I N G S P L A N

U T B I L D N I N G S P L A N Dnr: 66/2008/515 Grundutbildningsnämnden för matematik, naturvetenskap och teknik U T B I L D N I N G S P L A N Företagsingenjör med inriktning affärssystem och management, 180 högskolepoäng Bachelor of

Läs mer

Nuvarande lön för nyexade studenter. Nuvarande månadslön (meddellön) från bästa till sämsta placeringen.

Nuvarande lön för nyexade studenter. Nuvarande månadslön (meddellön) från bästa till sämsta placeringen. Nuvarande lön för nyexade studenter. Nuvarande månadslön (meddellön) från bästa till sämsta placeringen. Område Ämne Lärosäte Nivå Lön Juridik och samhällsvetenskap Data- och systemvetenskap Uppsala universitet

Läs mer

Lunds Tekniska Högskola

Lunds Tekniska Högskola Demografisk enkät inför studiestart Helsingborg Män oktober 2013 William Grevatt & Associates Helsingborg - Män Number of Surveys: 162 2. Hemorten ligger i: Skåne 73% Blekinge 2% Småland 3% Halland 6%

Läs mer

Utbildningsplan. Fakulteten för teknik

Utbildningsplan. Fakulteten för teknik Dnr: 2014/2309 3.1.1. Utbildningsplan Fakulteten för teknik Matematik och modellering, masterprogram, 120 högskolepoäng Mathematics and Modelling, Master Programme, 120 credits Nivå Avancerad nivå Fastställande

Läs mer

ALUMNIRAPPORT MASKINTEKNIK

ALUMNIRAPPORT MASKINTEKNIK ALUMNIRAPPORT 1993-211 MASKINTEKNIK Sammanställd av Max Berg och Charlotte Röhfors (M-8) Enkät: Magnus Lindqvist Korrekturläst av maskinprogrammets programledning och maskinsektionens styrelse Citat Här

Läs mer

Programschema 2012 LUNDS TEKNISKA HÖGSKOLA LUNDS UNIVERSITET

Programschema 2012 LUNDS TEKNISKA HÖGSKOLA LUNDS UNIVERSITET Programschema 2012 LUNDS TEKNISKA HÖGSKOLA LUNDS UNIVERSITET 2 PROGRAMSCHEMA 2012 PROGRAMSCHEMA 2012 3 Ekosystemteknik Biokemi Biokemi Biokemi Molekylär bioteknik Bioprocess Livsmedel Läkemedel Projektarbete

Läs mer

Att bygga en generell examen

Att bygga en generell examen Att bygga en generell examen - TANKAR OM HUR EN GENERELL EXAMEN FÅR RÄTT INNEHÅLL Anna Selfvén Allmän studievägledare, Lunds universitet Allmän studievägledning LU -Vad kan jag välja utifrån mina intressen?

Läs mer

Utbildningsplan för Masterprogram i Biologi, 120 högskolepoäng

Utbildningsplan för Masterprogram i Biologi, 120 högskolepoäng GÖTEBORGS UNIVERSITET Naturvetenskapliga fakulteten Utbildningsplan för Masterprogram i Biologi, 120 högskolepoäng Master s programme in Biology 1. Beslut om fastställande Utbildningsplan för, masterprogrammet

Läs mer

Utbildning med Steel. Högskoleingenjör Materialteknik

Utbildning med Steel. Högskoleingenjör Materialteknik Utbildning med Steel Högskoleingenjör Materialteknik Högskoleingenjör i Materialteknik är en utbildning som kommer att ge dig ett roligt och omväxlande jobb med möjlighet att göra karriär, fortsätta utvecklas

Läs mer

Hur fungerar ett utbyte? Våga ta steget!

Hur fungerar ett utbyte? Våga ta steget! Sikte på utlandet Våga ta steget! Hur fungerar ett utbyte? Vad finns det egentligen för möjligheter för dig som student vid LTH när du har sikte på utlandet? LTH:s Internationella avdelning tillsammans

Läs mer

Programmets benämning: Civilekonomprogrammet Master of Science in Business and Economics

Programmets benämning: Civilekonomprogrammet Master of Science in Business and Economics Dnr: HS 2014/248 Fakulteten för humaniora och samhällsvetenskap Utbildningsplan Civilekonomprogrammet Programkod: Beslut om fastställande: SACEK 14 4. -04- Programmets benämning: Civilekonomprogrammet

Läs mer

Information från programledningen

Information från programledningen Information från programledningen Paul Stankovski, Programledare Göran Lindell, Bitr. programledare Nora Ekdahl, Programplanerare Roger Berlin, Studie- och karriärvägledare Svar: (Högskoleförordningen

Läs mer

Underlag för kvalitetsbaserad resurstilldelning 2014

Underlag för kvalitetsbaserad resurstilldelning 2014 BESLUT 1(2) Avdelning Datum Reg.nr Analysavdelningen 2013-11-05 511-323-13 Handläggare Magdalena Inkinen 08-563 085 40 magdalena.inkinen@uk-ambetet.se Regeringen Utbildningsdepartementet Underlag för kvalitetsbaserad

Läs mer

UTBILDNINGSPLAN. Högskoleingenjörsutbildning i datateknik, 180 högskolepoäng. Computer Engineering Programme, 180 ECTS Credits

UTBILDNINGSPLAN. Högskoleingenjörsutbildning i datateknik, 180 högskolepoäng. Computer Engineering Programme, 180 ECTS Credits Dnr: 1013/2007-510 Grundutbildningsnämnden för matematik, naturvetenskap och teknik UTBILDNINGSPLAN Högskoleingenjörsutbildning i datateknik, 180 högskolepoäng Computer Engineering Programme, 180 ECTS

Läs mer

Kandidatprogram i miljövetenskap miljö, hälsa, arbete, 180 högskolepoäng

Kandidatprogram i miljövetenskap miljö, hälsa, arbete, 180 högskolepoäng Utbildningsplan Sida 1 av 6 Kandidatprogram i miljövetenskap miljö, hälsa, arbete, 180 högskolepoäng Bachelor Program in Environmental Science Environment, Health and Working life, 180 Credits Denna utbildningsplan

Läs mer

INSTITUTIONEN FÖR MATEMATIK OCH NATURVETENSKAP. Fastställd i institutionsstyrelsen 2003-06-11 Dnr 853/333-03

INSTITUTIONEN FÖR MATEMATIK OCH NATURVETENSKAP. Fastställd i institutionsstyrelsen 2003-06-11 Dnr 853/333-03 INSTITUTIONEN FÖR MATEMATIK OCH NATURVETENSKAP LOKAL UTBILDNINGSPLAN MEDIEINFORMATIKPROGRAMMET 120 POÄNG MI03 Fastställd i institutionsstyrelsen 2003-06-11 Dnr 853/333-03 INNEHÅLL LOKAL UTBILDNINGSPLAN

Läs mer

TEKNIK/EKONOMIPROGRAMMET, 120/160 POÄNG Programme for Business Economics and Engineering, 120/160 points

TEKNIK/EKONOMIPROGRAMMET, 120/160 POÄNG Programme for Business Economics and Engineering, 120/160 points UTBILDNINGSPLAN TEKNIK/EKONOMIPROGRAMMET, 120/160 POÄNG Programme for Business Economics and Engineering, 120/160 points Utbildningsplanen är fastställd av fakultetsnämnden för medicin, naturvetenskap

Läs mer

Utbildningsplan. Engineering: Surveying Technology and Geographical IT Högskolepoäng/ECTS: 180 högskolepoäng/ects. Svenska.

Utbildningsplan. Engineering: Surveying Technology and Geographical IT Högskolepoäng/ECTS: 180 högskolepoäng/ects. Svenska. Fakulteten för samhälls- och livsvetenskaper Utbildningsplan Programkod: Programmets benämning: TGLIT Högskoleingenjörsprogrammet i lantmäteriteknik och geografisk IT Engineering: Surveying Technology

Läs mer

Datavetenskapligt program, 180 högskolepoäng

Datavetenskapligt program, 180 högskolepoäng GÖTEBORGS UNIVERSITET UTBILDNINGSPLAN IT-fakultetsstyrelsen 2013-02-14 Datavetenskapligt program, 180 högskolepoäng (Computer Science, Bachelor s Programme, 180 credits) Grundnivå/First level 1. Fastställande

Läs mer

Kerstin Paulsson har meddelat förhinder att delta i sammanträdet.

Kerstin Paulsson har meddelat förhinder att delta i sammanträdet. LUNDS UNIVERSITET PROTOKOLL 1/07 Lunds Tekniska Högskola Sammanträdesdatum Utbildningsnämnd 1 2007-02-14 Närvarande ledamöter: Kullberg, Rune Ek, Åsa Diehl, Stefan L Huillier, Anne Nilsson, Sofie Runeson,

Läs mer

Förbereder dig för högskolan Teknikvetenskap är inriktningen för dig som siktar

Förbereder dig för högskolan Teknikvetenskap är inriktningen för dig som siktar Teknikvetenskap Förbereder dig för högskolan Teknikvetenskap är inriktningen för dig som siktar på en karriär som civilingenjör. Den här utbildningen laddar dig med kunskap i matematik och fysik, vilket

Läs mer

Välkommen till Ekosystemteknik/Environmental Engineering, W!

Välkommen till Ekosystemteknik/Environmental Engineering, W! Välkommen till Ekosystemteknik/Environmental Engineering, W! Grattis - Du har blivit antagen till civilingenjörsprogrammet Ekosystemteknik/Environmental Engineering vid LTH 2008! Du är därmed en mycket

Läs mer

Att välja kurser på Datateknik år 4-5

Att välja kurser på Datateknik år 4-5 Att välja kurser på Datateknik -5 Inledning På D-programmet är alla kurser i årskurs 1-3 obligatoriska. Efter det är alla kurser valfria. Det skapar möjligheter för dig att sätta din egen prägel på utbildningen

Läs mer

U T B I L D N I N G S P L A N

U T B I L D N I N G S P L A N Dnr: 1022/2007-515 Grundutbildningsnämnden för matematik, naturvetenskap och teknik U T B I L D N I N G S P L A N Högskoleingenjörsutbildning i elektro- och datorteknik - med inledande bastermin, 180 högskolepoäng

Läs mer