I. Flersekvensjämförelser, sekvensmotiv och profiler. II. Fylogenetisk analys

Storlek: px
Starta visningen från sidan:

Download "I. Flersekvensjämförelser, sekvensmotiv och profiler. II. Fylogenetisk analys"

Transkript

1 I. Flersekvensjämförelser, sekvensmotiv och profiler II. Fylogenetisk analys

2 I. Flersekvensjämförelser (multiple sequence alignments, MSA) Jämföra tre eller fler sekvenser samtidigt (homologer eller funktionellt länkade sekvenser) Vilken typ av information ger det oss? 1. Försök hitta den konserverade (bevarade) kärnsekvensen Spår av den ursprungliga sekvensen 2. Hitta ett sekvensmotiv som korrelerar med den funktionella länken.

3 Välj sekvenserna väl Om vi är ute efter ett konserverat motiv så måste alla sekvenserna vara homologer annars är resultatet meningslöst. Det kan ju inte finnas ett konserverat motiv om sekvenserna inte har ett gemensamt evolutionärt ursprung. Vilken resolution på sekvensvariationen är man ute efter?

4 Mammaliskt cytokrom b

5 Eukaryotiskt cytokrom b

6 Konserverade regioner i biologiska sekvenser domäner och motiv En domän är en biokemiskt definierad region i ett protein som kan ha en känd enzymatisk aktivitet eller struktur. Isolerade domäner kan oftast bilda självständiga strukturer: Kinasdomän DNA-bindande domän Ett motiv är endast bioinformatiskt definierat. DNA, RNA eller protein Biologisk relevans Evolutionärt konserverat

7 Sekvensmotiv - exempel DNA: Estrogen response element (AGGTCAnnnTGACCT) E. coli ori sekvens (245 bp) RNA: Kozak site, translation ( A / G CCACCAUGG) Poly-adenyleringssignal (AAUAAA) Protein Zinkfingermotiv (X 3 -Cys-X 2-4 -Cys-X 12 -His-X 3-4 -His-X 4 ) Faktor Xa klyvningsställe (Ile-Glu-Gly-Arg) CDK fosforyleringssignal (Ser-Pro) N-länkad glykosyleringssignal (Asn-X-Ser/Thr)

8 Att hitta sekvensmotiv in silico Från homologa sekvenser Vi förväntar oss att alla eller så gott som alla sekvenserna kommer att innehålla motivet Från funktionellt länkade sekvenser (1) en grupp proteiner som alla fosforyleras av ett visst kinas (fosforyleringssignal) (2) en grupp proteiner som förekommer inom en viss organell (lokaliseringssekvens) Vi förväntar oss att en signifikant andel av sekvenserna (som inte måste vara homologer!) kommer att innehålla et gemensamt motiv

9 OBS! Homologa sekvenser måste inte innehålla ett konserverat motiv! Kom ihåg: homologi betyder endast att sekvenserna har ett gemensamt evolutionärt ursprung. Sekvenserna kan ha förändrats till oigenkännlighet under tidens gång.

10 So you want to make a multiple sequence alignment. 1. Välj input sekvenserna och välj dem väl ( junk goes in, junk comes out ) 2. Välj MSA-program (ClustalW, T-Coffee, BlockMaker, MAFFT, Praline, MEME etc) 3. Gör en första jämförelse 4. Utvärdera den första jämförelsen trixa med parametrar tills du är nöjd 5. Visualisera resultatet på ett meningsfullt sätt 6. Använd resultatet på ett meningsfullt sätt

11 icke-konserverad region högt konserverad region (homologa regioner) delvis konserverad region (homologa regioner i en del av sekvenserna)

12 Hur kan vi förbättra jämförelsen? ta bort problematiska sekvenser (även fast de är homologer) och gör om analysen ta bort regioner som är mindre konserverade och gör om analysen

13 Localised multiple sequence alignments Lämpar sig för homologa sekvenser som inte har särskilt hög sekvensidentitet eller för sekvenser som endast har mindre regioner av sekvenshomologi. Protein som besitter homologa domäner Sekvensmotiv i DNA sekvenser som omges av icke-konserverad sekvens Flera program tillgängliga. BLOCKS database och BlockMaker för proteinsekvenser MEME för både DNA och proteinsekvenser Gibbs Motif Sampler för både DNA och proteinsekvenser

14 Exempel: MEME (Multiple Em for Motif Elicitation) Jag ville hitta konserverade motiv i promotorsekvenserna hos SOH1 genen i elva olika jästarter. S. cerevisiae S. mikatae S. paradoxus C. glabrata S. kudriavzevii Y. lipolytica icke-konserverad sekvens

15 Hur kan vi visualisera resultatet på ett informativt sätt? Vi måste urskilja de regioner i flersekvensjämförelsen som är högst konserverad Formatera flersekvensjämförelsen Definera och visualisera det konserverade sekvensmotivet

16 Formatera en flersekvensjämförelse H.sapiens 17 RFQLELEFVQCLANPNYLNF-LAQRGYFKDKAFVNYLKYLLYWKD-PEYAKYLKYP-QCLHMLELLQYEHFR 85 D.melanogaster 21 RWQIELEFVQCLSNPNYLNF-LAQRGFFKDQSFINYLKYLQYWKE-PDYAKYLMYP-MCLYFLDLLQYEHFR 89 C.elegans 10 RFEVECEFVQALANPNYLNF-LAQRGYFKEEYFVNYLKYLLYWKD-PQYARCLKFP-QCLHMLEALQSQQFR 78 T.solium 30 RFQIELEFVQSLGNPDYLTF-LAQQGCFDKPEFINYLSYLQYWKS-PSYSRFITYP-FCLHMLDLLQSPDFR 98 C.parvum 19 RFSLELEFVQCLSNPDYLQW-LSKEGYFEDESFVNYLKYLLYWCE-FPYVKYISYP-HCIKMLRLLQIEDFR 87 S.pombe 16 RFEIELEFVQMLSNPWYLNF-LAQHKYFEDEAFLQYLEYMEYWRE-PEYVKFIIYP-TCLHMLTLLKNPQFR 84 S.cerevisiae 22 RFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCN-PPYSQCIVYP-NCLFILKLLNG-FME 90 C.albicans 30 RWEIELEFVQSLSNIPYVNY-LAQNNYFNDENFINYLNYLQYWTQ-PEYSKFLVYP-NCLHILKLLQDENFR 98 P.falciparum 37 RFECELEFLQSLCNIDYIKH-LYENKYFNDYNFINYLKYLNYWRN-KPYIFYVHFP-ICLYVLDILNNNNTN 105 E.cuniculi 5 RFERELEFVQLLCNPDYLRW-LTREGHFESEEFRSYLRYLEYWRS-PEYSRFLTYP-QCLAVLEHLNSENIN 73 A.thaliana 31 RFLLELEFIQCLANPTYIHY-LAQNRYFEDEAFIGYLKYLQYWQR-PEYIKFIMYP-HCLYFLELLQNPNFR 99 M.grisea 33 RFEIELEFVQALGNPIYLNH-LAVNKVLSQPAFVAYLDYLQYWTR-PPYVKYLTYPGPTLRSLKLLQQEKFR 102 C.reinhartii 200 RFALELEFLQCLANPLYINW-LATKQYFDNPAFLNYLKYLQYWKQ-PAYAVHITYP-HCLFFLDLVQDADFR 268 G.intestinalis 10 RLQADLEFVHLLANLEYVQS-LLDAQYFEDESFRAYLRYLQYVRR-PEYSCYVKYP-RALYMLEKLTEPAFY 78 C.merolae 68 SFLEELAWVESLASPSYVAY-LCQMRRFDDVVAQRRLTTLQRWRQDPAYRQHVSQP-IALFFLEQLCSAEFR 137

17

18 Hur visualiserar man sekvensmotiv? Kan representeras i form av: konsensussekvenser regular expressions sekvenslogo positionsspecifika matriser (position weight matrix, PWM)

19 Konsensussekvenser representerar en flersekvensjämförelse i form av en enda sekvens innehåller den vanligaste nukleotiden eller aminosyran vid varje enskild position ibland kan man även specificera två nukleotider eller aminosyror om de är ungefär lika vanliga (t.ex. AG C / T GC T / A ) kan vara lik den ursprungliga sekvensen Alignment Sequence 1. ATAGTTA Sequence 2. ATTGTAA Sequence 3. ATT-TAA Sequence 4. ATAGTAC Sequence 5. ATAGTGA Consensus: ATAGTAA (OBS! I detta exempel är konsensussekvensen inte identisk med någon av inputsekvenserna.)

20 Regular expression Beskriver sekvensmotiv på ett enkelt sätt utan positionspecifika frekvenser Regular expressions kan användas direkt av sökalgoritmer för att hitta nya sekvenser som överensstämmer med motivet Position 2 and 3. vilken aminosyra som helst [G A S] X 2 T X [L V] Position 5. vilken aminosyra som helst Position 1. glycin, alanin eller serin Position 6. Leucin eller valin Position 4. treonin

21 Sequence logos Frekvensen av varje sekvenskaraktär visualiseras direkt med höjden på bokstaven Användbart när man analyserar ett stort antal sekvenser (> 50) Als peptide repeat (n = 473)

22 Nästa steg gör en profil Om vi nu har en representativ samling homologa sekvenser så kan vi uppskatta graden av sekvensvariation vid varje enskild position i ett sekvensmotiv. Med hjälp av denna information kan datorn konstruera en sekvensprofil från de positionsspecifika frekvenserna. Vi kan sedan använda sekvensprofilen för att hitta nya homologa sekvenser som matchar den profil vi har skapat.

23 Hur man söker med en profil/pssm Ett lätt exempel: leta efter EcoRI klyvningsställen (konsensus GAATTC) För enkelhetens skull så kan vi använda % frekvenserna direkt som en PSSM (se nedan): Position G A Sekvenskarktär T C

24 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Sliding window -principen Vi sätter ett gränsvärde på 100 % identitet (dvs 6 perfekta träffar)

25 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

26 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

27 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

28 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

29 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

30 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

31 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

32 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

33 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

34 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

35 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

36 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

37 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

38 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Position G A T C

39 Eco RI consensus GAATTC TAGTGTTATAGTAAAGAATTCGT Bingo! Position G A T C

40 Profiler sammanfattning 1. Gör en position specific scoring matrix (PSSM) 2. Ange gränsvärdet för att hitta nya sekvenser. För högt så hittar vi inga nya sekvenser (känslighet) För lågt så plockar vi upp sekvenser som inte homologer (selektivitet) 3. Scanna sekvenserna med din profil. 4. Utveckla profilen med de nya sekvenserna du har hittat (vilket ger en ny PSSM) och finjustera gränsvärdet.

41 Varför är profiler bra att ha? Profiler är mycket bättre på att hitta avlägsna homologer än att använda en enskild sekvens (Exempel: proteiner) När du söker med en enstaka sekvens använder du dig av de vanliga substitutionmatriserna (PAM250, BLOSUM62) som baserar sig på stora dataset av icke-homolog sekvenser För varje ny homolog du hittar kan du lägga till den i profilen och göra den ännu mer känslig och selektiv. I bästa fall ska du hitta alla homologer utan att plocka upp icke-homologa sekvenser.

42 Profildatabaser Jämför en sekvens med alla bokförda profiler Proteinmotiv: Domäner, transmembranregioner, intracellulär lokalisering (TargetP, SignalP), proteolytiska klyvningsställen, fosforyleringsmotiv etc Pfam, Prosite, PRINTS, InterPro, NCBI Conserved Domain Database (CDD), ProDom DNA motiv Promotorer, enhancers, strukturella genomiska element, splicing sites, initieringssekvenser för transkription och translation (Ribosomal Binding Site, Kozac site) Eukaryotic Promoter Database, ConSite

TENTAMEN för KMB056 - Molekylär Bioteknik

TENTAMEN för KMB056 - Molekylär Bioteknik TENTAMEN för KMB056 - Molekylär Bioteknik 2011-10-22 em (V-salar) Totalt 60 poäng (Frågor 1-8: Joakim Norbeck, totalt 45 poäng; Frågor 9-12: Lisbeth Olsson, totalt 15 poäng). Betygsgränser: 30 poäng =

Läs mer

RNA-syntes och Proteinsyntes

RNA-syntes och Proteinsyntes RNA-syntes och Proteinsyntes Jenny Flygare (jenny.flygare@ki.se) Genexpression - översikt 5 (p) A T G T C A G A G G A A T G A 3 (OH) T A C A G T C T C C T T A C T 3 (OH) 5 (p) VAD TRANSLATERAS DEN HÄR

Läs mer

Bioinformatisk metodik (1MB331) VT11 - Sammanfattning

Bioinformatisk metodik (1MB331) VT11 - Sammanfattning Bioinformatisk metodik (1MB331) VT11 - Sammanfattning Per Enström & Eli Burell Innehåll 1 Inledning 2 2 Databastyper 2 2.1 Depåer (repositories)............................. 2 2.2 Vårdade (curated)..............................

Läs mer

Släktträd med hjälp av databaser och program från Internet

Släktträd med hjälp av databaser och program från Internet Övning: Släktträd sid 1 Övning i bioinformatik Släktträd med hjälp av databaser och program från Internet Det finns databaser som är fritt tillgängliga och innehåller nukleotid- och amino-syrasekvenser

Läs mer

Stamträd med hjälp av databaser och program från Internet

Stamträd med hjälp av databaser och program från Internet Övning: Stamträd sid 1 Övning Stamträd med hjälp av databaser och program från Internet Det finns databaser som är fritt tillgängliga och innehåller nukleotid- och aminosyrasekvenser från ett stort antal

Läs mer

Tentamen. Kurskod: MC1004. Medicin A, Molekylär cellbiologi. Kursansvarig: Christina Karlsson. Datum 130814 Skrivtid 4h

Tentamen. Kurskod: MC1004. Medicin A, Molekylär cellbiologi. Kursansvarig: Christina Karlsson. Datum 130814 Skrivtid 4h Tentamen Medicin A, Molekylär cellbiologi Kurskod: MC1004 Kursansvarig: Christina Karlsson Datum 130814 Skrivtid 4h Totalpoäng: 86p Poängfördelning Johanna Sundin (fråga 1 8): 18p Ignacio Rangel (fråga

Läs mer

Transkription och translation. DNA RNA Protein. Introduktion till biomedicin 2010-09-13. Jan-Olov Höög 1

Transkription och translation. DNA RNA Protein. Introduktion till biomedicin 2010-09-13. Jan-Olov Höög 1 Från DNA till protein, dvs den centrala dogmen DNA RNA Protein Biochemistry, kapitel 1 (delvis), kapitel 2 (ingående) samt kapitel 3 (delvis, kommer att behandlas mer) Transkription och translation Informationsflödet

Läs mer

Från DNA till protein, dvs den centrala dogmen

Från DNA till protein, dvs den centrala dogmen Från DNA till protein, dvs den centrala dogmen DNA RNA Protein Biochemistry, kapitel 1 5 samt kapitel 29 31. Kapitel 2 5 samt 29 31 berörs även i kommande föreläsningar. Transkription och translation Informationsflödet

Läs mer

Från DNA till protein, dvs den centrala dogmen

Från DNA till protein, dvs den centrala dogmen Från DNA till protein, dvs den centrala dogmen DNA RNA Protein Biochemistry, kapitel 1 5 samt kapitel 29 31. Kapitel 2 5 samt 29 31 berörs även i kommande föreläsningar. ph, kapitel 1, gås igenom i separata

Läs mer

En bioinformatisk genjakt

En bioinformatisk genjakt En bioinformatisk genjakt Efter en ide från: CUSMOBIO, Milano, Italien. Hur man kan söka i databaser efter information om en gen som kan ge ökad risk för bröstcacer. Bakgrund Människor utan symptom men

Läs mer

Molekylärbiologins centrala dogma

Molekylärbiologins centrala dogma Molekylärbiologins centrala dogma m Replikation:Bassekvensen i DNA står för den genetiska informationen. När en cell ska delas måste DNA:tdupliceras man måste få nytt DNA med exakt samma bassekvens som

Läs mer

TENTAMEN för KMB056 - Molekylär Bioteknik

TENTAMEN för KMB056 - Molekylär Bioteknik TENTAMEN för KMB056 - Molekylär Bioteknik 2013-01-15 em (V-salar) Totalt 60 poäng (Frågor 1-8: Joakim Norbeck, totalt 45 poäng; Frågor 9-12: Lisbeth Olsson, totalt 15 poäng). Betygsgränser: 30-38.5 poäng

Läs mer

Transkription och translation = Översättning av bassekvensen till aminosyrasekvens

Transkription och translation = Översättning av bassekvensen till aminosyrasekvens Transkription och translation = Översättning av bassekvensen till aminosyrasekvens OBS! Grova drag för prokaryota system! Mycket mer komplicerat i eukaryota system! RNA: Tre huvudtyper: trna transfer RNA

Läs mer

RNA och den genetiska koden

RNA och den genetiska koden RNA och den genetiska koden Table of Contents Struktur... 1 DNA och RNA... 2 Puriner och Pyrimidiner... 2 Watson-Crick baspar... 2 RNA som molekyl... 2 Primär struktur... 2 Sekundära strukturer... 2 Typer

Läs mer

DNA-labb / Plasmidlabb

DNA-labb / Plasmidlabb Översikt DNA-labb Plasmidlabb Preparation och analys av -DNA från Escherichia coli Varför är vi här idag? Kort introduktion till biokemi och rekombinant DNA- teknologi Vad skall vi göra idag? Genomgång

Läs mer

Eukaryot proteinexpression

Eukaryot proteinexpression Välkomna Eukaryot proteinexpression 30 oktober 2008 Sissela Liljeqvist Föreläsningens innehåll Prokaryot vs Eukaryot översikt eukaryota värdar och expressionsvektorer (='budbärare') Saccharomyces cerevisiae

Läs mer

Bioinformatik. Marina Axelson-Fisk Matematisk orientering, 30 nov 2015

Bioinformatik. Marina Axelson-Fisk Matematisk orientering, 30 nov 2015 Bioinformatik Marina Axelson-Fisk Matematisk orientering, 30 nov 2015 Bioinformatik Bioinformatik Var används bioinformatik? DNA analys Medicin DNA-sekvensering och assemblering Sekvensanalys Proteinstruktur

Läs mer

Genetik I. Jessica Abbott

Genetik I. Jessica Abbott Genetik I Jessica Abbott Att kunna/förstå efter föreläsningarna i genetik: DNA och RNA Packning av DNA Replikation Transkription och translation Cellcykeln Mitos och meios Översikt över genetiska verktyg

Läs mer

Protein en livsviktig byggsten

Protein en livsviktig byggsten Protein en livsviktig byggsten Ingvar Bosaeus Enheten för klinisk nutrition Sahlgrenska universitetssjukhuset Göteborg KSLA 2015-02-19 Aminosyra Alpha Amino- grupp Fredrik Bertz Karboxyl- grupp 20 aa

Läs mer

Ärftliga sjukdomar och egenskaper hos hund

Ärftliga sjukdomar och egenskaper hos hund Engelsk bulldog Tibetansk terrier Västgötaspets Dvärgpinscher Chow chow Foto: Pleple2000 Foto: Flickr user skaty222 Foto: Sören T Eriksson Foto: Entheta Foto:Jurriaan Schulman Alla bilder Wikimedia commons

Läs mer

Proteinsyntesen. Anders Liljas Biokemi och strukturbiologi Lunds universitet

Proteinsyntesen. Anders Liljas Biokemi och strukturbiologi Lunds universitet Proteinsyntesen Anders Liljas Biokemi och strukturbiologi Lunds universitet Ett fundament i proteinsyntesen är strukturen av nukleinsyror. F. Crick, J. Watson & Wilkins Nobelpris i medicin 1962 Wikipedia

Läs mer

VI-1. Proteiner VI. PROTEINER. Källor: - L. Stryer, Biochemistry, 3 rd Ed., Freeman, New York, 1988.

VI-1. Proteiner VI. PROTEINER. Källor: - L. Stryer, Biochemistry, 3 rd Ed., Freeman, New York, 1988. Proteiner VI. PTEINE VI-1 Källor: - L. Stryer, Biochemistry, 3 rd Ed., Freeman, New York, 1988. VI-2 Molekylmodellering VI.1. Aminosyra En aminosyra (rättare: α-aminosyra) har strukturen som visas i figur

Läs mer

Analys av nukleinsyra. Molekylärbiologisk metodik T3 ht 11 Märit Karls

Analys av nukleinsyra. Molekylärbiologisk metodik T3 ht 11 Märit Karls Analys av nukleinsyra Molekylärbiologisk metodik T3 ht 11 Märit Karls Studietips Detta kompendium är INTE en lärobok. Det är inte meningen att man skall kunna läsa kompendiet och förstå innehållet. Ni

Läs mer

Rening av proteiner: hur och varför?

Rening av proteiner: hur och varför? Rening av proteiner: hur och varför? (och lite biologiska grunder) Joakim Norbeck! norbeck@chalmers.se! Grunder! Plasmider! Protein-rening! Detektion!!!!! Mest relevanta sidor i "Cell" är 510-518 & 532-552!

Läs mer

Kap 26 Nukleinsyror och proteinsyntes. Bilder från McMurry

Kap 26 Nukleinsyror och proteinsyntes. Bilder från McMurry Kap 26 Nukleinsyror och proteinsyntes Bilder från McMurry Namn Efternamn 26 februari 2011 2 Varje DNA molekyl är uppbyggd av många gener induviduella DNA segmant som innehåller instruktioner för syntes

Läs mer

Tidiga erfarenheter av arvets mysterier

Tidiga erfarenheter av arvets mysterier Cellens genetik Cellen Växtcellen Växtcellen Tidiga erfarenheter av arvets mysterier Artförädling genom riktad avel Religiösa förbud mot syskongiftemål Redan de gamla grekerna.. Aristoteles ~350 år före

Läs mer

Genetik II. Jessica Abbott

Genetik II. Jessica Abbott Genetik II Jessica Abbott Nukleosid Sockergrupp + kvävebas Kvävebaser: Puriner (adenin, guanin) Pyrimidiner (cytosin, thymin i DNA, uracil i RNA) Basparning A=T G C Packning av DNA i eukaryot cellkärna

Läs mer

Transkriptionen. Niklas Dahrén

Transkriptionen. Niklas Dahrén Transkriptionen Niklas Dahrén Innehållet i denna undervisningsfilm: Översikt över proteinsyntesen Transkrip1onen Modifiering (bearbetning) av mrna Fler filmer på samma tema: Från gen 1ll protein Den gene1ska

Läs mer

Tentamen i 2D1396 Bioinformatik, 2 juni 2006

Tentamen i 2D1396 Bioinformatik, 2 juni 2006 Tentamen i 2D396 Bioinformatik, 2 juni 2006 Kursansvarig: Lars Arvestad Inga hjälpmedel förutom skrivmedel är tillåtna. Skriv tydligt! Skriv bara på en sida av pappret och behandla bara en uppgift per

Läs mer

Resultat:... (Cellbiologi:... Immunologi...) Betyg...

Resultat:... (Cellbiologi:... Immunologi...) Betyg... Cellbiologi del tentamen augusti 2005 1 Tentamen i Cellbiologi med Immunologi KTH 23 aug 2005 kl 9-13 Skriv svaren direkt i tentan. Vid behov använd extra blad Namn:... Årskurs/årgång... (typ I02, bio99,

Läs mer

Övning i bioinformatik

Övning i bioinformatik Övning: Släktträd sid 1 Övning i bioinformatik Släktträd med hjälp av databaser och program från Internet Det finns databaser som är fritt tillgängliga och innehåller nukleotid- och amino-syrasekvenser

Läs mer

Biologisk enfald. enheten i mångfalden. Anders Liljas Biokemi och Strukturbiologi

Biologisk enfald. enheten i mångfalden. Anders Liljas Biokemi och Strukturbiologi Biologisk enfald enheten i mångfalden Anders Liljas Biokemi och Strukturbiologi Naturen har en enorm mångfald av livsformer. I luften, på land och i vattnet Charles Darwin (1809-1882) Darwin studerade

Läs mer

TENTAMEN för KMB056 - Molekylär Bioteknik

TENTAMEN för KMB056 - Molekylär Bioteknik TENTAMEN för KMB056 - Molekylär Bioteknik 2012-10-23 em (V-salar) Totalt 60 poäng (Frågor 1-9: Joakim Norbeck, totalt 45 poäng; Frågor 10-11: Lisbeth Olsson, totalt 15 poäng). Betygsgränser: 30 poäng =

Läs mer

Användandet av olika jämförelsemetoder för att upptäcka proteiner som har liknande tredimensionell struktur

Användandet av olika jämförelsemetoder för att upptäcka proteiner som har liknande tredimensionell struktur Användandet av olika jämförelsemetoder för att upptäcka proteiner som har liknande tredimensionell struktur Exjobbsrapport i Biomedicinsk teknik, 2D1025, Nada, KTH av Magnus Nilsson Sammanfattning Samtidigt

Läs mer

NUKLEINSYRORNAS UPPBYGGNAD: Två olika nukleinsyror: DNA deoxyribonukleinsyra RNA ribonukleinsyra

NUKLEINSYRORNAS UPPBYGGNAD: Två olika nukleinsyror: DNA deoxyribonukleinsyra RNA ribonukleinsyra NUKLEINSYRORNAS UPPBYGGNAD: Två olika nukleinsyror: DNA deoxyribonukleinsyra RNA ribonukleinsyra Monomererna som bygger upp nukleinsyrorna kallas NUKLEOTIDER. En nukleotid består av tre delar: en kvävebas

Läs mer

Mikrobiologins tekniksprång Dr. Erik Nygren SP Food and Bioscience

Mikrobiologins tekniksprång Dr. Erik Nygren SP Food and Bioscience Mikrobiologins tekniksprång Dr. Erik Nygren SP Food and Bioscience Mikrobiologins tekniksprång Den högteknologiska mikrobiologin erbjuder idag nya verktyg för att förebygga smittspridning och öka produktsäkerhet.

Läs mer

Tentamen. Lycka till! Medicin A, Molekylär cellbiologi. Kurskod: MC1004. Kursansvarig: Christina Karlsson. Datum 120512 Skrivtid 4h

Tentamen. Lycka till! Medicin A, Molekylär cellbiologi. Kurskod: MC1004. Kursansvarig: Christina Karlsson. Datum 120512 Skrivtid 4h Tentamen Medicin A, Molekylär cellbiologi Kurskod: MC1004 Kursansvarig: Christina Karlsson Datum 120512 Skrivtid 4h Totalpoäng: 88p Poängfördelning Johanna Sundin: fråga 1-10: 18p Ignacio Rangel: fråga

Läs mer

DNA-molekylen. 1869 upptäcktes DNA - varken protein, kolhydrat eller lipid.

DNA-molekylen. 1869 upptäcktes DNA - varken protein, kolhydrat eller lipid. Genetik Ärftlighetslära - hur går det till när egenskaper går i arv? Molekylär genetik - information i DNA och RNA Klassisk genetik - hur olika egenskaper ärvs Bioteknik - Hur DNA flyttas mellan olika

Läs mer

Omtentamen Läkarutbildningen T1:B vårterminen 2006 Kodnr:

Omtentamen Läkarutbildningen T1:B vårterminen 2006 Kodnr: Magnus Karlsson, 40 år, har den senaste tiden lidit av huvudvärk från och till. Under ett besök hos distriktsläkaren klagar han även över trötthet och det kommer också fram att det är något konstigt med

Läs mer

FINLANDS FÖRFATTNINGSSAMLING

FINLANDS FÖRFATTNINGSSAMLING FINLANDS FÖRFATTNINGSSAMLING Utgiven i Helsingfors den 24 februari 2014 141/2014 Jord- och skogsbruksministeriets förordning om ändring av handels- och industriministeriets förordning om modersmjölksersättning

Läs mer

Tentamen Molekylärbiologi T3 / HT07 2007-10-25 VG = 66-83p G = 45-65p U = 0-44p. 1. Vad menas med att ett DNA-fragment har blunt ends?

Tentamen Molekylärbiologi T3 / HT07 2007-10-25 VG = 66-83p G = 45-65p U = 0-44p. 1. Vad menas med att ett DNA-fragment har blunt ends? KORTSVARSFRÅGOR 1. Vad menas med att ett DNA-fragment har blunt ends? (1p) Inget enkelsträngat DNA finns på DNA ändarna. 2. Vilken enzymatisk aktivitet har klenowenzymet och vad kan det användas till?

Läs mer

Felveckning och denaturering av proteiner. Niklas Dahrén

Felveckning och denaturering av proteiner. Niklas Dahrén Felveckning och denaturering av proteiner Niklas Dahrén Felveckning av proteiner Strukturen är helt avgörande för proteinets funktion ü E# protein är helt beroende av sin struktur för a& kunna fullgöra

Läs mer

Eukaryot proteinexpression

Eukaryot proteinexpression Föreläsningens innehåll Eukaryot proteinexpression 9:e november 2009 Patrik Samuelson översikt eukaryota värdar och expressionsvektorer (='budbärare') Saccharomyces cerevisiae Pichia pastoris Baculovirus/insektsceller

Läs mer

CELLKÄRNAN INNEHÅLL CELLKÄRNAN. cellkärnan

CELLKÄRNAN INNEHÅLL CELLKÄRNAN. cellkärnan CELLKÄRNAN Kap 8 i 3rd edtion, kap 9 + fig 16.24, s. 673-675, fig 16.27 i 4th edition Chromatin: S. 150-151, 257-258 3rd edition, s166-170, 281-283 4th edition. INNEHÅLL cellkärnan membran, nuclear lamina

Läs mer

Tentamen i tema Reproduktion/Utveckling Läkarprogrammet, T2, 2015-02-27, kl 8.15-12.15. Instruktioner

Tentamen i tema Reproduktion/Utveckling Läkarprogrammet, T2, 2015-02-27, kl 8.15-12.15. Instruktioner Tentamen i tema Reproduktion/Utveckling Läkarprogrammet, T2, 2015-02-27, kl 8.15-12.15 Instruktioner 1) Skriv din kod längst upp till höger på SAMTLIGA papper i detta häfte samt på eventuella extrablad

Läs mer

Maria Nyström Jessica Leander Louise Danielsson. G-proteinet Ras. 3 juni 2003. Handledare: Hans Eklund

Maria Nyström Jessica Leander Louise Danielsson. G-proteinet Ras. 3 juni 2003. Handledare: Hans Eklund Maria Nyström Jessica Leander Louise Danielsson G-proteinet Ras 3 juni 2003 Handledare: Hans Eklund Inledning Detta projektarbete behandlar en del av den signalväg som initieras av tillväxthormon och avslutas

Läs mer

Ägg till embryo Dugga 130318 Platsnummer VIKTIGT ATT DU FYLLER I OCH LÄMNAR IN! TEXTA TACK. Efternamn. Förnamn. Personnummer

Ägg till embryo Dugga 130318 Platsnummer VIKTIGT ATT DU FYLLER I OCH LÄMNAR IN! TEXTA TACK. Efternamn. Förnamn. Personnummer IDENTITETSBLAD VIKTIGT ATT DU FYLLER I OCH LÄMNAR IN! TEXTA TACK Efternamn Förnamn Personnummer Gruppnummer (Grupp 1-40 på kursen) Enligt KI:s utbildningsstyrelses beslut skall skrivningar rättas anonymt.

Läs mer

Hållbara foder och välfärd för fisk och människa

Hållbara foder och välfärd för fisk och människa Hållbara foder och välfärd för fisk och människa Kristina Snuttan Sundell och Eva Brännäs Zoologisk institutionen och Vattenbrukscentrum Väst Göteborgs Universitet Institutionen för vilt, fisk och miljö

Läs mer

BASÅRET KEMI B BIOKEMI VT 2012. PROTEINER OCH ENZYMER 174-190 (sid. 140-156)

BASÅRET KEMI B BIOKEMI VT 2012. PROTEINER OCH ENZYMER 174-190 (sid. 140-156) BASÅRET KEMI B BIOKEMI PROTEINER OCH ENZYMER 174-190 (sid. 140-156) Hur lätt blir det fel i strukturen? ganska stora skillnader i sekvens - ganska lika strukturer proteinerna är bara identiska i 27 av

Läs mer

Ladokkod: Tentamen ges för: Gsjuk15v. Namn: (Ifylles av student) Personnummer: (Ifylles av student) Tentamensdatum: 15-04 -29 Tid:

Ladokkod: Tentamen ges för: Gsjuk15v. Namn: (Ifylles av student) Personnummer: (Ifylles av student) Tentamensdatum: 15-04 -29 Tid: Humanbiologi Provmoment: Ladokkod: Tentamen ges för: Tenta A Gsjuk15v 15 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles av student) Tentamensdatum: 15-04 -29 Tid: Hjälpmedel: Inga hjälpmedel

Läs mer

Cellbiologi. Maria Ankarcrona Nov 2010

Cellbiologi. Maria Ankarcrona Nov 2010 Cellbiologi Maria Ankarcrona Nov 2010 1 Instuderingsfrågor (från den 15/11) 1. Beskriv uppbyggnaden av den eukaryota cellens cellmembran. 2. Vilken funktion fyller cellmembranet? 3. Ge exempel på fördelar

Läs mer

Evolutionen hos mammutar och deras nu levande släktingar. För elever A B C. Anna Lorenc. Dean Madden [Ed.] bioscience explained

Evolutionen hos mammutar och deras nu levande släktingar. För elever A B C. Anna Lorenc. Dean Madden [Ed.] bioscience explained bioscience explained 12467 Anna Lorenc Max Planck Institute for Evolutionary Biology, Plön, Deutschland Dean Madden [Ed.] NCBE, University of Reading, UK För elever Evolutionen hos mammutar och deras nu

Läs mer

5. Transkriptionell reglering OBS! Långsam omställning!

5. Transkriptionell reglering OBS! Långsam omställning! Reglering: 1. Allosterisk reglering Ex. feedbackinhibering en produkt i en reaktionssekvens inhiberar ett tidigare steg i samma sekvens 2. Olika isoformer i olika organ 3. Kovalent modifiering Ex. fosforylering

Läs mer

Ägg till embryo Dugga 120305 Platsnummer VIKTIGT ATT DU FYLLER I OCH LÄMNAR IN! TEXTA TACK. Efternamn. Förnamn. Personnummer

Ägg till embryo Dugga 120305 Platsnummer VIKTIGT ATT DU FYLLER I OCH LÄMNAR IN! TEXTA TACK. Efternamn. Förnamn. Personnummer IDENTITETSBLAD VIKTIGT ATT DU FYLLER I OCH LÄMNAR IN! TEXTA TACK Efternamn Förnamn Personnummer Gruppnummer (Grupp 1-40 på kursen) Enligt KI:s utbildningsstyrelses beslut skall skrivningar rättas anonymt.

Läs mer

Organisk kemi / Biokemi. Livets kemi

Organisk kemi / Biokemi. Livets kemi Organisk kemi / Biokemi Livets kemi Vecka Lektion 1 Lektion 2 Veckans lab Läxa 41 Kolhydrater Kolhydrater Sockerarter Fotosyntesen Bio-kemi 8C och D vecka 41-48 42 Kolhydrater Fetter Trommers prov s186-191

Läs mer

LAB 12. Preparation och analys av plasmid-dna från E.coli

LAB 12. Preparation och analys av plasmid-dna från E.coli Institutionen för biokemi och biofysik LAB 12 Preparation och analys av plasmid-dna från E.coli Basåret 2012 (finns på basårshemsida: www.kemi.su.se, välj Basår) INTRODUKTION I denna laboration ska vi

Läs mer

NUKLEINSYRORNAS UPPBYGGNAD: Två olika nukleinsyror: DNA deoxyribonukleinsyra RNA ribonukleinsyra

NUKLEINSYRORNAS UPPBYGGNAD: Två olika nukleinsyror: DNA deoxyribonukleinsyra RNA ribonukleinsyra NUKLEINSYRORNAS UPPBYGGNAD: Två olika nukleinsyror: DNA deoxyribonukleinsyra RNA ribonukleinsyra Monomererna som bygger upp nukleinsyrorna kallas NUKLEOTIDER. En nukleotid består av tre delar: en kvävebas

Läs mer

Aminosyror ökar träningseffekten

Aminosyror ökar träningseffekten Aminosyror ökar träningseffekten Kostens sammansättning är viktig för prestation och återhämtning. Dess innehåll av protein och essentiella aminosyror kan påverka musklernas anpassning till träning. Ny

Läs mer

Lärarhandledning gällande sidorna 6-27 Inledning: (länk) Läromedlet har sju kapitel: 5. Celler och bioteknik

Lärarhandledning gällande sidorna 6-27 Inledning: (länk) Läromedlet har sju kapitel: 5. Celler och bioteknik Senast uppdaterad 2012-12-09 55 Naturkunskap 1b Lärarhandledning gällande sidorna 6-27 Inledning: (länk) Celler och bioteknik C apensis Förlag AB Läromedlet har sju kapitel: 1. Ett hållbart samhälle 2.

Läs mer

Ordinarietentamen i tema Reproduktion/Utveckling Läkarprogrammet, T2, 2014-09-26, kl 14.15-18.15. Instruktioner

Ordinarietentamen i tema Reproduktion/Utveckling Läkarprogrammet, T2, 2014-09-26, kl 14.15-18.15. Instruktioner Ordinarietentamen i tema Reproduktion/Utveckling Läkarprogrammet, T2, 2014-09-26, kl 14.15-18.15 Instruktioner 1) Skriv din kod längst upp till höger på SAMTLIGA papper i detta häfte samt på eventuella

Läs mer

En bioinformatisk genjakt I

En bioinformatisk genjakt I En bioinformatisk genjakt I -jämförelser av olika arters genom I den här aktiviteten kan en elev självständigt undersöka det mänskliga genomet genom att hämta information från en databas på nätet. Målet

Läs mer

Cell och molekylärbiologi (BL3008) 2015-08-28 Omtentamen CMB-II (11 hp) Kod: Personnummer: Plats nr: Inlämnad kl: ID kollad: Poäng: Betyg:

Cell och molekylärbiologi (BL3008) 2015-08-28 Omtentamen CMB-II (11 hp) Kod: Personnummer: Plats nr: Inlämnad kl: ID kollad: Poäng: Betyg: STOCKHOLMS UNIVERSITET Institutionen för biologisk grundutbildning Cell och molekylärbiologi (BL3008) 2015-08-28 Omtentamen CMB-II (11 hp) Kod: Personnummer: Plats nr: Inlämnad kl: ID kollad: Poäng: Betyg:

Läs mer

Datorbaserade modeller inom ADMET samt molekylär funktion av transportörer. Pär Matsson, Inst f farmaci Biofarmaci 7.5p HT 2014

Datorbaserade modeller inom ADMET samt molekylär funktion av transportörer. Pär Matsson, Inst f farmaci Biofarmaci 7.5p HT 2014 Datorbaserade modeller inom ADMET samt molekylär funktion av transportörer Pär Matsson, Inst f farmaci Biofarmaci 7.5p HT 2014 Vad gör en molekyl till ett läkemedel? Molekylen måste binda tillräckligt

Läs mer

Slutrapport för projekt H1047248 Anslagsmottagare Prof. Bengt Guss, institutionen för mikrobiologi, SLU

Slutrapport för projekt H1047248 Anslagsmottagare Prof. Bengt Guss, institutionen för mikrobiologi, SLU Slutrapport för projekt H1047248 Anslagsmottagare Prof. Bengt Guss, institutionen för mikrobiologi, SLU Projekttitel: Studier av extracellulära proteiner hos Streptococcus equi och Streptococcus zooepidemicus

Läs mer

tisdag 8 oktober 13 Carl Von Linné

tisdag 8 oktober 13 Carl Von Linné Carl Von Linné Carl Von Linné Svensk Botanikprofessor. Carl Von Linné Svensk Botanikprofessor. Utformade ett taxonomi system. Carl Von Linné Svensk Botanikprofessor. Utformade ett taxonomi system. Taxonomi:

Läs mer

Cellen och biomolekyler

Cellen och biomolekyler Cellen och biomolekyler Alla levande organismer är uppbyggda av celler!! En prokaryot cell, typ bakterie: Saknar cellkärna Saknar organeller En eukaryot djurcell: Har en välavgränsad kärna (DNA) Har flera

Läs mer

Medieteknologi Webbprogrammering och databaser MEB725, 5p (7,5 ECTS) Klientprogrammering JavaScript Program på flera sidor

Medieteknologi Webbprogrammering och databaser MEB725, 5p (7,5 ECTS) Klientprogrammering JavaScript Program på flera sidor http://w3.msi.vxu.se/multimedia Medieteknologi Webbprogrammering och databaser MEB725, 5p (7,5 ECTS) Klientprogrammering JavaScript Program på flera sidor Rune Körnefors Innehåll Variabler i JavaScript

Läs mer

Proteinernas uppbyggnad, funktion och indelning. Niklas Dahrén

Proteinernas uppbyggnad, funktion och indelning. Niklas Dahrén Proteinernas uppbyggnad, funktion och indelning Niklas Dahrén Proteiner ü Namnet protein härstammar från det grekiska ordet protos som betyder den första. ü Anledningen 5ll namnet är a6 proteiner 7digt

Läs mer

Instuderingsfrågor till Cellbiologi av Charlotte Erlanson-Albertsson och Urban Gullberg

Instuderingsfrågor till Cellbiologi av Charlotte Erlanson-Albertsson och Urban Gullberg Instuderingsfrågor till Cellbiologi av Charlotte Erlanson-Albertsson och Urban Gullberg Den levande cellen, kapitel 1 Svara på frågorna 1 Nämn två viktiga skillnader mellan bakterier och djurceller. 2

Läs mer

Elektron-absorbtionspektroskopi för biomolekyler i UV-VIS-området

Elektron-absorbtionspektroskopi för biomolekyler i UV-VIS-området Elektron-absorbtionspektroskopi för biomolekyler i UV-VIS-området Principer Koncentrationsmätning Detektion Kromoforer, kolorimetriska assays DNA Komparativ analys Proteinrening Jonbindning Peptidgruppens

Läs mer

Resultat:... (Cellbiologi:... Immunologi...) Betyg...

Resultat:... (Cellbiologi:... Immunologi...) Betyg... Tentamen i Cellbiologi med Immunologi KTH 28 Maj 2003 kl 9-13 Skriv svaren direkt i tentan. Vid behov använd extra blad Namn:... Årskurs... Personnummer... Glöm inte skriva namn och personnummer på immunologidelen

Läs mer

Tentamen Läkarutbildningen T1:B vårterminen 2008 1

Tentamen Läkarutbildningen T1:B vårterminen 2008 1 Tentamen Läkarutbildningen T1:B vårterminen 2008 1 Lisa har middag för sina kurskamrater. En av middagsgästerna är en japansk utbytesstudent, Nanako. Efter välkomstdrinken serveras vin till maten och avec

Läs mer

rapport 2013/6 FISKUNDERSÖKNINGAR I FYRISÅN 2012

rapport 2013/6 FISKUNDERSÖKNINGAR I FYRISÅN 2012 rapport 2013/6 FISKUNDERSÖKNINGAR I FYRISÅN 2012 Tomas Loreth, Upplandsstiftelsen Johan Persson, Upplandsstiftelsen Gustav Johansson, Hydrophyta Ekologikonsult Anders Larsson, Fyrisåns vattenförbund Niclas

Läs mer

GENKOMB - en metod att hitta målprotein för läkemedel.

GENKOMB - en metod att hitta målprotein för läkemedel. ENKOMB - en metod att hitta målprotein för läkemedel. Erik urell dam meur Jakub Westholm i samarbete med strazeneca Disposition Biologisk bakgrund: cellen och arvsmassan proteinsyntes genuttryck och genuttrycksdata

Läs mer

Användning av kol och energikällor

Användning av kol och energikällor Bio 2. Biokemiska reaktioner och metabolism Liv Föröka sig, överföra information, energi från näringsmolekyler, anpassa sig till omgivningen För att leva och fortleva behöver cellen Kopiera och uttrycka

Läs mer

Henrik Brändén. bioscience explained Vol 3 No 1. Undersökning av influensavirus med hjälp av släktträd. Vetenskapsrådet 103 78 Stockholm Sverige

Henrik Brändén. bioscience explained Vol 3 No 1. Undersökning av influensavirus med hjälp av släktträd. Vetenskapsrådet 103 78 Stockholm Sverige Henrik Brändén Vetenskapsrådet 103 78 Stockholm Sverige Undersökning av influensavirus med hjälp av släktträd Introduktion Influensavirus delas in i olika stammar beroende på vilka varianter viruset bär

Läs mer

Kromatografi. Den kromatografiska processen. Fördelar med HPLC - (utförs under högt tryck ca 400 Bar) Vätskekromatografi. Olika former av LC

Kromatografi. Den kromatografiska processen. Fördelar med HPLC - (utförs under högt tryck ca 400 Bar) Vätskekromatografi. Olika former av LC Kromatografi Den kromatografiska processen Separationsmetod, där komponenterna som ska separeras, fördelas mellan två faser, en stationär fas och en mobil fas. Injektion 0 min Vätskekromatografi vätska

Läs mer

Frå n åminosyror till proteiner

Frå n åminosyror till proteiner Frå n åminosyror till proteiner Table of Contents Generellt om aminosyror... 2 Struktur och klassificering av aminosyror... 2 Alifatiska... 2 Aromatiska... 2 Polära, oladdade... 2 Positivt laddade... 2

Läs mer

52 onkologi i sverige nr 5 13

52 onkologi i sverige nr 5 13 52 onkologi i sverige nr 5 13 Genreglerande DNA-element EN OUTFORSKAD ORSAK TILL CANCER Utvecklingen av cancer är starkt kopplad till uppkomsten av genetiska förändringar. Dessa förändringar omfattar allt

Läs mer

Människans genom Databaser ger kunskap om genetiska sjukdomar

Människans genom Databaser ger kunskap om genetiska sjukdomar Nationellt resurscentrum för biologi och bioteknik Övning i bioinformatik Människans genom Databaser ger kunskap om genetiska sjukdomar Många molekylärbiologiska databaser och program är fritt tillgängliga

Läs mer

Äter jag rätt när jag tränar?

Äter jag rätt när jag tränar? Kostens betydelse för prestation Äter jag rätt när jag tränar? Eva Blomstrand Individens allmänna kostvanor Intag före träning Intag under träning Intag efter träning Åstrandlaboratoriet, Gymnastik- och

Läs mer

Proteinets potential i produktion av foder

Proteinets potential i produktion av foder Proteinets potential i produktion av foder Robin Kalmendal, AgrDr Produktchef och Försäljningschef, Fjäderfäfoder Innehåll Fodermarknadens kännetecken: igår, idag och i framtiden Proteinets betydelse i

Läs mer

Fotografens öga. En analys av fotografiet enligt John Szarkowski

Fotografens öga. En analys av fotografiet enligt John Szarkowski Fotografens öga En analys av fotografiet enligt John Szarkowski John Szarkowski (1925-2007) var chef för den fotografiska avdelningen på The Museum of Modern Art i New York. I sin bok The Photographers

Läs mer

Tentamen i Medicinsk kemi för biomedicinare 2010:

Tentamen i Medicinsk kemi för biomedicinare 2010: Tentamen i Medicinsk kemi för biomedicinare 2010: 1. Beskriv den molekylära strukturen på det vi i dagligt tal kallar fett (1 p) 2. Hur bryts stärkelse ned i saliven och magen? Kan även cellulosa brytas

Läs mer

Biologi breddning (mikrobiologi och immunologi) Kurskod: BI 1203-A Poäng: 50 Program: Förkunskapskrav: Biologi A och Biologi B

Biologi breddning (mikrobiologi och immunologi) Kurskod: BI 1203-A Poäng: 50 Program: Förkunskapskrav: Biologi A och Biologi B KURSBESKRIVNING Ämne: Biologi Kurs: Biologi breddning (mikrobiologi och immunologi) Kurskod: BI 1203-A Poäng: 50 Program: NV Förkunskapskrav: Biologi A och Biologi B Mål Kurserna Biologi breddning A och

Läs mer

BASÅRET KEMI B BIOKEMI VT 2012. GENETISK INFORMATION 191-210 (sid. 157-177)

BASÅRET KEMI B BIOKEMI VT 2012. GENETISK INFORMATION 191-210 (sid. 157-177) BASÅRET KEMI B BIOKEMI GENETISK INFORMATION 191-210 (sid. 157-177) DNA/RNA, Transkription, Translation VAR I CELLEN SKER DETTA? Replikation - kopiering av DNA, sker i cellkärnan Transkription - avläsa

Läs mer

Grafisk manual. För Falu Tank

Grafisk manual. För Falu Tank Grafisk manual För Falu Tank Grafisk profil Vad är en grafisk profil? En grafisk profil är en samling riktlinjer för hur tryckt och elektronisk information ska se ut. Den grafiska profilen består av tre

Läs mer

Slutrapport - Förstudie om Alternariaförekomst i potatis och behandlingseffekter 2013 i Mellansverige.

Slutrapport - Förstudie om Alternariaförekomst i potatis och behandlingseffekter 2013 i Mellansverige. 1 Slutrapport - Förstudie om Alternariaförekomst i potatis och behandlingseffekter 2013 i Mellansverige. Lisa Andrae, Rådhuset Nordfalan Eva Edin, Institutionen för Skoglig mykologi och växtpatologi, SLU

Läs mer

Föreläsningens innehåll. Rekombinanta läkemedel. Genterapi. 7 november 2008 Sissela Liljeqvist

Föreläsningens innehåll. Rekombinanta läkemedel. Genterapi. 7 november 2008 Sissela Liljeqvist Föreläsningens innehåll Rekombinanta läkemedel och Genterapi 7 november 2008 Sissela Liljeqvist sissela@liljeqvist.se Rekombinanta proteiner Enzymer Monoklonala antikroppar Produktion av rekombinanta antikroppar

Läs mer

30. Undersökning av aminosyror i surkål

30. Undersökning av aminosyror i surkål 30. Undersökning av aminosyror i surkål VAD GÅR LABORATIONEN UT PÅ? Du ska l ära dig tekniken vid tunnskiktskromatografi, TLC undersöka vad som händer med proteinerna och polysackariderna vid mjölksyrajäsning

Läs mer

Sluttentamen Bke2/KE0003, 29:e Oktober 2003, 09 00-15 00 Max poäng = 94 p. Preliminär gräns för godkänd = 50 p (53 %).

Sluttentamen Bke2/KE0003, 29:e Oktober 2003, 09 00-15 00 Max poäng = 94 p. Preliminär gräns för godkänd = 50 p (53 %). Sluttentamen Bke2/KE0003, 29:e Oktober 2003, 09 00-15 00 Max poäng = 94 p. Preliminär gräns för godkänd = 50 p (53 %). Besvara varje fråga på separat papper! Ange tydligt längst upp på varje papper både

Läs mer

Cellcykel/Celldöd. Laborationsrapport 20/2-14. Basgrupp 1

Cellcykel/Celldöd. Laborationsrapport 20/2-14. Basgrupp 1 Cellcykel/Celldöd Laborationsrapport 20/2-14 Basgrupp 1 Louise Andersson Alexander Barhebreus Pontus Boberg Amanda Dahl Simon Ingves Christina Larsson Kajsa Lethin Thea Wennman Syfte Se skillnad på hur

Läs mer

Tentamen Reproduktion och utveckling, 2011-12- 10. Åke Strids frågor:

Tentamen Reproduktion och utveckling, 2011-12- 10. Åke Strids frågor: Tentamen Reproduktion och utveckling, 2011-12- 10 Åke Strids frågor: Inför celldelning måste DNA:t kopieras. 1. Redogör för hur kopieringen går till och vilka huvudkomponenter som ingår i kopieringsmaskineriet

Läs mer

Provmoment: Ladokkod: Tentamen ges för: tentamen TX091X TNBAS12. Namn: (Ifylles av student) Personnummer: (Ifylles av student)

Provmoment: Ladokkod: Tentamen ges för: tentamen TX091X TNBAS12. Namn: (Ifylles av student) Personnummer: (Ifylles av student) Biologi A basår Provmoment: Ladokkod: Tentamen ges för: tentamen TX091X TNBAS12 7,5 högskolepoäng Namn: (Ifylles av student) Personnummer: (Ifylles av student) Tentamensdatum: on 24 oktober 2012 Tid: 9.00-13.00

Läs mer

Livsmedelsverkets författningssamling

Livsmedelsverkets författningssamling Livsmedelsverkets författningssamling ISSN 1651-3533 Föreskrifter om ändring i Livsmedelsverkets föreskrifter (LIVSFS 2008:2) om modersmjölksersättning och tillskottsnäring; (H 373:1) Utkom från trycket

Läs mer

Tentamen i DD2396 Bioinformatik, 3 mars 2008

Tentamen i DD2396 Bioinformatik, 3 mars 2008 Tentamen i DD2396 Bioinformatik, 3 mars 2008 Kursansvarig: Lars Arvestad Inga hjälpmedel förutom skrivmedel är tillåtna. Skriv tydligt! Skriv bara på en sida av pappret. Ge dina svar tydliga motiveringar.

Läs mer

Pilotstudie NGS: E. coli ESBL från patienter med misstänkt sepsis

Pilotstudie NGS: E. coli ESBL från patienter med misstänkt sepsis Pilotstudie NGS: E. coli ESBL från patienter med misstänkt sepsis Helena Enroth, Med Dr (PhD), Klinisk molekylärbiologi, Unilabs, Skövde och Adj. Professor, Systems Biology Research Group, Inst. för biovetenskap,

Läs mer

På utsidan av insidan

På utsidan av insidan Nr 6 December 2001 Tidskrift för Institutet för biomedicinsk laboratorievetenskap På utsidan av insidan Tarmens slemhinnebarriär en komplex konstruktion Equalis användarmöte för primärvården För ganska

Läs mer