Behovsanalys!i!Botkyrka!kommun!

Storlek: px
Starta visningen från sidan:

Download "Behovsanalys!i!Botkyrka!kommun!"

Transkript

1 & BehovsanalysiBotkyrkakommun SamtbiståndshandläggardiskussioneriNackakommun. av Per'OlofSjöbergochMarieSjölinder 2010$09$02& & & 1

2 Slutrapport SilverTechnologyprojektetiBotkyrkakommun & Innehållsföreteckning& 1 INLEDNING SAMMANFATTNING Sammanfattning&behovsanalys Områden&lämpliga&att&adressera&med&hjälp&av&IKT$lösningar BEHOVSANALYS Genomförandeochmetod Äldrekvarboendeilägenhet Anhörigatillkvarboendeilägenhet Personalhosäldreikvarboende Äldreisärskiltboende Anhörigatilläldreisärskiltboende Personalpåsärskiltboende Cheferförverksamheterna WorkshopiNackamedbiståndshandläggare VISSAPROBLEMKANLÖSASMEDNYTEKNIK Trygghet'larm Nyteknikivardagen Spridningavinformationomhjälpmedel Kontaktmellananhörigochdenäldre AVSLUTANDEKOMMENTARER

3 Slutrapport SilverTechnologyprojektetiBotkyrkakommun 3 FÖRORDOCHTACK DettaarbeteharbedrivitsinomramenfördetVINNOVAfinansieradeprojektetSilver Technology.DetharvaritettsamarbetemellanHalmstadLivingLab(Högskolani Halmstad)ochStockholmLivingLab(SICS).VivilltackaBotkyrkakommunförett mycketgivandesamarbeteianslutningtilldeolikadiskussionssammankomsterna.vi villävenvarmttackaalladepersonersomhardeltagitisammankomsternaochbidragit medvärdefullakommentarerochsynpunkter.slutligenvillvitackanackakommunför derasinsatseravseendearbetetmedattlyftaframproblemochlösningarkring hanteringenavbistånd,hjälpmedelochlösningar. 1 INLEDNING DendemografiskaförändringenSverigestårinförärenavdesvårasteutmaningarna någonsin.sverigefårenalltäldrebefolkningochantaletickearbetandepersoneroch personeribehovavvårdökardramatiskt.föratthanterasituationenkommerdeäldre attbehövatashandompåettmycketeffektivaresättänvadsomgörsidag.nyaikt' lösningar(informationsochkommunikationsteknik)ochnyahjälpmedelbehöver införaspåbredfront.samtidigtbehöverrutinerochprocesserförvårdpersonalatt förändrasocheffektiviseras. Förattillustreradendemografiskaförändringenkanmanjämföraantaletpersoneri arbetsföråldermeddesomäröver65år.detvisarpåendramatiskförändringöver åren.siffrornaärbearbetadefrånscbdatabaser. Sedan1950har, tillidag förhållandet mellanantalet personer20'64 år/65+år halverats. År2040gårdet tvåarbetsföra påenäldre. År2020är21%avSverigesbefolkningöver65årochdensiffranstigerdärefter. Iochmedattdetgårtvåarbetsförapersonerpåvarjeäldrebehövermångaavde arbetsföra,omingetgörs,behövaägnasigåtarbeteivården.detkandessvärreockså påverkasverigesbnpochvårmöjlighettillensundsamhällsutveckling. SituationenärallvarligförSverigemeninteunik.Fleraandraindustriländermöteren liknandesituation. OmvisatsarnuattpåettstruktureratsättattutvecklaIKT'lösningar,utvecklanya metoderochprocesserinomäldrevården,anpassaboendetefternyakravsåharsverige 0,0 1,0 2,0 3,0 4,0 5,0 6,0 7, L64år/65+år 20'64år/65+år

4 Slutrapport SilverTechnologyprojektetiBotkyrkakommun 4 ututmärktlägeatttaenledandepositioninomområdet.sverigekanbliledandepå exportavlösningar,hjälpmedelochprocesserföräldrevården.sverigeharalla förutsättningaratttaenledandepositionberoendepåvårförmågaattsamarbetaöver gränsernamellanoffentligheten,industrinochforskning.destoraunikabostadsbolagen isverigeharocksåenviktigrollidennautveckling. SilverTechnologyprojektetharhafttillsyfteattförståsituationenpåkommunnivå.För attverkligenförståproblemställningarnaikvarboendeochsärskiltboende genomfördesettantalworkshopsibotkyrka,nackaochhalmstadkommun. Idennaförstadelavprojektetvarfokuspåattinventeraproblemochidentifiera möjligheter.idennarapportredovisasframföralltresultatenavundersökningarnafrån Botkyrkakommun. Ikommandeprojektkommerfokusvarapåatttillsammansmedsmåochmedelstora företagutveckla,framförallt,iktbaseradelösningarochprodukterbaseradepå identifieradeproblem.dessalösningarkanutprovasochanvändasavkommunernaför attunderlättaellereffektiviserakvarboendeellersärskiltboende. 2 SAMMANFATTNING ProjektetgenomfördesibådeBotkyrkaochHalmstadkommun,tillsammansmed HögskolaniHalmstad/HalmstadLivingLab,somettgemensamtprojekt.Dennarapport fokuserarpådetresultatsomkomframibehovsanalysenibotkyrkakommun.behoven vardockmycketsamstämmigaidetvåkommunerna,vilketgerettbredareunderlagför deslutsatsersomkandras. BehovsanalyseniBotkyrkagenomfördesiformasju workshops medolikarelevanta grupperinomkommunen.detvarbrukare,anhöriga,personalochchefer.analysen genomfördespåbrukareikvarboendesåvälsompåbrukareiäldreboende. Dessutomgenomfördesen Workshop medbiståndshandläggareinackakommun. IbehovsanalyseniBotkyrkaframkomdiverse problemställningarfördeolikagrupperna. Naturligtframkomocksåförslagtilllösningar. Dessalösningarärlistadeirespektiveavsnitt längreneridennarapport. Iflerafalltordelösningarnavaranaturligaochtill ochmedexisterande.tyvärrråderenstor okunskap,isågottsomallagrupper,om lösningarnasexistensochdehardärförinte spriditstilldesomskullevarabetjäntaavdem ochdärmedenkeltkunnaförenklavardagslivet.i andrafallservibehovavdirektutvecklingsom skullekunnabliettnaturligtnästasteg. Fleraavdeproblemsombeskrivitsi diskussionsgruppernaskullekunnaminskaseller avhjälpasmedolikatyperavikt.tillexempel finnsdetsystemförattbådevisavemfrån hemtjänstensomkommersamtförattkontrollera dennesidentitet.dylikasystemskulledockkunna

5 Slutrapport SilverTechnologyprojektetiBotkyrkakommun 5 utvecklasavsevärtmedsyftetattökadenäldresegenkontroll.dettabådegenomny designochgenomnyautökademöjlighetertilltilläggsfunktionalitet.vidareskulleden ökadeisoleringenvidhögålderkunnaminskasmedhjälpavikt.vidsidanav traditionella kommunikationsverktyg(mail,chat,skype)skulleteknikkunnaanvändas istörreutsträckningförattstödjainitiativtagandetillkontaktersamtförattskapa känslaavnärvaroavvännerochanhöriga. Ettannatområdesomskullekunnautvecklasytterligareärlarmen.Dessaskulleförses medflernivåer,utökadfunktionalitetsamtnyasättattinteragera.larmenskullkunna varabådepassivaochaktivasamtkunnainnehållakombinationeravdatafråndessa systemsamtfrånsensorerihemmet.dennainformationskulleockså,påett anonymiseratvis,kunnaanvändasiolikatjänsterochkommunikationmedanhöriga. BeträffandedenapatisomkandrabbaäldreskullefleraIKT'lösningarkunnabidratill attökamotivationentillolikatyperavengagemangochdeltagande.olika tekniklösningarkanvidsidanomattgeinformationomomvärldenbidramedstöd avseendeattochhurvardagligasysslorkanutföras.vidarekantekniskalösningar utvecklasförattstimulerainitiativtagandeellerintresseförattdeltaiolikaaktiviteter. Dessalösningarskulleävenkunnaanpassasutifrånolikaindividerspreferenseroch intresseområdenochiochmeddettakunnabättreriktamotivationshöjandelösningar. 2.1 Sammanfattning behovsanalys Behovsanalysengenomfördespåsjuolika grupperinombotkyrkakommun. Blanddeäldre&i&eget&boendevarproblemen medattkunnaklaraavvanligavardagssysslor sommantidigarehadeklarataventypisk faktorsomlyftesfram.rädslanattfallavar storochmanundvekdärförextremafysiska rörelser.deäldreidennagruppbeskreväven ökandeisoleringpågrundavattmångavänner hargåttbortdåmannåttenhögålder.hjälpen frånhemtjänstenfungeradebra,dockmedviss variationmellanolikaområden.detsomlyftes framsomnegativtmedhemtjänstenvarhög omsättningblandpersonalensamtbrister beträffandeidentifieringavdemsombesökte deäldre.deäldreidennagruppdiskuterade slutligenävenettbehovavattfånyaintryck ochattfåolikaupplevelsersåsomattkunna varainaturenellerattresa. Inomdennagruppaväldreiegetboendefanns enstorspridningkringvadsomvarkärnaniolikaproblem.någraavdeltagarnakundet exbaraanvändaenhand.dettavarnågotsomskapadeenalldelesspeciellproblembild fördennadelgrupp.enövergripandeslutsatsomgenomförandetattdenna diskussionssammankomstvarattdetkanvaragynnsamtattväljadeltagareisamma situationochmedliknandesvårigheteroch/ellersjukdomar.deolikasvårigheternaär

6 Slutrapport SilverTechnologyprojektetiBotkyrkakommun 6 såspecifikaförvarjegruppattdetkrävsattmankanfokuserapådeolikaspecifika problemenförattkunnahittameningsfullalösningar. Deanhörigatilldeäldreiegetboendebelystesammaproblemsomdeäldreavseende hemtjänstpersonalenochbristenpåidentifikation,dvs.attdetvarsvårtattvetavem sombesöktedenäldresamtomdetverkligenvarenpersonfrånhemtjänsten.vidare belystesviktenavattrutinerkringtrygghetssamtalviatelefonfungerareftersomdet barakrävsattdettafallerarenendagångföratttrygghetenskaraseras.detsomdock gerdenstörstatrygghetenfördenanhörigeärattdetärnågonpåplatshosdenäldre.i bristpådettakandetdockkännasbraattviaexternkommunikationkontaktadenäldre ochhöraattalltverkarbraochlåtersomdetbrukar.ävenproblemmedattklaraav vardagssysslorsomkräverfysiskrörlighetlyftesframavdennagrupp.önskemålom bättremöjligheterattfåhjälpmedsakerutanförhemtjänstensuppdragframkom.denna gruppavanhörigabeskrevävenviktenavattkunnaklaraavbankärendenochliknande påegenhand.dettaskulleunderlättasavattbankenbesöktedeäldreiställetförattde äldreskullebehövatasigtillbanken.slutligendiskuteradesviktenavsocialstimulans ochattdetegentligenintekrävssåmycketförattmanskauppnådetta.detskulleräcka medettbesökpåettkaféellerettbesökiettköpcentrum. Personalgruppenfrånhemtjänstentrycktestarktpåattdeuppskattadedestunderdåde kundekännaattdegjorttillvaronlitebättreförnågonavdeäldre.ävenomdeibland kändeavtids'ochpersonalbristsåvardenöjdameddenomsorgdegav.ettstort problemsomdennagruppdiskuteradevarattsåmångaolikaspråkförekom.detfanns bådepersonalochäldresomintepratadesvenska,vilketbidrogtillattvissaäldrehelt kundesaknamöjligheterattkommuniceraochgörasigförstådda.slutligenbeskrev personalgruppenviktenavattökavalmöjligheternafördeäldre,bådeavseendematoch omsorg. Idiskussionsgruppenmedäldre&som&bodde&i&ett&särskilt&boendebeskrevsviktenavatt manhademöjligheterattgörasaker.detviktigavarintevadutanattmaninteblev passiv.fleraavdeaktivitetersomanordnadespåboendenavaruppskattadeblandde boende.docklyftepersonalgruppenuppenproblematikkringkrystadeaktivitetersom kundeuppfattassomkränkandeavdeäldre.uppskattadeaktivitetervarvanligasysslor somfrämjadesocialtumgänge.vidarebelysteävenpersonalgruppenviktenavatt placeraäldreiliknandesituationochmedliknandeintressenisammaboendeochi sammagrupp.dettaskullegynnadetsocialaumgängetochdesspositivaeffekteristor utsträckning.deäldrelyfteävenuppproblematikenmedattkunnabesökavänner.det kan,vidsidanavproblemmedattförflyttasig,ävenvarasvårtattkunnabjudaigendå manboriettsärskiltboende.ävendeäldreidennagruppönskadesigfler valmöjligheter,isynnerhetbeträffandevalavmat.slutligendiskuteradedeäldrei dennagruppbristerilarmsystemet.larmsombaraharennivåavlarmgradskapar osäkerhet.manskulleviljakunnalarmabådevidfaraochvidbehovavhjälp.påsåvis skullemankännaenstörretrygghetavseendeattfåhjälpsnabbtdånågotakuthar inträffat. Deanhörigatilldeäldreisärskiltboendelyfteuppproblematikenkringattdeäldrekan bliapatiska.ävenomdetkanvaralättareförenanhörigänförpersonalenattfåmed denäldreutpånågonaktivitetsåkanpraktiskaproblemtillföljdavfysiska begränsningargörautflyktersvåra.ettannatrelateratområde,somävendettabidrar

7 Slutrapport SilverTechnologyprojektetiBotkyrkakommun till(ellerkommersigav)apatiäravsaknadenavintryckochkunskapomomvärlden. Dettaproblemkanvaraextrastortförmän,dåmöjligheternatillnaturliga samtalsämnenkanvarabegränsadedåpersonalentillstörstadelenärkvinnlig. Personalgruppenfrånsärskildaboendenbeskrevviktenavatthatidfördeäldre.Ett problemsomtidsbristkanmedföraärattpersonalenintehinnerlåtadeäldreutföra sysslorsomdeklararav.dettaärocksånågotsombidrartillapatiochmindre initiativtagandefråndenäldressida.slutligenpoängteradepersonalgruppenattde upplevdedetsomviktigtattarbetaiettbraarbetslagdärallaarbetadepåsammasätt. Idiskussionsgruppenmeddekvarboendeäldrefungeradedetbramedfrågoroch frågeområden.villmankopplatillteknikochprodukterkrävsdetkanskedockattman väljerdeltagaremedvissvanaavdatorerochteknik.studiemetodenmed diskussionsfrågorfungeradeäveniäldregruppensomkomfrånsärskildaboenden,dock intelikabrasomigruppenmeddekvarboende.detvarasvårareattfådeltagarnaatt beskrivaproblem,deflestavarnöjdaellerhadeaccepteratsinsituation.kanskekan ävennärståendehaenstörrerollavseendeattlyftaframproblemochbehovhosdenna grupp. 2.2 Områden lämpliga att adressera med hjälp av IKT-lösningar IsamverkanmedBotkyrkakommunharettantalpotentiellaområdenattgåvidaremed diskuterats.detfinnsmångaområdensomäradresserbaramennågraärspeciellt lämpadeattstödjamedhjälpavikt.någraavdediskuteradeområdenabeskrivsnedan. Trygghet larm Trygghetslarmområdetärytterstintressantförkommunernadådeseratttillgängliga larmlösningarskaparbådetrygghetmenocksådelotrygghet.trygghetslarmenhardålig återkopplingtillommanlarmatellerej.larmenfungerarbristfälligtutanförbostaden ochdeanvändsförtveksammalarmsituationer.larmenskullebehövaindividualiseras ochgörasmerprogrammerbaraefterlivsmönsterochefterolikasituationer.detgäller såvälpassivitetssomaktivalarm. Nyteknikivardagen Införandetavnyteknikförteknikovanaäldreärettstortproblem.Detefterfrågas lättanvändteknikbådeisambandmeddatorer,tv,kommunikationochandra hjälpmedel.enklagränssnittförittjänsterärenförutsättningförenstorspridning. Attgradvisförainnyteknikiettmodultänkdärmantidigtvänjersigmedteknikenären möjliglösning. Spridningavinformationomhjälpmedel Ettgenomgåendestortproblemhosbrukare,hosanhörigaochhospersonalenär okunskapenomvilkahjälpmedelsomfinnspåmarknadenochhurdekananvändasi olikasituationer.detfinnsidagingabrametoderförattspridadennakunskaptilldessa grupper.detverkarsomdetmångagångermerärentillfällighetänenrutinsomgöratt etthjälpmedelbörjaranvändasavenbrukare. Kontaktmellananhörigochdenäldre 7

8 Slutrapport SilverTechnologyprojektetiBotkyrkakommun Kontaktenmellandenäldreochdenanhörigeärettmycketviktigtområde. Undersökningarnaharvisatattdetfinnsenheldelbristeridagidennakontakt. Härfinnsstorautmaningarmensamtidigtenmycketstorgrundförattföraineffektiva IT'lösningarsomkanökatrygghetenbådefördenäldreochfördenanhörige.Ett supportsystemsomskaparinformationsöverföringkringhändelserelleravsaknadav händelserskulleupplevasmycketpositivt.detkanvaraettsmsnärkvällsmedicinen tagitsellerenenkelhälsningvidspeciellatillfällen. Teknikenupplevsidagsomalldelesföropersonligochhårdavmånga,videotelefoniär ettexempelpåen mjukare lösningdärmankansedenmanpratarmed. 3 BEHOVSANALYS BehovsanalyseniBotkyrkakommungenomfördesiformavsjusammankomsteri workshopform.tresammankomsterbestodavdeltagaremedanknytningtillomsorgi hemmetochtresammankomsteravdeltagaremedanknytningtilläldreboenden.varje sammankomstriktadeinsigpåengruppavpersoner,äldre,anhörigaellerpersonal. Slutligengenomfördesensammankomstmedcheferpåolikanivåer. 3.1 Genomförandeochmetod Metodernasomanvändesviddeolikasammankomsternavarieradenågotberoendepå deltagargrupp.uppläggetochfrågeformuleringarnaskiljdesigåtmellanäldre,anhöriga, personalochchefer. Detvåsammankomsternamedäldre&deltagaregenomfördesmedhjälpavblädderblock påväggen.ettantalförbestämdafrågeområdenskrevsuppochdeltagarnauppmanades attdiskuterabehov,problemochlösningarpåproblemutifråndeaktuella frågeområdena. Deolikafrågeområdenafördessasammankomsterberördeblandannatvadman saknadeattkunnagöra,kontaktenmedanhörigasamtolikaaspekterpåtrygghet. 8

9 Slutrapport SilverTechnologyprojektetiBotkyrkakommun Detvåsammankomsternamedanhörigadeladesintvådelar.Idenenadelen diskuteradesbehov,problemochlösningarpåproblemutifråndenäldresperspektiv.i denandradelendiskuteradesdessasakerurdeanhörigasperspektiv.frågornasom diskuteradesurettäldreperspektivvarfokuseradepåtrygghetsamtvadsomskulle kunnaunderlättadenäldreslivssituation.frågornasomdiskuteradeurett anhörigperspektivvarfokuseradepåtrygghet,kontaktmeddenäldresamtkontakten medomsorgsgivaren. Sammankomsternamedpersonalendeladesävendennainitvådelar.Idenenadelen diskuteradesolikaaspekteravdeäldresbehovsamtdeanställdasarbetssituation. Dennadelberördeområdensomleveransenavvård,kommunikationmedvårdtagaren samtarbetsrutiner.denandradelenvarinriktadpåhurmanskullekunnalösaproblem ochpåhurmanskullekunnaförbättrainomolikaområden.underdennadelvalde deltagareochdiskussionsledaretillsammansutettantalområden.dessadiskuterades vidaremedfokuspåhurmanskullekunnaförändraellerförbättra. Sammankomstenmedchefsgruppengenomfördesutifråndiskussionkringtre frågeområdensompresenteradesmedhjälpavdator.detförstadiskussionsområdet berördedeäldressituation,detandradiskussionsområdetberördeleveransenavvård ochdettredjeochsistadiskussionsområdethandladeomolikalösningarochinsatser. Detinsamladematerialetbearbetadesbaseratpådeolikainsamlingssätten,gemensamt vardockdenkvalitativaansatsenochdentematiskaindelningenavmaterialet.itexten nedanredovisasäventabellermedolikaförslagpålösningarsomframkomi diskussionernameddeäldreochdeanhöriga.endelavdessalösningsförslagbyggerpå endialogmellandeltagareochdiskussionsledare,eftersommångaavdeltagarnaivissa situationerintevisstevilkatekniskalösningarsomfannstillgängligaidagsläget. 3.2 Äldrekvarboendeilägenhet Deäldredeltagarnaidennagruppbestodav4kvinnoroch3män.Diskussionenmedde äldredeltagarnabyggdesuppkringfrågoromvadmanskulleviljakunnagörasomman intekunde,respektiveinteskulleviljabehövagöra.vidareställdesfrågorkring trygghet,kontaktmedanhörigasamtkringomsorg/hemtjänst. Sakersomärsvåraattgöraellersommansaknarattkunnagöra:Ettområde,som diskuteradesistoromfattningigruppenaväldre,varsvårigheterattklaraavvanliga vardagssaker.fleraavdeltagarenigruppentoguppattdetvartråkigtattinteklaraav sakersommanengångitidenhadeklaratav.sakersomärhögtplaceradeihemmetär väldigtsvåraattnåellerattförflytta.diskussionsdeltagarnanämndetexattdeskulle viljakunnasättauppgardinerellerputsakopparenpåhyllan,mendetfinnsenstor rädslaattramlanerochskadasig.manärvanattklarasigsjälvochdetkänns förödmjukandeattbehövabeomhjälp.fleraavdeltagarnaigruppenbelysteviktenav attkunnagåtillaffärenochhandlasinegenmat.dennasituationmedfördedock besvärligaellerobehagligamomentsommanskulleviljaslippa.harmanrollatorärdet förtrångtiaffärenochmankommerintefram.detärsmalapassagerochdetfinnsvaror somärplaceradeigångarna.detkanävenvarasvårtattbetalamedkontanterommant exskakar. 9

10 Slutrapport SilverTechnologyprojektetiBotkyrkakommun Förslag på lösningar saker som underlättar utförandet av vardagssysslor Allt som underlättar i boende som man idag inte får gjort, men som borde kunna ordnas genom att man får kontakt med dem som kan utföra olika tjänster Automattvättande fönster Automatstädning Förslag på lösningar saker som underlättar om man skakar Spis med ugn där plåten åker ut när man öppnar ugnsluckan. Sked som sluter kring maten mellan tallrik och mun Någraavdeltagarnahadebaraenhandsomdekundeanvända.Dettamedfördeproblem avolikatyper.vissaproblemlöstekommunenåtdemmedhjälpavolikahjälpmedel. Andraproblemförsöktedesjälvahittalösningarpå.Någraavdeproblemsomdenna gruppbeskrevvar:svårtattbredaensmörgåseftersommanintekundehålladenstilla; svårtattknytaskornamedenhand;svårtattklippanaglarna;samtsvårtatttapåsig strumporna.vidarepåtaladedeltagarnaigruppensombarakundeanvändaenhandoch behövderollator,attdetvarsvårtattköradennamedbaraenhandeftersomdendågår snett. Förslag på lösningar saker som underlättar om man bara kan använda en hand Fixbräda med piggar som man la smörgåsen på så att man kunde breda den. Ordna en termos som innebär att man kan hälla upp kaffe samtidigt som man håller i koppen. Stolptrådar som man spänner upp sockan med. En rollator där handtaget är på mitten. Flytta hjulen på rollatorn längre fram så att man inte snavar på hjulen. Stationär sax som kan styras med fingret som man klipper med. Eller en sax som kan hanteras med foten. Deltagarnaigruppensaknadeocksåupplevelsersomdetidigarekunnafåilivet,men somintelängrevarmöjligtpågrundavorörlighetellerandrafysiskahinder.texatt kunnaresa,attkunnasimmaihavetellerattkunnagåiskogenochplockabäroch svamp.ommanvilleresaellergörautflyktervardetväldigtbesvärligt(förbesvärligt) atttamedrollatorn.detskulleävenblialldelesfördyrtatttamedsigenledsagarepåen längreresa. Förslag på lösningar saker som möjliggör upplevelser En helt ihopfällbar rollator som blir en som fyrkantig låda. Nyttja Internet och resa på nätet som sedan kan utvecklas till VR resor med möjlighet att styra vad man vill se och där man kan ha resesällskap. Kontaktmedvännerochanhöriga:Ettproblemförmångaäldresomnåttenhögålder ärattmångavännerhargåttbort,ochattdetärsvårtattfånyabekanta.ettsättattfå nyavännerkanvaraattengagerasigochstartauppaktiviteter.endeltagareberättade omatthonfåttnyavännergenomattspelabridgeochbingo.attgåochätamedandra beskrevssomenviktigsocialsammankomst.deltagarnaigruppenberättadeävenatten delställenhadeuppskattadepub'kvällar.slutligenlyftesfrågesportframsomentrevlig aktivitet.kontaktenmedanhörigasågolikautfördeltagarnaigruppen,någrahadebarn 10

11 Slutrapport SilverTechnologyprojektetiBotkyrkakommun inärheten,medanandrahadebarnsomboddelångtbort.telefonvardetvanligaste sättetattkommunicera,menendeltagarehöllkontaktenmedsindotterviae'mail. Kontaktenmeddeanhörigakundehaflerasidor,deltagarnaberättadetexattdeinte villestörasinabarnochsinfamilj.manvilleinteringaföroftaellerbehövabjudainsig själv. Förslag på lösningar kontakten med vänner och anhöriga Skype eller liknande Sociala tjänster som känner av (låg) aktivitet i lägenheten, kan stödja umgänge och aktiviteter Kontaktochrelationtillhemvården:&Deltagarnatyckteatthemtjänstenfungerade olikabraberoendepåvarmanbodde.påettavställenframkommångaåsikterom personalen,texattdenvarnyhelatiden,attmaninteändeigendesomkomochattde intehadenamnlapparpåsig.dåpersonalenintehadenamnlapparblevdetsvårtattlära signamnenpådesomkom.ävenavsaknadenavuniformellerenhetligklädselvarnågot somdeltagarnaidiskussionsgruppenupplevdesomnegativt.utannamnlappoch/eller uniformkundemanintevarasäkerpåomdeverkligenarbetadeförhemtjänsten.under diskussionenlyftesävenviktenavdenpersonligakontaktenfram,ochattdennainte kundeersättasmedteknik.påettavboendenaifrågasattesattcheferdatoriserade verksamhetensåpersonalenintehadetidattpratameddeäldre. Förslag på lösningar kontakten med hemvården De borde visa vad de heter Möjlighet att tända en grön diod innanför dörren som visade att, man var behörig Tjänst som visar vem som ska komma från hemtjänsten Trygghet:Närhetentillhemtjänstenihusetskapadetrygghet.Deltagarnaberättadeatt detskapadeentrygghetattbliseddochigenkändavhemtjänstenihuset.detvarviktigt förkänslanavtrygghetattandramänniskorvissteomattmanfanns,ochattmanmådde bra.deltagarnapåtaladeävenettbehovavattnågonhöravsigochkontrollerarattman lever,attmaninteharramlatellerliggerochbehöverhjälp.olikatyperavlarm diskuteradessamtävenproblemmedlarmsomärförkänsligaochkanfalsklarma. Riskenförfalsklarmbidrartillattmanintevillhadempåsig.Igruppenfannsävenett behovavfleratyperavlarm,intebaradesomärreaktiva(attmanmåstetryckapå dem).ettpassivtlarmkanocksåvarabra,texdådetkontrollerasattmanharspolati toaletten. Förslag på lösningar trygghet och larm Rutiner för att någon ringer till en (Telefonen fungerar, Trygghet när det ringer på telefonen) Kontakt, text, bild, olika former av asynkron kommunikation Olika typer av övervakning Positivt om man var övervakad och att man rör på sig eller att hjärtat slår. Låsa knappen på samma vis som man kan låsa knappsatsen på en mobiltelefon. Hjälpmedel:Förmångavardagssakersomdeltagarnahadeproblemmed,texattinte kunnataavsigstrumpornaellerattintekunnaöppnaburkarmedlock,finnsdet hjälpmedelför.dockverkadekunskapenom,ellertillgångentilldessa,varalåg.i 11

12 Slutrapport SilverTechnologyprojektetiBotkyrkakommun diskussionenvardetdeltagaresomupplystevarandraomvadsomfanns.densom behövdehjälpmedletvissteinteomattdetfanns.dekontakterdiskussionsdeltagarna hadehaftmedarbetsterapeuterhadeinteriktigtresulteratiattdefåttallade hjälpmedelsomdebehövde.detvisadesigävenattdeltagarnavarvilligaattköpa hjälpmedelföregnapengar,menattdeintevisstevardekundetaredapåvadsom fanns.eftersomdeflestaintehadetillgångtillinternetkundedeintehellertadelav Hjälpmedelsinstitutetsinformation(HItorget). 3.3 Anhörigatillkvarboendeilägenhet Omdenäldressituation Anhöriggruppenbestodav5kvinnoroch1man.Diskussionenmeddeanhörigabyggdes uppkringfrågorsomrördetrygghetsamtomvadmantroddeskullekunnaunderlätta denäldressituation. Trygghet:Ävendeanhörigatilldekvarboendeäldrehadesynpunkterpåhemtjänsteni anslutningtillotrygghet.svårigheternaattidentifierapersonalutannamnskylttogsupp ävenidennadiskussion.ävenproblematikenattdetärmycketolikapersonalochatt manintevetvemsomkommerdiskuterades.vidarehadedetvifleratillfälleninte fungeratkringhemtjänstensdagligatelefonsamtaltillvissakvarboendeäldre.denna tjänstbeskrevssomväldigtviktig,bådefördeäldresochdeanhörigastrygghet.det behövdesdockbaraettmissattelefonsamtalförattraseratrygghetenochförattskapa otrygghet.slutligendiskuteradesolikasättattfåutfelrapporteromhemtjänstenmissat attringanågonavdeäldre. Enannankällatillotrygghetsomnämndesvaroroföranhörigameddemens.Antingen kundemanlåtadenäldrekommaut,dåriskerademanatthan/honkomvilse;ellerså kundemangörasåattpersonenintekundetasiguturlägenhetenmedpåföljdenatt han/honkännasiginlåstellerkundehamnaifaraomdetblevbråttomattsigutur lägenheten. Förslag på lösningar - trygghet För ökad säkerhet kring vem som kan ta sig in i lägenheten: Intelligenta timer-varianter lösningar som stöder personens rutiner För att undvika känsla av att känna sig inlåst: Lösningar för personen, vid dörren på väg ut (inlåst) högtalare som talar om vad och varför. Meddelandet startar om man tar i handtaget. Ha med sig tekniklösningar från tid då man var friskare. Hur rustar man lägenheter så att de blir funktionella över tid över åldrandet, kognitiva hjälpmedel, talande dagböcker etc. Personligare morgonrutiner utan personal, kaffe-fix, frukostmaskin etc. använda personal till umgänge istället bättre än stressad människa. Sakersomkanunderlättadenäldresvardag:&Endelsakeriboendet&kundeställatill problem.deanhörigalyfteframviktenavinsatsersåsomatttrösklarmåstetasbortpå grundavfallriskensamtinstallationavdetektorersomslåspånärmanrörsigpånatten. Att&få&hjälp&med&vanliga&vardagssysslorsomfallerutanförhemtjänstensomsorgerskulle varatillstorhjälptycktemångaidiskussionsgruppen.allakändeintetill Botkyrka fixaren somkundekommahemochordnadetsomdenäldreintekundeklaraavsjälv. 12

13 Slutrapport SilverTechnologyprojektetiBotkyrkakommun Förslag på lösningar saker som underlättar vardag och social samvaro Väntjänst mycket som de inte gör eller kan göra. Kunna utveckla väntjänsten Stötta upp umgänget, samtalet, inte ställa frågor. Bilddagbok bilder från förr, musik från förr Det skulle behöva utvecklas minnesstöd för att komma ihåg: Bilder från förr, dansdagbok, andra nöjen. Utveckla TV/spel som kompenserar jobbigt för andra att umgås med personer med demens etc. Anhöriga - förenklad Skype helst mot TV:n en knapp med namn oavsett teknisk lösning Beträffandevardagsrutiner&och&hygiensaknasdetklädersomärlättaatttapåochsom intekostarsåmycketsomspecialtillverkadekläderkangöra.detfinnsingasnyggaoch praktiskakläderfördesomsitterirullstol.deltagarnaidiskussionsgruppenlyftefram viktenavattdenäldrekanhållasvarm.värmehjälpermotvärkochdåligcirkulation, mendetärsvårtattanvändavärmefiltareftersomdeintefårbliblötautanmåstevara vattentåliga.närmanärutanförhemmetkantoalettbesökvaraproblematiska.detär ävenviktigtattkunnagåtillbanken&och&att&kunna&sköta&sin&ekonomi.manbehöverkunna pratamednågonpåbanken.deanhörigaefterfrågadeenpersonfrånbankensom kommertilldenäldreiställetförattdeäldreskabehövatasigtillbanken. Nöjen&ochattkommautärviktigt.Deanhörigaidiskussionsgruppentroddeinteattdet krävdessåmycket.detskulleräckamedattkommaut,fikaellerbesökaett shoppingcenter.detvikigavaratttittapåfolkochrörelseochattnågonfrånpersonalen kundevaramedpådetta.eftersomdetkanvarasvårtellerotryggtattvarautepå kvällenbehövdesdetattnågonkundeföljamedutpådagtid.social&samvaro&och& kommunikationärviktigmenkanvaraproblematisk,denkanvarasvårviddemenseller baravidförsämratminne.detkanvarasvårtmedsamtalsämnenellersvårtatthållaen rödtrådisamtalet.vissaandrasakerblirocksåsvåradåmöjlighetentillattsättasakeri ettsammanhangminskarellerförsvinner.detskaparfrustrationdåmanintekanfölja medikonversationerellerhändelseförlopp. Förslag på lösningar nöje och underhållning Ljudböcker bra, reglage (TV, musik) kan stå på högt och de inte vet hur de ska sänka. Telefon som inte kräver lur etc. bara knapp och gå ut i rummet GPS funktion så den äldre kan ta sig till och från affären. Sång karaoke, band med sang allsång så att de kan sjunga med Wii är mycket uppskattat, speciellt bowling. Karaoke är populärt. Anhörigatillkvarboendeilägenhet omsinegensituation Diskussionmeddeanhörigaomderasegensituationbyggdesuppkringfrågoromvad manskulleviljakunnagöratillsammansmeddenäldresommanbehövdestödföratt kunnagöra.vidareställdesfrågorkringhurkontaktenmeddenäldrefungerade,om trygghetsamtomomsorgen/hemtjänsten. Sakermanvillkunnagöratillsammans:Desakersomdiskussionsgruppen huvudsakligenbelystevarrelateradetillpraktiskaproblemsomuppstoddåmangjorde sakertillsammans.tillexempeldåmanrestemednågonsomhadedemens.ibland måstemanlämnapersonenensam,dettakrävdeattmanhadenågonformavkontakt medvarandraförattmanskullekunnahakontrollsåattingethände.ettannatproblem 13

14 Slutrapport SilverTechnologyprojektetiBotkyrkakommun vidresorvartoalettbesök.manskullebehövahamedsigentoalettförhöjareförden äldre.iländersominteharvåratyperavtoalettervardetännusvårare.ävendenövriga hygienenbeskrevssomettproblempåresor. Behovsominteadresserasfulltut:Detsomomnämndessomdetabsolutstörsta problemetvarattdetkommermångaolikamänniskorfrånhemtjänsten.problematiken kringhurhemtjänstenkommerinilägenheternabelystesäven.endeläldrehadesvårt atttasigtilldörrenochlämnadedärfördörrenolåst.dettaskapadeensäkerhetsriskoch kundeävenskapaotrygghetfördeanhöriga. DiskussionsgruppentogvidareuppattProblemmedattanvändaolikaapparater.Många äldretittarmycketpåtv,menbådeapparaternaochfjärrkontrollernakanvarasvåra attanvända.detbordefinnasenklafjärrkontrollermedavochpåochnågrafåkanaler attväljamellan.enannanviktigvardagssysslaärattpåegenhandkunnabörjadagen medenkoppkaffe.dockärmångakaffebryggaresåkompliceradeattdeäldreinte klararavattanvändadem.ettannatproblemsombelystesvarattdetkanvarasvårtför mångaäldreatttasigframioländigterräng.detsaknadeshjälpmedelsomunderlättade detta.rollatornharinteutvecklatssedandenkom,denärotympligochdenkaninteta sigöverhinder. Förslag på lösningar behov som inte adresseras fullt ut Enkla fjärrkontroller med av och på och några få kanaler att välja mellan. Enkel kaffekokare/bryggare som fungerar som en kaffeautomat där man bara trycker på en knapp som det står kaffe på De äldre behöver speciella datorgränssnitt Kontaktenmeddenäldre:Deanhörigaidiskussionsgruppenhöllkontaktmedsin närståendeviatelefonochdeträffadedem1'2gångeriveckan.synpunkterframkom avseendeattdetviddemensskullevaraextrabraattkunnasedenäldre.manskulle viljakunnagåinochsehurdetserut.bildenskullegöramycketeftersomendastljudet kundebliobehagligtomdensomvardementinteförstodvarljudetkomifrån.iett sådantanvändningsområdemåstedockteknikenkunnastödjakommunikationenutan attmottagarenbehöverhandhaellerställainteknikenpåegenhand. Förslag på lösningar kontakt med den äldre anhörige Demens skulle vilja ha Skype eller liknande vill kunna se varandra. Skapar trygghet om man bor långt borta Rollator som klarar kanter, grenar och andra hinder bättre än de rollatorer som finns idag. Trygghet:Detsomskapartrygghetfördeanhörigaärnärnågonärhosdenäldre.Det kännsäventryggtattpratamedsinnärstående,dåhörmanvadhan/honsägerochman kankännaavomdetärbraochomalltföljersinarutiner.detskaparävenentrygghet blanddeanhörigadåhemtjänstenringervarjemorgon.detärväldigtviktigtattdenna rutinfungerarväleftersomdetskaparotrygghetomdemissarattringa. Enotrygghetsfaktorfördeanhörigaärfallrisken.Någraanhörigatänkteständigtpå fallriskenfördenäldre.maneftersöktenågotsomlarmadeävenompersoneninte kundelarmasjälv.någonformavpassivtlarmsomfungeradevälutanattorsakafellarm efterfrågades.ettsådantlarmskullereageradånågotintestämmerochbordegåatt 14

15 Slutrapport SilverTechnologyprojektetiBotkyrkakommun programmeraeftersituation,livsmönsterochfunktionsnedsättningar.larmetskulle kunnavarakänsligtförljud,rörelser,kroppssignalermedmera.vidaretycktegruppen attlarmenbordekunnagörasmycketintelligentaremedtexbildanalysomenperson liggerpågolvet.förattdeanhörigaidiskussionsgruppenskullekännasigtrygga krävdesävendubbla/fleralarmsystemifallettlarmsystemintefungerade. Förslag på lösningar - trygghet Saker som nämndes som redan finns: Spisvakt, starka lampor, trösklar (borttagna) Övervakningskamera med integritet, ska bara reagera och gå igång då något är onormalt. T ex om personen har ramlat. Ett smart larm som är anpassat efter individuella förutsättningar. Kunna lyssna i lägenheten, bio-feedback/sensorer som läser av medicinska värden. Maskin (eller rutin) som påminner hemtjänsten om att ringa till de äldre på utsatta tider Central uppringningscentral och låta några ha det som enda uppgift. Bekräftelse till anhörig att samtalet skett Kontaktenmeddenäldreshemvård:Deanhörigatyckteatthemvårdenbrasti avseendeattlegitimerasigdådekomhemtilldenäldre,ochävenattdetvardåligtatt deintebarnamnskyltar.depoängteradeävenvissabristerirutiner,texuteblivna inplaneradedagligatelefonsamtaltilldeäldre.enannanfrågasomdiskuteradesvaratt manidagintefårnågotkvittopåvilkenvårdelleromsorgsomharlevererats.utförda sysslorbordekvitterastexelektronisktellermedhjälpavbandspelare.detskulle skapaskvittonpånärmanvarhosdenäldreochpåvadmangjorde.slutligen poängteradedeianhöriggruppenattdetlönarsigalltförmycketattvaraelakochställa krav.desomintegördetfårintelikabraservice. 3.4 Personalhosäldreikvarboende Personalgruppensomdeltogidiskussionssammankomstenbestodav4kvinnor.De frågorsomdiskuteradesbelystevilkahindersomfannsförattdeäldreskullekunna kännasigtillfredsmedtillvaron.vidarediskuteradesvårdsituationenurett personalperspektivavseendekvalitetochtrygghetdetsistastyrdafrågeområdetbelyste personalensarbetsrutiner. Hinderförattäldreskakännasigtillfredsmedtillvaron.Personaleni diskussionsgruppenbeskrevettantalsakersomhindradeattdeäldrekändesigtillfreds medtillvaron.ettstortproblemvarattäldreärmycketensamma,ochattmångaavde boendeiderasområdeävenbefinnersiglångtfrånanhörigasomboriettannatland. Bakgrundenfrånandraländerochmedföljandespråkproblematikökarisoleringen ytterligare.problemenmedattkommuniceramedpersonalenkanuppståfråntvå perspektiv,detkanantingenvaradenäldreellerpersonalensomsaknartillräckliga kunskaperisvenska.personalgruppenangavocksåattderastidsbristdrabbadede äldre,samtattdetävenfannsoutbildadpersonalsominteförstoddeäldresbehov. Vidaretogdiskussionsgruppenuppfysiskaproblemsometthinderfördeäldre.Dehar ontochvärkikroppen,ochimångafallliderdebristpåbrasjukvård.slutligen diskuteradebristenavvalmöjligheterfördeäldre,bådeavseendevalavmatsamtöver lagimångasammanhang. 15

16 Slutrapport SilverTechnologyprojektetiBotkyrkakommun 16 Braochdåligasakeravseendedenvårdsomlevereras.Depositiva&aspektersom angavsvarattpersonalgruppenkändesignöjdamedsinainsatser.dekändeattde gjordeettmycketbrajobb.vidarelyftediskussionsgruppenframviktenavattdetvar roligtsamtattdettavarenförutsättningförattmanskullekunnagöraettbrajobb.det varävenoerhörtviktigtattkännaattbrukarenvarnöjd'detkändesbraattkännaatt manhadegjortnågongladare. Negativa&aspektersomdiskuteradesvarattpersonalenkundekännasigstyrdaav biståndshandläggarensbeslut.dettakändedeiochförsigattdekundepåverkaiviss utsträckning,dockskulledeviljavaramedpåvårdplaneringarochhembesökistörre utsträckning.vidareansågpersonalgruppenattarbetssituationeniblandkundevara stressig.delegeringtillvikariertogförlångtidochnypersonalfickförkort introduktionstid.ävenantaletvikarierhadeökatpåsistatiden,någotsomskapade otrygghethosbrukarna.ävendetökandeantaletbrukarebidrogtillattflervikarierkom in.slutligenbeskrevstessystemet(tes Trygghet,EnkelhetochSäkerhet),somvar nyttförpersonalen,somenbidragandefaktortillökandepersonalvariationfördeäldre, eftersomsystemetkanläggainfleraolikapersonaltillenbrukarepåsammadag. Trygghet.Språkproblemendiskuteradesävensomenkällatillotrygghet.Dekundeleda tillmissuppfattningarisituationerdåmanbådehadepersonalochäldresomintetalade svenska.dessutomkompliceradesdetytterligareavnypersonalsomsaknadeförståelse förspråkbruket. Blandytterligaresakersomskapadeotrygghetiarbetssituationendiskuterades personalbristsomenviktigfaktor.vidarekundeomorganisationermednyaområden ochnyacheferskapaotrygghet.sjukdomhospersonalmedpåföljdenattmanmåsteta överandrasarbeteocksåvarocksåenfaktorsomangavssomnågotsomskapade otrygghet.vidareansågdiskussionsgruppenatthanddatornochdetnyinfördates systemetskapadestressdådetintefungerade,ellerdåsystemetvarlångsamt(dådet togförlångtidattloggain).systemetstyrdeävenarbetetpåettsättsåattpersonalen kändesigmindrefri,bådeavseendetidsplaneringochavseendevardebefannsig(gps). Detnyasystemetmeddesshanddatorangavsävensomnågotsomkundebidratill trygghetdådettextillhandahöllstödförplanering.vidarebelystesytterligareviktenav braplaneringochbraorganisationförattskapatrygghetochlågpersonalomsättning. Detvisadesigävenvaraviktigtmedenbraochnärvarandechefsomstodbakom personalenochsomgickattfåtagpådåmanbehövde. Arbetsrutiner.Enstordelavdiskussionenkringarbetsrutinerhandladeomdetnya handdatorbaseradesystemettes.deltagarnaidiskussionsgruppentyckteattsystemet varbraeftersomdetinnehölluppgifterombrukarna,kontaktinformationtillanhöriga samtinformationommedicinering.systemetgjordedetävenmöjligtförpersonalenatt gedeäldreinformationomnästabesök.enytterligarefördelmedtesvarattdet faktisktvisadeattpersonalenhademycketattgöra.överlagansågpersonalgruppenatt planeringenavarbetetfungeradebra. NågranegativasakersomdiskussionsgruppennämndeangåendeTES'systemetvaratt planeringpådettasättinnebarlängreframförhållning(längreplanering),samtattdet toglångtidattplaneraom.enytterligarenegativaspektavseendetesvarattdetgav möjlighetattöverbokapersonal.dettaeftersomsystemetintetoghänsyntillverkliga

17 Slutrapport SilverTechnologyprojektetiBotkyrkakommun avståndattfärdasochrealiteterkringsysslorsommanutfördeutanförhemmet.i anslutningtilldettalyftesviktenavattgöraenindividuelltidsplaneringfram. ArbetsrutinerochsysslorsomnämndesvidsidanavTESvaratthandlamatochatt utföraövrigaärendenpåstanåtdenäldre.handlingavmatbeskrevssomjobbigt,tungt ochtidsödande.matinköpskeddeförsällansåattdetblirmycketvarorochtungtatt bäravarjegång.betalningavvarargjordesmeddenäldreskortellermedkontanter, ävendettakundevarabådebesvärligtochkännasosäkert.inompersonalgruppenfanns ettstarktbehovochettuttalatönskemålomattinhandlingenavmatvarorskulleutföras avnågonannanpersonalgrupp.ettspecialfallavattutföraärendensombeskrevsav diskussionsgruppenvarapoteksärenden.dessavarproblematiskaeftersomdeinte specifiktgickattbeviljaavbiståndshandläggare.dessabesökföllinomkategorininköp ochärenden,mentogisigstortidianspråk.förattkunnafåihopdettidsmässigtmed dentiddenäldrehadebeviljatsmåsteapoteksbesökläggasihopmedhandling.detta medfördeattpersonalentillbringademyckettidpåattspringaruntpåstanbärandes tungasakeriställetförattkunnavarahosdenäldreochhjälpahonomellerhennei hemmet. Möjlighetertillförbättringar.Diskussionssammankomstenmedpersonalgruppen avslutadesmedattgruppengemensamtbeslutadeomnågrafrågorattdiskuteravidare kring.dettautifrånettperspektivkringhurmanskullekunnaskapabättre förutsättningarfördeäldreochfördenvårdsomges. Enfrågasomvaldesattbelysafrånettperspektivhurmanskullekunnaförbättravar bristen&på&valmöjligheter&för&äldre.deförslagtillförbättringarsomdiskuteradesi personalgruppenvar: Störreinflytandeövervarmanvillbo.Möjliggöraboende(flytt)tillannankommun såattmankommernärmareanhörig. Kunnapåverkasindygnsrytmistörreutsträckning.Låtadenäldresovapådetider han/honvillellerärvanattsova. Störreinflytandeövermatochhandling.Kunnabestämmavemsomhandlaråten. Kunnabestämmafrånvilkenrestaurangmanfårmaten.Genomavtalskapa samarbetenmedrestaurangersomökarantaletställensomkanlevereramattill äldre. Störreinflytandeövervilkenpersonalsomkommertilldenäldre,kunnaväljasjälva vemsomkommer. Bättrevalmöjligheteravseendevalavvård.Kunnaväljavilkenvårdcentraleller vilketsjukhusmanvillgåtill.ävenstörremöjligheterattpåverkavalavmedicin skullegynnadenäldreochökakänslanavvalfrihet. Ettannatviktigtområdeförförbättringsomlyftesframvarinhandlingen&av&mat&samt& utförandet&av&olika&ärenden.dessaskullekunnaförbättrasgenomatt: Attaffärenplockarihopvarornaochkörutdem. Enklarebetalningssättsomundvikerhanteringenavkontanter,texnågot kreditsystemellerfakturafrånaffärerna. StödjamöjligheterattfördeäldreellerpersonalenattbeställamatviaInternet. Apoteksärendenskullekunnaunderlättasgenomenspecialkassapåapoteken,eller undvikasheltgenomhemleveransavmedicin. 17

18 Slutrapport SilverTechnologyprojektetiBotkyrkakommun systemet.denviktigastefaktornsomlyftesframvarbehovetavettenklaregränssnitt somgavenbättreöverblick.diskussionsgruppenönskadeenöversiktihanddatornsom visadebådebrukareochpersonalsåattmanpåettenklaresättkundefåenkänslaför attingetblevförbisett. 3.5 Äldreisärskiltboende Deltagarnafråndenäldregruppenbestodav3kvinnoroch3män.Diskussionmedde äldredeltagarnabyggdesuppkringfrågoromvadmanskulleviljakunnagörasomman intekunderespektiveinteskulleviljabehövagöra.vidareställdesfrågorkringvilken typavstödmanönskadesigsamthurkontaktenmedanhörigaochmedpersonalenpå boendetfungerade.slutligendiskuteradesfrågoravseendetrygghet. Sakersomärsvåraattgöraellersommansaknarattkunnagöra: Diskussionsdeltagarnatycktedetviktigavarattmangjordenågot.Detkundevara trivialasakersåsomboulespelellerfrågesporter.detuttrycktesintresseavattdelta gymnastikgruppersamtatthamöjlighetattbadabastuianslutningtillboendet.musik ochsångvarnågotsomflerauppskattadeeftersomdethöjdestämningen.enperson saknadeattdansa.ianslutningtillsamtaletomdansberättadedockdeltagarnaattde iblandåkteivägochdansadepåettannatboende.enannanavdeltagarnasaknadeatt kunnagåpåteater.detvardocksvårtatthittanågonattgåmedochdetvarsvårtatt kunnagenomföradethelarentpraktiskt.detvanligastedåmanvillekommautvaratt manfickhjälpavanhöriga. Mångasakermanskulleviljakunnagöramenintekundehadesingrundifysiska begränsningar.endeltagarevillekunnagåutanrollator,ellerönskadeiallafallatthan skullekunnatameddenpåettenklaresätt.omrollatornvarlättareatttamedskulle hankunnaresa,vilketvarnågothanönskadekunnagöra. Detvarfåsakersomdeltagarnatyckteattdevartvungnaattgörasomdeintevill.De berättadeattdefickhjälpmeddetmestaochattpersonalenvarlyhördavseendehurde villehadet.någraavdeltagarnatycktedockattdekundekännaobehagianslutningtill duschsituationen.devillinteduschaeftersomdeblevkallaochfrösefteråt. Stödmanönskadesigiframtiden:Dennafrågainleddesmedendiskussionom datorerochattdekundesysselsättamånga.allaigruppenhadeanväntdator,men väldigtfåhadedockvaritpåseniornetsomhållertillpåbiblioteketibotkyrka.botkyrka kommunharnintendowiipånågraavsinaäldreboendenochnågonuppskattadespel sominnebarattmankunderbowlaellerspelaboule. Deteknikrelateradeproblemensomkomuppidiskussionenvarattmobiltelefonerna harförsmåknapparochförlitentext.ommantexfickettsmssåkundemaninteläsa det.detvarävenmångasomledavattandrabehövdehasintvpåsåhögtförattkunna höra.diskussionsdeltagarnabelystedockattdettakundelösasmedhjälpavhörlurar somkundereglerasefterbehov.tyvärrleddedettatillattmanblevutestängdfrån andraljud. 18

19 Slutrapport SilverTechnologyprojektetiBotkyrkakommun Slutligen,underdennahuvudrubrik,diskuteradesmöjlighetenattväljamat.Detvar svårtförpersonalenatthållaredapåspeciellamatbehov,isynnerhetomdetvarnågon maträttsommanintetyckteomochintevilleha. Förslag på lösningar saker som man önskade sig i framtiden Integrera ihop allt ljud till en hörapparat som kan ta in signaler utifrån också. Alternativt ha hörlurar som är anslutna till någon central del i hemmet. Även för att kunna ringa. Kontaktenmedanhörigaochvänner:Enavdeltagarnahadevännersomhonblev bjudentill.bådedennaochandradeltagarelyftedockframattdennatypavumgänge varproblematiskeftersomdetvarsvårtattbjudatillbakadåmanboddepåett äldreboende.detvanligastesättetatthållakontaktenmedvännerochanhörigavarvia telefon.detfannsdeltagareigruppensomanvändeskypeförattkommuniceramedsina vänner.förandravarskypeheltokänt. Förslag på lösningar kontakt med anhöriga och vänner Skype på TV skulle vara mycket bra. Fler programvaror på nätet skulle dessa personer vara betjänta av att få beskrivna och tillgängliga. Beskrivna på olika sätt. Kontaktenmedpersonalenpåboendet:Enaspektsomkomuppidiskussionenvar attdeäldrekändesigutestängdafrånsinegenvårdsituation.deskulleviljavetamerom vadsombehandladespåpersonalmötena.fleraavdeäldretroddeattmötenahandlade omdemochdärförvilledevaramedpåmötena.devilleävenvaramedpådemöten medläkarensomrördedem.vidareframkomdet,angåendeläkaren,attdeupplevdeatt han/honaldrighadetidattstannaföratthörahurmanmådde.vadgällde medicineringen,ochdepåsarsomkomfrånapoteket,fungeradedetbra. Trygghet:Dennadiskussiongavförstintrycketaventrygggruppdäringeninitialt kändeotrygghet.efterenstundframkomdetdockattdekändeenstorotrygghetkring larmet.deboendevarosäkrapåhuruvidaenlarmsignalgåttframtillpersonaldåman tryckteftersomkvitteringsaknades,ochdetkundeäventalångtidinnannågon personalkom.deflestatryckningarvarsåkallade normalahjälptryckningar (texfå hjälpmedatttapåsigstrumporna),viddessagjordedetingetommanfickväntalite. Dennaväntanskapadedockenorokringvadsomskullehändaomdetvarenskarp larmtryckningochpersonalenintekomsnabbtnog.utifrånsamtaletverkadedetatt finnasolikatyperavlarmsomanvänds.endelvarkoppladetillenhögtalaresomgjorde attlarmpersonalenkundetalameddensomlarmat.andralarmvarbaraenknapp. Överlagverkadekunskapenomolikahjälpmedelvaralåg.Deäldrekändeintetill hjälpmedelsomdeskullekunnavarabetjäntaav. Förslag på lösningar trygghet och larm Ett larm borde kvitteras till exempel genom att knappen vibrerade på armen eller gav ifrån sig ett ljud. Man skulle kunna ha olika typer av larm för de akuta och en annan knapp då man bara behöver den normala hjälpen. Ordna med demonstrationer av hjälpmedel öka arbetsterapeuternas insatser (tid, utbildning etc.). 19

20 Slutrapport SilverTechnologyprojektetiBotkyrkakommun Anhörigatilläldreisärskiltboende Omdenäldressituation Anhöriggruppenbestodav5kvinnoroch2män.Defrågorsomdiskuteradesvarvad somkundefådenäldreattkännasigtryggsamtvilkentypavsakersomskullekunna underlättadenäldresvardag. Trygghet:Deanhörigaidiskussionsgruppenlyfteframurviktigtdetärförkänslanav trygghetatthasammapersonalsamtattdennaharhögkompetensochkännerempati. Detyckteävenattdetvarbraomdensomarbetadehelgävenarbetademåndag förmiddag.sommarenkundevaraenproblematisktidsombidrogtillorofördeäldre. Medmångavikarierbrötsrutinerochkontinuitet.Osäkerhetenkringomlarmsystemet fungeradeskapadeotrygghet.deltagarnatyckteattdetävenbordefinnas kompletterandetyperavlarmifallmanintekundetryckapåenlarmknapp. Sakersomskulleunderlättadenäldresvardag:Diskussionsdeltagarnatyckteatt boendenaskullehabalkongerförattskapamöjligheterattkommautävenomdetinte fannstidförpersonalenatttameddeäldreut.detframkomävenidiskussionenatt värmenvaralldelesförlågfördeäldreävenomdenlågpå21grader.sittermanstill heladagensåblirmankall.deanhörigatyckteävenattmatenbordevarabättre.den sågintetilltalandeutochmanlauppförmycketmatpåtallriken.matenvarinte tillräckligtvarierandeochdetbordevarastörreskillnadmellanvardagochhelg.man bordetexdukafinarepåhelgerna.tidernaförmåltidernaärintealltidhelleranpassade efterdeäldresönskemål,texsåäterdekvällsmatförtidigt.slutligenbelystedeltagarna viktenavattlagamatenpåplats,mångaäldreskulledessutomviljavaramedochlaga maten. DetkanvarasvårtattskötabankärendenviaInternet,detbordefinnasenklaresätt. Bankgirofungeradebra,mendetbyggdeistorutsträckningpåattanhörigafannsoch hjälptetill.ettproblemsomlyftesframvarattdetvarbesvärligtmedfullmaktförvarje besök/räkning.bankenbordebesökaäldreboendenaförattdelautendosatillden anhörigesomsedankanskötaekonomin. Någraavdenöjensomdeanhörigatroddeskullevarauppskattadeblanddeboendevar pubkvällarochseminariermedförfattaresomkommerochberättaromsinaböcker ellersinaliv.vidaretroddediskussionsdeltagarnaatthögläsningskullevaraenbra syssla,samtattdetkundevarabraompensionärernasjälvadeltogochengageradesi underhållningen.andraaktivitetersomföreslogsvartillgångtillsnickeriellerattfå hållapåmedhushållssysslor.vadgälldetittandetpåtvsåtycktedeanhörigaattde äldrebordekunnaväljablandflerprogram.vidarebeskrevdedetpositivai användandetavhörlurarochmöjlighetenattkunnabestämmavolymensjälv. AnhörigatilläldreisärskiltboendeLomsinegensituation Diskussionenmeddeanhörigaomderasegensituationbyggdesuppkringfrågorom vadmanskulleviljakunnagöratillsammansmeddenäldresommanbehövdestödför attkunnagöra.vidarediskuteradesbehovsomdenanhörigeupplevdeattdeintefick hjälpmedidagsläget.slutligenställdesfrågorkringhurkontaktenmeddenäldre fungeradesamtvadsomvarviktigtförattdenanhörigeskullekännatrygghet.

BO-IT ett samverkansprojekt för att möta utmaningen i en åldrande befolkning

BO-IT ett samverkansprojekt för att möta utmaningen i en åldrande befolkning BO-IT ett samverkansprojekt för att möta utmaningen i en åldrande befolkning Teknik för självständighet, social samvaro och trygghet. Individer önskar i de allra flesta fall klara sig själva så långt det

Läs mer

Som tiden går. Hjälpmedel som gör vardagen lättare

Som tiden går. Hjälpmedel som gör vardagen lättare Som tiden går Hjälpmedel som gör vardagen lättare Att minnas Förgätmigej är en elektronisk tidskalender som visar dag och datum på en display och gör det lättare att komma ihåg vilken dag och månad det

Läs mer

Andelen hörselskadade ökar med stigande ålder

Andelen hörselskadade ökar med stigande ålder Andelen hörselskadade ökar med stigande ålder Andel hörselskadade bland äldre 65-74 år: 28 % 75-84 år: 39 % 85-110 år: 46 % Källa: SCB, genomsnitt 2008-2012 På sjukhus och äldreboenden är det inte ovanligt

Läs mer

PAPPA ÄR UNDERSKÖTERSKA DANIEL LEHTO EN JULIASAGA

PAPPA ÄR UNDERSKÖTERSKA DANIEL LEHTO EN JULIASAGA PAPPA ÄR UNDERSKÖTERSKA DANIEL LEHTO EN JULIASAGA Daniel Lehto 2011 daniellehto@yahoo.se Till Julia PAPPA ÄR UNDERSKÖTERSKA DANIEL LEHTO Pappa jobbar på ett boende för gamla människor. Det är ett roligt

Läs mer

Fiber till alla. Fiber till alla. Kommunledningskontoret informerar

Fiber till alla. Fiber till alla. Kommunledningskontoret informerar Fiber till alla Fiber till alla Kommunledningskontoret informerar Innehåll Kommunikationsplan för fiber i Simrishamns kommun 3 Vad vi kommunicerar 4 Praktiska exempel 5 Några målgrupper 6 Vad är optisk

Läs mer

Mobilt trygghetslarm. För äldre Kroniskt sjuka Funktionshindrade

Mobilt trygghetslarm. För äldre Kroniskt sjuka Funktionshindrade Mobilt trygghetslarm För äldre Kroniskt sjuka Funktionshindrade TRYGGHETSLARM ÄR FÖR MÅNGA DEN LÖSNING SOM GÖR DET MÖJLIGT ATT BO KVAR HEMMA TROTS FUNKTIONSHINDER ELLER KRONISK SJUKDOM. SYFTET MED ETT

Läs mer

Sakernas internet. (Internet of Things)

Sakernas internet. (Internet of Things) Sakernas internet (Internet of Things) Vad är det? Från streckkoder på paket till bokföringssystem ( Datorerna är ju saker ) Transport Självkörande bilar Automobil Självdisciplinering Träning Kost Sömn

Läs mer

2014-11-11. E-hemtjänst. En undersökning om möjligheterna för e-hemtjänst i Lidköping

2014-11-11. E-hemtjänst. En undersökning om möjligheterna för e-hemtjänst i Lidköping 2014-11-11 E-hemtjänst En undersökning om möjligheterna för e-hemtjänst i Lidköping 1 E-hemtjänst - En undersökning om möjligheterna för e-hemtjänst i Lidköping LIDKÖPING DECEMBER 2014 2 3 Innehållsförteckning...

Läs mer

Vad är ett trygghetslarm? En installatör kopplar in trygghetslarmet hos dig. Nycklar till din ytterdörr

Vad är ett trygghetslarm? En installatör kopplar in trygghetslarmet hos dig. Nycklar till din ytterdörr Larmet troget Vad är ett trygghetslarm? Trygghetslarm är till för dig vars hälsotillstånd gör att du kan behöva hjälp omedelbart, och där du har svårt att tillkalla hjälp på annat sätt. Är du 75 år eller

Läs mer

Genomförandeplan Personlig omsorg

Genomförandeplan Personlig omsorg Fastställd 300 Vad ska göras Morgon Personlig hygien Klädsel Bäddning Diskning Sophantering När ska det göras Ca 8.30 Detta gör jag själv Jag går med min rollator bredvid dig till toaletten. Under tiden

Läs mer

Hjälpmedelsinstitutet

Hjälpmedelsinstitutet Hjälpmedelsinstitutet (HI) Hjälpmedelsinstitutet Höjd livskvalitet genom stödjande teknik Verksamhetsidé: Nationellt kunskapscentrum inom området hjälpmedel och funktionshinder Arbeta för full Delaktighet

Läs mer

Trygg om natten En studie av kunders, anhörigas och personals perspektiv på införandet av ny teknik inom nattpatrullens arbete

Trygg om natten En studie av kunders, anhörigas och personals perspektiv på införandet av ny teknik inom nattpatrullens arbete Trygg om natten En studie av kunders, anhörigas och personals perspektiv på införandet av ny teknik inom nattpatrullens arbete Helena Eriksson och Anna Isaksson För utveckling av verksamhet, produkter

Läs mer

Kommunikationsplan för fiber i Simrishamns kommun

Kommunikationsplan för fiber i Simrishamns kommun Kommunikationsplan för fiber i Simrishamns kommun Syftet med detta dokument är att stödja alla som jobbar aktivt med att få fler att vilja ha en fiberanslutning i Simrishamns kommun. Vid all kommunikation

Läs mer

Hörsel- och dövverksamheten. Information till dig som har hörselnedsättning Hörselverksamheten

Hörsel- och dövverksamheten. Information till dig som har hörselnedsättning Hörselverksamheten Hörsel- och dövverksamheten Information till dig som har hörselnedsättning Hörselverksamheten Hörseln, ett av våra sinnen Hörseln är ett av våra allra viktigaste sinnen för att kunna kommunicera med våra

Läs mer

Trygghet och glädje hela livet. Äldreomsorg i Karlskrona kommun

Trygghet och glädje hela livet. Äldreomsorg i Karlskrona kommun Trygghet och glädje hela livet Äldreomsorg i Karlskrona kommun Hej senior! I den här broschyren berättar vi om de olika insatser som Karlskrona kommun erbjuder dig som fyllt 65 år. Sveriges pensionärer

Läs mer

Energi jacktens koncept

Energi jacktens koncept Energi jacktens koncept Vi har utvecklat ett koncept som ska hjälpa personer sänka sin energiförbrukning och ge dom en lättförstådd överblick av sin förbrukningen. Konceptet bygger på en programvara som

Läs mer

Omgivningskontroll ur ett barns perspektiv. Hanna Gullskog LD Hjälpmedel, KLOK Kommunikation, Larm, Omgivningskontroll, Kognition

Omgivningskontroll ur ett barns perspektiv. Hanna Gullskog LD Hjälpmedel, KLOK Kommunikation, Larm, Omgivningskontroll, Kognition Omgivningskontroll ur ett barns perspektiv Definition av omgivningskontroll Med omgivningskontroll menas att med annat styrsätt än en vanlig fjärrkontroll eller vanlig trycknapp styra saker i omgivningen

Läs mer

Målmedveten hörsel och varseblivning Dina kunder anförtror dig

Målmedveten hörsel och varseblivning Dina kunder anförtror dig Hör ditt hem Målmedveten hörsel och varseblivning Dina kunder anförtror dig sina hörselproblem: Smart Alert System ger ett meningsfullt och mycket enkelt tillfälle att utöka hjälpen till dem och samtidigt

Läs mer

Life is on. www.phonak.se

Life is on. www.phonak.se Life is on Vi är lyhörda för behoven hos alla dem som är beroende av våra kunskaper, idéer och omsorger. Genom att utmana teknologins gränser på ett kreativt sätt utvecklar vi innovationer, som hjälper

Läs mer

Tekniska prylar leder till gräl i de svenska villorna

Tekniska prylar leder till gräl i de svenska villorna PRESSMEDDELANDE 2011-12-12 Tekniska prylar leder till gräl i de svenska villorna Två av tio svenskar som bor i hus tycker att tekniken begränsar umgänget med familjen. Lika stor andel tycker att tekniken

Läs mer

TEKNIKSTÖD FÖR ÄLDRE. innocare

TEKNIKSTÖD FÖR ÄLDRE. innocare TEKNIKSTÖD FÖR ÄLDRE innocare För EU projektet Innocare handlade det om att ge sig ut på oplöjd mark och börja skapa något nytt. Mänskliga möten Innovativ teknik Trygghet i hemmet Ledorden i rubriken speglar

Läs mer

Omgivningskontroll. Jenny Jansson 2013-03-20. KLOK Kommunikation Larm Omgivningskontroll Kognition

Omgivningskontroll. Jenny Jansson 2013-03-20. KLOK Kommunikation Larm Omgivningskontroll Kognition Omgivningskontroll Jenny Jansson 2013-03-20 KLOK Kommunikation Larm Omgivningskontroll Kognition IR-styrning I det här materialet presenteras olika hjälpmedel som gör det möjligt att styra olika elektriska

Läs mer

Ökad trygghet i det egna hemmet med Trygghetslarm

Ökad trygghet i det egna hemmet med Trygghetslarm Ökad trygghet i det egna hemmet med Trygghetslarm Så här fungerar Trygghetslarmet Trygghetslarmet är en högtalartelefon som kopplas in i ett strömuttag och fungerar tillsammans med en larmklocka som du

Läs mer

Träffpunkt Skogslid. månadsblad September 2015

Träffpunkt Skogslid. månadsblad September 2015 Träffpunkt Skogslid månadsblad September 2015 Tis 1 9.00-10.15 14.30-16.00 Våffel café 25 kr Anders och Bertil spelar Ons 2 15.00 Kort bingo Anhörig café (café för anhöriga som vårdar sina respektive i

Läs mer

Ensam och fri. Bakgrund. Om boken. Arbetsmaterial LÄSAREN. Författare: Kirsten Ahlburg. www.viljaforlag.se

Ensam och fri. Bakgrund. Om boken. Arbetsmaterial LÄSAREN. Författare: Kirsten Ahlburg. www.viljaforlag.se Arbetsmaterial LÄSAREN Ensam och fri Författare: Kirsten Ahlburg Bakgrund Ensam och fri är en berättelse om hur livet plötsligt förändras på grund av en skilsmässa. Vi får följa Lena och hennes tankar

Läs mer

LARM. Bygg ditt eget larm. Arbeta med elektriska kretsar. Skydda dina värdesaker.

LARM. Bygg ditt eget larm. Arbeta med elektriska kretsar. Skydda dina värdesaker. LARM Bygg ditt eget larm. Arbeta med elektriska kretsar. Skydda dina värdesaker. INNEHÅLL kretskort och larmpanel batterihållare brickor lysdioder, LED motstånd summer strömbrytare påsnitar skruvar kartong

Läs mer

Välkommen till särskilt boende på Blomstervägen

Välkommen till särskilt boende på Blomstervägen Välkommen till särskilt boende på Blomstervägen SÄRSKILT BOENDE FÖR PERSONER MED DEMENSSJUKDOM Gemensamt för särskilt boende är att det finns gemensam matsal och dagrum, höj - och sänkbar säng inklusive

Läs mer

glädjestunder ni kan ha tillsammans på tu man hand minskar sannolikt på känslan av missnöje och desorientering.

glädjestunder ni kan ha tillsammans på tu man hand minskar sannolikt på känslan av missnöje och desorientering. Skånes universitetssjukhus Minneskliniken i Lund Omvårdnadsplan för TRIVSEL Vårdtagare nr 1, född 1922, diagnos ospecifik demens Läkemedel: Datum: Kontaktperson: Bakgrund: Änkeman sedan flera år, har 2

Läs mer

Medelpunkten. en social mötesplats för seniorer och frivilliga. Foto Taina Ahola

Medelpunkten. en social mötesplats för seniorer och frivilliga. Foto Taina Ahola Medelpunkten en social mötesplats för seniorer och frivilliga Foto Taina Ahola Augusti 2015 ANSLAGSTAVLAN Seniorveckan 13-18 september Seniorveckans program finns att hämta på Medelpunkten, Rådhuset och

Läs mer

HEMTJÄNST i Årjängs kommun

HEMTJÄNST i Årjängs kommun Rev 140116 HEMTJÄNST i Årjängs kommun Innehållsförteckning Vad kan du ansöka om enligt Socialtjänstlagen... 3 Ingår i städning... 4 Ingår ej i städning... 4 För att vi skall kunna städa behövs... 5 Ingår

Läs mer

Information om vårdbostad. Att bo i vårdbostad

Information om vårdbostad. Att bo i vårdbostad Information om vårdbostad Att bo i vårdbostad Att bo i vårdbostad Den här broschyren ger en kort beskrivning över de krav som äldrenämnden ställer på den vård och omsorg som bedrivs av både privata och

Läs mer

Välfärdsteknologi inom äldreomsorgen i Munkedals kommun

Välfärdsteknologi inom äldreomsorgen i Munkedals kommun Välfärdsteknologi inom äldreomsorgen i Munkedals kommun Sammanfattning Den demografiska utvecklingen innebär att andelen äldre med omsorgsbehov kommer att öka, samtidigt som det kommer att bli svårt och

Läs mer

PRIORITERINGSORDNING HEMREHAB

PRIORITERINGSORDNING HEMREHAB PRIORITERINGSORDNING HEMREHAB 1 vecka 2 veckor 4 veckor boende, klarar sig hemma. Skapa trygghet/säkerhet. 1:A boende. åtgärder. 1:C boende utan hemtjänst. åtgärder. 3:B ordinärt boende. Skapa trygghet/säkerhet.

Läs mer

Lokal anvisning 2012-04-30

Lokal anvisning 2012-04-30 1(5) Virusorsakad gastroenterit Lokal anvisning 2012-04-30 Ersätter tidigare dokument Basala hygienrutiner är den absolut viktigaste åtgärden för att förebygga smittspridning i vården. De skall konsekvent

Läs mer

Handlings plan RoM projektet för : Stattutgatan 4, avd 6 Datum: 2010. Förbättringsområde Delmål/Mål Hur gör vi? Klart/när?

Handlings plan RoM projektet för : Stattutgatan 4, avd 6 Datum: 2010. Förbättringsområde Delmål/Mål Hur gör vi? Klart/när? Handlings plan RoM projektet för : Stattutgatan 4, avd 6 Datum: 2010 Förbättringsområde Delmål/Mål Hur gör vi? Klart/när? Resultat Ny arbetsordning Vardagsrehabilitering Gå till maten Förbättra personalens

Läs mer

Riktlinje för stöd till Anhöriga som vårdar eller stödjer en närstående

Riktlinje för stöd till Anhöriga som vårdar eller stödjer en närstående Riktlinje för stöd till Anhöriga som vårdar eller stödjer en närstående Socialförvaltningen Vård och Omsorg 2012-04-10 Innehåll 1 Bakgrund 5 2 Direkt stöd till anhöriga i Arboga kommun 6 2.1 Information...

Läs mer

Om företaget Comai AB

Om företaget Comai AB Om företaget Comai AB Företaget grundades av personer med kompetens inom pedagogik, rehabilitering och kunskaper inom att utveckla produkter enligt principen design for all. Företaget har även fått innovationsutmärkelser

Läs mer

Stark, trådlös anslutning till din tv, mobiltelefon......och andra viktiga enheter

Stark, trådlös anslutning till din tv, mobiltelefon......och andra viktiga enheter Stark, trådlös anslutning till din tv, mobiltelefon......och andra viktiga enheter Det har aldrig varit enklare att ansluta sig ReSound Unite är en serie trådlösa tillbehör som gör att du kan ansluta din

Läs mer

VÄLKOMMEN TILL JOHANNESLUND ÄLDREBOENDE. Hemmatrivsel i natursköna Västerhaninge

VÄLKOMMEN TILL JOHANNESLUND ÄLDREBOENDE. Hemmatrivsel i natursköna Västerhaninge VÄLKOMMEN TILL JOHANNESLUND ÄLDREBOENDE Hemmatrivsel i natursköna Västerhaninge KONTAKTINFORMATION JOHANNESLUND ÄLDREBOENDE Enhetschef: Inger Norlin, A-sidan, 08-606 72 17, inger.norlin@haninge.se Anne

Läs mer

VANLIGA FRÅGOR FRÅN BOENDE OM HSB BOLINA

VANLIGA FRÅGOR FRÅN BOENDE OM HSB BOLINA 2015-03-27 VANLIGA FRÅGOR FRÅN BOENDE OM HSB BOLINA Hur kommer jag igång med HSB Bolina? Svar: Koppla in datorn i bredbandsuttaget i väggen och gå till www.bredbandswebben.se. Väl där så kan du se alla

Läs mer

Bruksanvisning. Tack för att du har valt Neckmike R4 Bluetooth Intercomsystem från Neckmike AB

Bruksanvisning. Tack för att du har valt Neckmike R4 Bluetooth Intercomsystem från Neckmike AB Bruksanvisning Tack för att du har valt Neckmike R4 Bluetooth Intercomsystem från Neckmike AB För att snabbt och enkelt komma igång med ditt användande ber vi dig läsa igenom denna bruksanvisning och spara

Läs mer

Äldreomsorg i NYNÄSHAMN. En guide till vad du kan få hjälp med

Äldreomsorg i NYNÄSHAMN. En guide till vad du kan få hjälp med Äldreomsorg i NYNÄSHAMN En guide till vad du kan få hjälp med Nynäshamns kommun Innehållsförteckning Att ansöka om hjälp och stöd 3 Hemtjänst 4 Stöd 5 Färdtjänst 6 Särskilt boende 7 I hemmet 8 Tryggt

Läs mer

1.9. Bjurholms kommun 1 (5) Rutiner kring trygghetstelefon För hemtjänst och nattpersonal

1.9. Bjurholms kommun 1 (5) Rutiner kring trygghetstelefon För hemtjänst och nattpersonal Bjurholms kommun 1 (5) Rutiner kring trygghetstelefon För hemtjänst och nattpersonal Hur får människor trygghetstelefon? Biståndshandläggaren får information om behovet och beviljar trygghetstelefon. Biståndshandläggaren

Läs mer

KRISPLAN ALLMÄNNA RÅD OCH MALLAR

KRISPLAN ALLMÄNNA RÅD OCH MALLAR KRISPLAN ALLMÄNNA RÅD OCH MALLAR Dessa råd med tillhörande mall för krisplan och mall för dokumentation, som framtagits av Svenska Aikidoförbundet, kan användas av aikidoklubbar anslutna till förbundet.

Läs mer

Stöd och service till pensionärer och personer med funktionsnedsättningar i Norrköping

Stöd och service till pensionärer och personer med funktionsnedsättningar i Norrköping Stöd och service till pensionärer och personer med funktionsnedsättningar i Norrköping Det är vård- och omsorgsnämnden som har ansvar för kommunens äldre- och handikappomsorg. Vård- och omsorgsnämnden

Läs mer

HEMTJÄNST. i Årjängs kommun

HEMTJÄNST. i Årjängs kommun HEMTJÄNST i Årjängs kommun 2012 Innehållsförteckning Vad kan du ansöka om enligt Socialtjänstlagen...3 Ingår i städning 4 Ingår ej i städning 4 För att vi skall kunna städa behövs..5 Ingår i klädvård 5

Läs mer

Kognition-Teknik. Inga-Lill Boman leg arbetsterapeut, med dr Rehabiliteringsmedicinska universitetskliniken Danderyds sjukhus AB

Kognition-Teknik. Inga-Lill Boman leg arbetsterapeut, med dr Rehabiliteringsmedicinska universitetskliniken Danderyds sjukhus AB Kognition-Teknik Inga-Lill Boman leg arbetsterapeut, med dr Rehabiliteringsmedicinska universitetskliniken Danderyds sjukhus AB Tekniska hjälpmedel för kognition Nytt begrepp Definieras som en teknisk

Läs mer

Åskrapporten 2015. Ingela Samuelson, Skadeförebyggare Folksam

Åskrapporten 2015. Ingela Samuelson, Skadeförebyggare Folksam Åskrapporten 2015 Ingela Samuelson, Skadeförebyggare Folksam Varför gör vi detta? År 2014 var ett Åskrikt år. Folksam fick in ungefär lika många åskskador som under åren 2012-2013 tillsammans. Totalt anmäldes

Läs mer

Hörseltjänst Göteborg

Hörseltjänst Göteborg Hörseltjänst Göteborg Leg Audionom Karin Ilstedt Nordstadstorget 6 411 05 GÖTEBORG Tel 031-761 08 01 Tidsbokad mottagning www.horseltjanst.se karin.ilstedt@horseltjanst.se maj 2014 2 Hörseltjänst erbjuder:

Läs mer

Hjälp i hemmet Hjälp i hemmet kan beviljas i form av omsorgsinsatser, serviceinsatser samt trygghetslarm.

Hjälp i hemmet Hjälp i hemmet kan beviljas i form av omsorgsinsatser, serviceinsatser samt trygghetslarm. Hjälp i hemmet Hjälp i hemmet Hjälp i hemmet kan beviljas i form av omsorgsinsatser, serviceinsatser samt trygghetslarm. Omsorgsinsatser Du kan få hjälp med din personliga hygien och med på och avklädning.

Läs mer

Sammanställning av anteckningar samt enkäter från medborgardialogen angående framtidens äldreboenden.

Sammanställning av anteckningar samt enkäter från medborgardialogen angående framtidens äldreboenden. Rapport Datum 2014-08-27 Sida 1(8) Robert Hagström robert.hagstrom@vargarda.se Sammanställning av anteckningar samt enkäter från medborgardialogen angående framtidens äldreboenden. Sammanfattning Cafédialog

Läs mer

Råd och tips på hur du kan förebygga fallolyckor

Råd och tips på hur du kan förebygga fallolyckor Råd och tips på hur du kan förebygga fallolyckor Fall och fallskador kan förebyggas Risken att ramla och drabbas av skador ökar med stigande ålder. Det finns en hel del du kan göra själv eller tillsammans

Läs mer

Samordning enligt SOSFS 2008:20 och ICF. Exempel patientfall

Samordning enligt SOSFS 2008:20 och ICF. Exempel patientfall Samordning enligt SOSFS 2008:20 och ICF. Exempel patientfall Gustav 78 år: Stroke, epilepsi, periodvis nedstämdhet, inkontinens, diabetes. Bor med frisk hustru i handikappanpassad lägenhet. Hjälpmedel

Läs mer

Information om rehabilitering och hjälpmedel

Information om rehabilitering och hjälpmedel Information om rehabilitering och hjälpmedel Välkommen till Gällivare Kommun! Du kommer att jobba med våra boende inom äldreomsorg, handikappomsorg eller psykiatri. Vad kul att du vill göra det! Här kommer

Läs mer

Trygg hjälp när hörseln inte räcker till

Trygg hjälp när hörseln inte räcker till Trygg hjälp när hörseln inte räcker till Sinnesro för dig och dina nära och kära Säkerhet, självständighet och sinnesro skänker livskvalitet och det är något som du förtjänar när du blir äldre. Det är

Läs mer

Välkommen till Hantverkarn

Välkommen till Hantverkarn Välkommen till Hantverkarn Rev juni 2014 Hantverkarn är ett särskilt boende som består av 28 lägenheter. På Hantverkarn arbetar vi efter målsättningen att skapa en lugn, trygg och förtroendefull hemmamiljö

Läs mer

Ökad trygghet i det egna hemmet med. Trygghetslarm

Ökad trygghet i det egna hemmet med. Trygghetslarm Ökad trygghet i det egna hemmet med Trygghetslarm April 2014 Så här fungerar Trygghetslarmet Trygghetslarmet är en högtalartelefon och består av två delar, en huvuddel som placeras i ditt fasta telenät

Läs mer

Välkomna till Tuvängen 3 Adress och telefonnummer 3 Boendet 4 Allmän information 5 Kontaktperson 6 Besök 7 Måltider 7 Checklista 8

Välkomna till Tuvängen 3 Adress och telefonnummer 3 Boendet 4 Allmän information 5 Kontaktperson 6 Besök 7 Måltider 7 Checklista 8 Tuvängen Innehållsförteckning Välkomna till Tuvängen 3 Adress och telefonnummer 3 Boendet 4 Allmän information 5 Kontaktperson 6 Besök 7 Måltider 7 Checklista 8 2 Välkomna till Tuvängen Tuvängen är ett

Läs mer

Få ut mer av dina hörapparater. Phonaks trådlösa tillbehör

Få ut mer av dina hörapparater. Phonaks trådlösa tillbehör Få ut mer av dina hörapparater Phonaks trådlösa tillbehör Modern hörapparatsteknik gör det bekvämt att lyssna och höra i de flesta situationer. Men när du talar i telefon, ser på TV eller befinner dig

Läs mer

Lokala värdighetsgarantier för äldreomsorgen, Gnesta kommun

Lokala värdighetsgarantier för äldreomsorgen, Gnesta kommun Lokala värdighetsgarantier för äldreomsorgen, Gnesta kommun Rätt till privatliv och kroppslig integritet 1. Vi garanterar att vi respekterar att bostaden tillhör Ditt privatliv Vi knackar eller ringer

Läs mer

Välkommen till Spelmannen

Välkommen till Spelmannen Välkommen till Spelmannen Rev sep -15 Spelmannen är ett särskilt boende som består av 43 lägenheter där 14 av dessa är särskilt anpassade för personer med demenssjukdom. Vi erbjuder även parboende för

Läs mer

Håll dig på benen Tips och råd för att förebygga fall

Håll dig på benen Tips och råd för att förebygga fall Håll dig på benen Tips och råd för att förebygga fall De flesta fallskador som drabbar äldre personer sker i det egna hemmet och i närmiljön. Kanske har du själv eller någon du känner ramlat den senaste

Läs mer

Karolinska Exhaustion Disorder Scale 9

Karolinska Exhaustion Disorder Scale 9 KEDS Karolinska Exhaustion Disorder Scale 9 Avsikten med detta formulär är att ge en bild av ditt nuvarande tillstånd. Vi vill alltså att du försöker gradera hur du mått de senaste två veckorna. Formuläret

Läs mer

2212 Hjälpmedel för teckning och handskrift 221203 Manuella hjälpmedel för att teckna och skriva Betalas av patienten/brukaren.

2212 Hjälpmedel för teckning och handskrift 221203 Manuella hjälpmedel för att teckna och skriva Betalas av patienten/brukaren. KOMMUNIKATION OCH INFORMATION 03 Synhjälpmedel 0303 Ljusfilter (absorbtionsfilter) 1(6) 0306 Glasögon och kontaktlinser Se riktlinje Glasögon och kontaktlinser (bidragsregler) 0309 Glas, linser och linssystem

Läs mer

Monterings råd till ditt nya Larm Dokumentet hjälper dig att göra en bra montering med högsta säkerhet.

Monterings råd till ditt nya Larm Dokumentet hjälper dig att göra en bra montering med högsta säkerhet. Monterings råd till ditt nya Larm Dokumentet hjälper dig att göra en bra montering med högsta säkerhet. Dessutom får du ytterligare givande tips i slutet av dokumentet. Vill du ha rådgivning kontakta Bostadslarmet

Läs mer

Det trygga valet Hemtjänst centrum

Det trygga valet Hemtjänst centrum Det trygga valet Hemtjänst centrum Enköpings kommun Välkommen till hemtjänst centrum! Tack för att du har valt att få din hemtjänst utförd av oss. Inom kommunen har vi lång erfarenhet av hemtjänst, och

Läs mer

Medelpunkten. en social mötesplats för seniorer och frivilliga. Humlorna från Veberöd underhåller den 12 maj kl.14.00 Maj 2014

Medelpunkten. en social mötesplats för seniorer och frivilliga. Humlorna från Veberöd underhåller den 12 maj kl.14.00 Maj 2014 1 Medelpunkten en social mötesplats för seniorer och frivilliga Humlorna från Veberöd underhåller den 12 maj kl.14.00 Maj 2014 1 Foto Taina Ahola ANSLAGSTAVLAN Ört och Kryddcafé Kom på vårt första Ört

Läs mer

Socialförvaltningens grundsyn

Socialförvaltningens grundsyn Trygghetsboende Trygghetsboende Trygghetsboende erbjuder boende för dig med omfattande behov av vård, omsorg, stöd, service och en trygghetsskapande vardags miljö. Syftet är att kombinera ett självständigt

Läs mer

K Hur ser de t ut för dig?

K Hur ser de t ut för dig? Behandlingsguide K Hur ser de t ut för dig? arbetsbl ad (Kryssa för det som stämmer för dig) 1. Är du stressad eller orolig? Jag kan inte tänka klart ( Jag glömmer saker ( Jag har svårt att fokusera (

Läs mer

Aktiviteter i Eslövs kommun Vår och sommar 2008

Aktiviteter i Eslövs kommun Vår och sommar 2008 Aktiviteter i Eslövs kommun Vår och sommar 2008 AKTIVITETSHUSET KARIDAL Karidal är en mötesplats för kommunens alla pensionärer där alla är lika välkomna! På Karidal finns det möjlighet för dig att träffas

Läs mer

Hela ben hela livet om hur du undviker fallolyckor i hemmet

Hela ben hela livet om hur du undviker fallolyckor i hemmet Hela ben hela livet om hur du undviker fallolyckor i hemmet Partille kommun, folkhälsorådet och vård- och omsorgsförvaltningen i samarbete med Västra Götalandsregionen. Håll dig på benen Personer i dagens

Läs mer

Så här fyller du i Genomförandeplanen ÄBIC

Så här fyller du i Genomförandeplanen ÄBIC INSTRUKTION Sid: 1 (7) Målgrupp Gällande utgåva nr. Datum Utförarenheten 3 2015-04-27 Förvaltare Ersätter utgåva nr. Datum Områdeschef område 3 (arbetsgrupp social dokumentation) 2 2014-12-02 Beslutande

Läs mer

Information av arbetsterapeut och sjukgymnast till dig som ska få en ny höftled

Information av arbetsterapeut och sjukgymnast till dig som ska få en ny höftled Sjukgymnast & arbetsterapeut tjänstgörande vid Ortopedklinken NLL Ansvarig för uppdatering; Kristina Larsson, Birgitta Frohm Godkänd av Anders Sundelin/Verksamhetschef Ortopedi Uppdaterad 2007-06-20 Information

Läs mer

Få ut mer av dina hörapparater. Phonaks trådlösa tillbehör

Få ut mer av dina hörapparater. Phonaks trådlösa tillbehör Få ut mer av dina hörapparater Phonaks trådlösa tillbehör Phonaks hörapparater är högfunktionella lösningar med syfte att återansluta människor till ljudvärlden. Även om ny teknik gör det möjligt att

Läs mer

Socialförvaltningens grundsyn

Socialförvaltningens grundsyn Björktrasten Björktrasten Björktrastens vårdboende erbjuder boende för dig med omfattande behov av vård, omsorg, stöd och service. Vi arbetar utifrån kontaktmannaskap. Det innebär att din kontaktman har

Läs mer

Ny digital teknik införs för invånare som har trygghetslarm för att ge ökad trygghet, säkerhet och kvalité

Ny digital teknik införs för invånare som har trygghetslarm för att ge ökad trygghet, säkerhet och kvalité Ny digital teknik införs för invånare som har trygghetslarm för att ge ökad trygghet, säkerhet och kvalité Under hösten kommer alla befintliga trygghetslarm att bytas ut. De som har trygghetslarm kommer

Läs mer

Nationella inspirationsmiljön

Nationella inspirationsmiljön Nationella inspirationsmiljön Välkommen till vår nationella inspirationsmiljö! Hjälpmedelsinstitutet och Micasa Fastig heter driver gemensamt en nationell inspirationsmiljö med bostäder för personer med

Läs mer

Innehåll 1. Om ScandLarm Air... 3 2. Ladda ner App... 3 3. Starta kontrollpanel... 4 4. Konfigurera App till kontrollpanelen... 5 5.

Innehåll 1. Om ScandLarm Air... 3 2. Ladda ner App... 3 3. Starta kontrollpanel... 4 4. Konfigurera App till kontrollpanelen... 5 5. ScandLarm Air Innehåll 1. Om ScandLarm Air... 3 2. Ladda ner App... 3 3. Starta kontrollpanel... 4 4. Konfigurera App till kontrollpanelen... 5 5. Koda enheter till kontrollpanelen... 7 5.1 Radera enhet...

Läs mer

Resledaren Användarguide Android Innehåll

Resledaren Användarguide Android Innehåll Resledaren Användarguide Android Innehåll Planera Ny Resa... 3 Visa Mina Resor... 13 Ta bort sparad resa... 14 Ändra planerad resa... 15 Påminnelser... 16 Under Resan... 17 Inaktivera Pågående Resa...

Läs mer

Vi vill att människor ska leva hela livet

Vi vill att människor ska leva hela livet Vi vill att människor ska leva hela livet Daljunkaregårdens äldreboende drivs sedan maj 2008 av Temabo. Vårt mål är att skapa ett aktivare boende för äldre med inriktning musik. Vi inför en salutogen äldreomsorg

Läs mer

Hälsorobotar. Robotar som hjälper och vårdar

Hälsorobotar. Robotar som hjälper och vårdar Hälsorobotar Robotar som hjälper och vårdar Hälsorobotar behövs för att bygga framtiden Hälsorobotar kan hjälpa personer med funktionsnedsättning och äldre till ett mer självständigt och oberoende liv.

Läs mer

Manual. - bredbandsskåpet i ditt digitala hem

Manual. - bredbandsskåpet i ditt digitala hem Manual - bredbandsskåpet i ditt digitala hem KOM IGÅNG MED ALLA TJÄNSTER I din digitala lägenhet finns ett skåp med kopplingar till lägenhetens bredbandsuttag. Det är här fibern ifrån Botkyrka Stadsnät

Läs mer

Trygghetslarmen installeras av personal från vård och äldreomsorgens larmgrupp. De ger dig råd om vilken lösning som fungerar hos dig.

Trygghetslarmen installeras av personal från vård och äldreomsorgens larmgrupp. De ger dig råd om vilken lösning som fungerar hos dig. Trygghetslarm Allmänt Efter beslut från biståndshandläggare kan du hyra ett trygghetslarm av Alingsås kommun. Larmet är personligt och ska användas av dig i din bostad. Du ska använda trygghetslarmet vid

Läs mer

Handhavande AV-tekniska hjälpmedel - Fullt utrustad sal

Handhavande AV-tekniska hjälpmedel - Fullt utrustad sal 108-01-21 sid 1 Handhavande AV-tekniska hjälpmedel - Fullt utrustad sal Denna handledning är avsedd för nedan listade lärosalar där av-tekniken styrs med en knappsats (se bild) och där en stationär dator

Läs mer

Vad är ett gott liv var dag?

Vad är ett gott liv var dag? Vad är ett gott liv var dag? Anteckningar från dialogcafé om framtidens omsorg. Tema: äldreomsorg. 2014-12-02 Skogslid, Gamla kyrkvägen 6, Fristad Närvarande Politiker: Malin Carlsson (S) ordförande Stadsdelsnämnden

Läs mer

Äldreomsorgen - För dig med demenssjukdom

Äldreomsorgen - För dig med demenssjukdom Äldreomsorgen - För dig med demenssjukdom Socialförvaltningen Äldreomsorgen Våra lokala värdighetsgarantier Delaktighet och inflytande Klippans Kommuns Äldreomsorg garanterar dig regelbundna samtal med

Läs mer

KNX En kunskap, många möjligheter

KNX En kunskap, många möjligheter KNX En kunskap, många möjligheter Page No. 1 Buss Ett kollektivt medium här börjar allmän väg Page No. 2 Vi förser dig med KNX i Sverige Page No. 3 Tack för att ni lyssnade Rikard Nilsson Ordförande KNX

Läs mer

Välkommen till Persgården särskilt boende

Välkommen till Persgården särskilt boende Välkommen till Persgården särskilt boende Rev sep -15 Persgården är ett särskilt boende med 32 lägenheter. På Persgården arbetar vi efter målsättningen att skapa en lugn, trygg och förtroendefull hemmiljö.

Läs mer

Information för dig som ska sälja en lägenhet i BRF Väduren

Information för dig som ska sälja en lägenhet i BRF Väduren Information för dig som ska sälja en lägenhet i BRF Väduren Föreningen förvaltas av AdEx Fastighetsutveckling. Förvaltare: Daniel Boding Fastighetsadministratör: Cassandra Gustafsson Ekonomi: Lisa Welin

Läs mer

Om du får ett negativt beslut kan du överklaga. För mer information, ring mottagningsgruppen på 011-15 27 37.

Om du får ett negativt beslut kan du överklaga. För mer information, ring mottagningsgruppen på 011-15 27 37. Hemtjänst i Norrköping Det är vård- och omsorgsnämnden som har ansvar för kommunens äldre- och handikappomsorg. Vård- och omsorgsnämnden erbjuder stöd, omsorg och omvårdnad i livets olika skeden. I vård-

Läs mer

Svårt att minnas, Demens... Har du en demenssjukdom? Eller är orolig för att ha drabbats?

Svårt att minnas, Demens... Har du en demenssjukdom? Eller är orolig för att ha drabbats? Svårt att minnas, Demens... Har du en demenssjukdom? Eller är orolig för att ha drabbats? Vad är demens? Demens är ett samlingsnamn på olika demenssjukdomar som kan drabba människor i olika åldrar. Sjukdomen

Läs mer

Installationsmanual. Installera systemet: För att installera systemet korrekt så krävs följande: Steg 1.1- Förbered systemet.

Installationsmanual. Installera systemet: För att installera systemet korrekt så krävs följande: Steg 1.1- Förbered systemet. S i d a 1 Installationsmanual Alla delar i paketet är förprogramerade för centralenheten som följer med. För att koppla ihop fler delar (larmdosor/rörelsedetektorer) se avsnittet Koppla in tillbehör. För

Läs mer

BYT UTTAG! Klart huset ska ha fiber INFORMATION OM UTBYGGNADEN AV FIBERNÄTET I DITT OMRÅDE

BYT UTTAG! Klart huset ska ha fiber INFORMATION OM UTBYGGNADEN AV FIBERNÄTET I DITT OMRÅDE BYT UTTAG! Klart huset ska ha fiber INFORMATION OM UTBYGGNADEN AV FIBERNÄTET I DITT OMRÅDE Äntligen fiber tv, internet och telefoni med ljusets hastighet Botkyrka Stadsnät är snabbt med närmast obegränsad

Läs mer

Handhavande. inbrottslarmsystem VR8

Handhavande. inbrottslarmsystem VR8 Handhavande inbrottslarmsystem VR8 Din installatör Vid frågor eller service kontakta din installatör: Företag: Telefon: Fax: E-mail: Kontaktperson: Övrigt: Larmet är anslutet till: Larmcentral: Telefon:

Läs mer

Stöd och omsorg för äldre. Information om vilket stöd som finns till dig som är äldre

Stöd och omsorg för äldre. Information om vilket stöd som finns till dig som är äldre Stöd och omsorg för äldre Information om vilket stöd som finns till dig som är äldre 2 Denna broschyr är uppdaterad 29 september 2014. Du kan också lyssna på informationen som finns på Umeå kommuns webbplats.

Läs mer

Socialförvaltningens grundsyn

Socialförvaltningens grundsyn Strömsborg Strömsborg Strömsborgs vårdboende erbjuder boende för dig med omfattande behov av vård, omsorg, stöd och service. Vi arbetar utifrån kontaktmannaskap. Det innebär att din kontaktman har ett

Läs mer

Socialförvaltningens grundsyn

Socialförvaltningens grundsyn Strandvägen Strandvägen Vårdboende Strandvägen erbjuder tillfälligt boende för dig med omfattande behov av vård, omsorg, stöd och service. Vi arbetar utifrån kontaktmannaskap. Det innebär att din kontaktman

Läs mer

Vad händer när man börjar se dåligt?

Vad händer när man börjar se dåligt? Vad händer när man börjar se dåligt? Välkommen till Syncentralen För att komma till Syncentralen måste du ha remiss från ögonläkare. På Syncentralen finns optiker, synpedagoger, datapedagog, kurator, psykolog,

Läs mer

Välkommen till Fyrklövern Ett boende för korttidsvård och platser i särskilt boende

Välkommen till Fyrklövern Ett boende för korttidsvård och platser i särskilt boende Välkommen till Fyrklövern Ett boende för korttidsvård och platser i särskilt boende Toftaängen Detta är Fyrklövern! På Fyrklövern finns 16 platser avsedda för korttidsvård såsom rehabilitering, växelvård

Läs mer

KUPP Äldrevård och omsorg K U P P Kvalitet Ur Patientens Perspektiv 2007 ImproveIT AB & Bodil Wilde Larsson

KUPP Äldrevård och omsorg K U P P Kvalitet Ur Patientens Perspektiv 2007 ImproveIT AB & Bodil Wilde Larsson Denna enkät är ett referensexemplar. För mer information - se enkätens sista sida KUPP Äldrevård och omsorg K U P P Kvalitet Ur Patientens Perspektiv 2007 ImproveIT AB & Bodil Wilde Larsson 1. Ålder 2.

Läs mer