,QQHKnOO. 7HOHIRQ 6DPWDO 6DPWDOVORJJ,QVWlOOQLQJDU ,QOHGQLQJ 'LQ(UL VVRQ5V 'RNXPHQWDWLRQ,QIRUPDWLRQR K &RPPXQL DWLRQV6XLWH G

Storlek: px
Starta visningen från sidan:

Download ",QQHKnOO. 7HOHIRQ 6DPWDO 6DPWDOVORJJ,QVWlOOQLQJDU ,QOHGQLQJ 'LQ(UL VVRQ5V 'RNXPHQWDWLRQ,QIRUPDWLRQR K &RPPXQL DWLRQV6XLWH G"

Transkript

1 ,QQHKnOO,QOHGQLQJ 'LQ(UL VVRQ5V 'RNXPHQWDWLRQ,QIRUPDWLRQR K &RPPXQL DWLRQV6XLWH G.RPPDLJnQJ &KH NOLVWD )XQNWLRQVOlJHQ %DWWHULHW 6,0NRUWHW 6OnDYSn 6WlQJGOX ND gsshqox ND 6lNHUKHW 6WlQJGOX ND 7HOHIRQNQDSSDU.QDSSVDWVHQVIXQNWLRQHU,QGLNDWRUHULWH NHQI QVWUHW +LWWDLPHQ\V\VWHPHW 5LQJDR KWDHPRWVDPWDO 7HOHIRQPHQ\.DOHQGHU,QNRUJ 7HOHIRQERNHQ /DUP 9DUQLQJ $QYLVQLQJDUI U SSHQ OX ND 6NULYERUGHW 0HQ\NRQWUROO 6NULYDLQLQIRUPDWLRQ 9DUQLQJ 7HOHIRQ 6DPWDO 6DPWDOVORJJ,QVWlOOQLQJDU.RQWDNWHU 3HUVRQXSSJLIWHU,QQHKnOOVI UWH NQLQJ 1\NRQWDNW 6 N 0HGGHODQGHQ,QNRUJ 1\WWHEUHY 1\WW606 6 N *HQHUHUDO VHQRUG.DOHQGHU 0nQDGVY\ 9H NRY\ 'DJVY\ $WWJ UD 1\WWP WH :$3WMlQVWHU :$3 %RNPlUNHQ *nwloodguhvv +LVWRULN 6lNUDZHEESODWVHU

2 .RPPDLJnQJPHG HSRVWR K:$3,QVWlOOQLQJDYHSRVW $XWRPDWLVNLQVWlOOQLQJDY IMlUUDQVOXWQLQJR KHSRVW 0DQXHOOLQVWlOOQLQJDY IMlUUDQVOXWQLQJR KHSRVW 6WlOODLQHQWMlQVWHRSHUDW U PDQXHOOW 6WlOODLQHSRVWNRQWRPDQXHOOW 6NL NDHSRVWI UI UVWDJnQJHQ $QYlQGDHSRVWPHGIOHUD NRQILJXUDWLRQHULQVWDOOHUDGH 6WlOODLQ:$3WMlQVWHU :$3SURILOHU $XWRPDWLVNLQVWlOOQLQJDY:$3 0DQXHOOLQVWlOOQLQJDY:$3 6nKlUDQYlQGHUGX:$3 I UI UVWDJnQJHQ $QYlQGD:$3PHGIOHUD NRQILJXUDWLRQHULQVWDOOHUDGH +LWWDLQVWlOOQLQJDUL :LQGRZVHOOHU &HUWLILNDW )OHUSURJUDP $QWH NQLQJDU.OR ND 5lNQDUH 6SHO 6\VWHP 5&RPPXQL DWLRQV 6XLWH $QVOXWD5VWLOOGDWRUQ 6\QNURQLVHUD5V 6lNHUKHWVNRSLHUD5V cwhuvwlood5v %\WDVSUnNL5V +MlOS )HOV NQLQJ 9LNWLJLQIRUPDWLRQ 6lNHUR KHIIHNWLYDQYlQGQLQJ 7HNQLVNDGDWD %HJUlQVDGJDUDQWL 8SSKRYVUlWW /L HQVDYWDO 1RUPHU ) UVlNUDQRP YHUHQVVWlPPHOVH 6DNUHJLVWHU

3 Ericsson R380s Användarhandbok Andra utgåvan (april 2001) Denna handbok utges av Ericsson Mobile Communications AB utan vidare ansvarsförbindelse. Förbättringar och ändringar i denna handbok på grund av typografiska fel, ofullständig information eller förbättringar av program och/eller utrustning, må utföras av Ericsson Mobile Communications AB när som helst och utan meddelande. Dessa ändringar kommer emellertid att införas i nya utgåvor av denna handbok. Alla rättigheter förbehållna. Ericsson Mobile Communications AB, 2001 Publikationsnummer: Användarhandbok (tryckt) SV/LZT R2A Användarhandbok (PDF) SV/LZT R2A INNOVATRON PATENTS Observera! Vissa tjänster som beskrivs i den här handboken stöds inte av alla nät. Detta gäller även det internationella nödsamtalsnumret 112. Kontakta din nätoperatör om du är osäker på om du kan använda en viss tjänst eller inte. EG-standarder -symbolen på våra produkter betyder att de är certifierade enligt EMC-direktivet 89/336/EEC, direktivet om telekommunikation 91/263/EEC och direktivet om lågspänning 73/23/EEC när så är tillämpligt. Produkten uppfyller kraven enligt följande standarder: Mobiltelefoner och tillbehör tillsammans: ETS EMC for European digital cellular telecommunications. Tillbehör utan direkt anslutning till mobiltelefonen: EN Elektromagnetisk kompatibilitet Emission, generella fordringar, och EN Elektromagnetisk kompatibilitet Immunitet, generella fordringar. 3

4

5 ,QOHGQLQJ 'LQ(UL VVRQ5V 7D NI UDWWGXN SW(UL VVRQV6PDUWSKRQH5VGHQVHQDVWH PRELOWHOHIRQHQPHGLQE\JJGSHUVRQOLJGLJLWDODJHQGD'HWlUHQ DYDQ HUDGPHQOlWWKDQWHUOLJSURGXNWPHGPnQJDIXQNWLRQHUVRPJ U YDUGDJVOLYHWP\ NHWHQNODUH 'LQ5VJHUGLJIULKHWDWWNRPPXQL HUD±YDUKHOVWGXlUR KQlUKHOVW GXYLOO) UXWRPDWW5VKDUHQPlQJGPRELOWHOHIRQIXQNWLRQHUNDQ GXDQYlQGDGHQI UDWWVNL NDR KWDHPRWHSRVWR K606 PHGGHODQGHQJ UDV NQLQJDUSn,QWHUQHWYLDHQ:$3ZHEEOlVDUHR K P\ NHWP\ NHWPHU 'HQDYDQ HUDGHSURJUDPYDUDQL5VlUE UMDQSnHQKHOWQ\HUD LQRPPRELONRPPXQLNDWLRQ9lONRPPHQWLOOYnUWUnGO VDYlUOG 'RNXPHQWDWLRQ 'RNXPHQWDWLRQHQlUXWIRUPDGI UDWWGXVNDNXQQDXWQ\WWMDWHOHIRQHQV NDSD LWHWWLOOIXOOR'HQJHUGLJEnGHVQDEEUHIHUHQVHUR KHQPHU GHWDOMHUDGEHVNULYQLQJDYWHOHIRQHQVPnQJDIXQNWLRQHU %HVNULYQLQJHQI OMHUGHWYnYLNWLJDVWHIXQNWLRQHUQDVWlQJGR K SSHQ OX ND 7HUPHQWHOHIRQVWnUI UPRELOWHOHIRQ 6QDEEUHIHUHQV 6QDEEUHIHUHQVHQJHUGLJNRUWIDWWDGHLQVWUXNWLRQHURPKXUGXDQYlQGHU GLQ5V $QYlQGDUKDQGERN,DQYlQGDUKDQGERNHQILQQVHQRPIDWWDQGHEHVNULYQLQJDYDOODIXQNWLRQHU LGLQ5V 2EVHUYHUD,QIRUPDWLRQHQLDQYlQGDUKDQGERNHQlUGHQVDPPDVRP L UHIHUHQVKDQGERNHQSnGHQPHGI OMDQGH GVNLYDQ,QOHGQLQJ

6 ,QIRUPDWLRQR K&RPPXQL DWLRQV6XLWH G 6lWWLQ GVNLYDQLGDWRUQV GURPHQKHW+XYXGPHQ\QYLVDV DXWRPDWLVNW )UnQKXYXGPHQ\QNDQGXVWDUWDI OMDQGH (QPXOWLPHGLDSUHVHQWDWLRQ3URGXNWLQIRUPDWLRQI UWHOHIRQHQ VRPEHVNULYHUWHOHIRQHQVIXQNWLRQHUSnVNlUPHQ,QVWDOODWLRQHQDY(UL VVRQV5&RPPXQL DWLRQ6XLWHI U V\QNURQLVHULQJVlNHUKHWVNRSLHULQJR KnWHUVWlOOQLQJDYGDWD 2EVHUYHUD6H 5&RPPXQL DWLRQV6XLWH SnVLG HOOHU GVNLYDQVIRGUDOI UPHULQIRUPDWLRQRP GOlVDUHQLQWHYLVDVQlU GVNLYDQVlWWVL GURPHQKHWHQ 6SUnNE\WHL5VYLGV\QNURQLVHULQJHQ $QYlQGDUKDQGERN5VVRPlUHWWHOHNWURQLVNWGRNXPHQW PHGHQRPIDWWDQGHEHVNULYQLQJLSGIIRUPDWDYDOODIXQNWLRQHUL WHOHIRQHQ 2EVHUYHUD$GREH$ UREDW5HDGHU PnVWHLQVWDOOHUDVSnGDWRUQ I UDWWGXVNDNXQQDOlVDDQYlQGDUKDQGERNHQWLOOWHOHIRQHQ,QVWDOODWLRQHQDY$GREH$ UREDW 2EVHUYHUD,QIRUPDWLRQHQLUHIHUHQVKDQGERNHQSn GVNLYDQlU H[DNWGHQVDPPDVRPLDQYlQGDUKDQGERNHQ'HKDUROLNDQDPQVnDWW UHVSHNWLYHGRNXPHQWOlWWNDQNlQQDVLJHQ,QVWDOODWLRQHQDY/RWXV2UJDQL]HU 0HULQIRUPDWLRQILQVVLDYVQLWWHW &KH NOLVWD SnVLGDQ,QOHGQLQJ

7 .RPPDLJnQJ &KH NOLVWD.RQWUROOHUDDWWI OMDQGHILQQVLI USD NQLQJHQQlUGX SSQDUGHQ 5VHQKHW 5VEDWWHULR KSHNGRQWLOOSHNVNlUP /DGGDUHPHGQlWNRQWDNWR KWHOHIRQNDEHO $QYlQGDUKDQGE NHU 6QDEEUHIHUHQVHU &GURP(UL VVRQV0RELOH&RPPXQL DWLRQVDQG,QIRUPDWLRQ 6XLWHVRPLQQHKnOOHUHQPXOWLPHGLDSUHVHQWDWLRQ&RPPXQL DWLRQV 6XLWHSURJUDPYDUDR KHQUHIHUHQVKDQGERNLSGIIRUPDW (Q56NDEHOI UDWWDQVOXWD5VWLOOGDWRUQ %RUGVVW G H[WUDSHNGRQ,QIRUPDWLRQRPEDWWHULHW,QIRUPDWLRQRP(UL VVRQVVHUYL HR KVXSSRUW,QIRUPDWLRQRPWLOOEHK UHQ 2PGXLQWHWlQNHUOlVDLJHQRPDQYlQGDUKDQGERNHQHOOHU UHIHUHQVKDQGERNHQLQQDQGXE UMDUE UGXWDQnJUDPLQXWHUR KWLWWD LJHQRPVQDEEUHIHUHQVHQ'lUInUGXNRUWIDWWDGHLQVWUXNWLRQHURPKXU GXNRPPHULJnQJ )XQNWLRQVOlJHQ 'HWYnYLNWLJDVWHIXQNWLRQVOlJHQDlUVWlQJGR K SSHQOX ND )XQNWLRQHUQDlUWLOOJlQJOLJDPHGOX NDQ SSHQHOOHUVWlQJG9LVVD IXQNWLRQHUNDQVWDUWDVPHGOX NDQVWlQJGR KYLGEHKRYNRPSOHWWHUDV PHG SSHQOX NDGnPHUDYDQ HUDGHLQVWlOOQLQJDUlUP MOLJD byhqrpkdqgernhqehvnulyhuengdoljhqlghwdome UGXKDLnWDQNH DWWPnQJDDYIXQNWLRQHUQDVRPEHVNULYVPnVWHILQQDVWLOOJlQJOLJDKRV GLQQlWRSHUDW UR K,QWHUQHWOHYHUDQW UI UDWWGXVNDNXQQDDQYlQGD GHP7DNRQWDNWPHGGLQQlWRSHUDW UR K,QWHUQHWOHYHUDQW UI UPHU LQIRUPDWLRQ.RPPDLJnQJ

8 )XQNWLRQVOlJHQDlUI OMDQGH 6WlQJGOX ND 6WDWXVLQGLNDWRU 9RO\PNQDSS 5 VWDQWH NQLQJVNQDSS NÄTVERK :00 3nDYNQDSS gsshqox ND 3URJUDPIOLN 1DPQOLVW 3URJUDPLNRQHU %DWWHULHW %DWWHULHWVRPPHGI OMHUWHOHIRQHQNDQVNHLQWHlUKHOWXSSODGGDW'HW UHNRPPHQGHUDVDWWGXODGGDUEDWWHULHWLXSSWLOOWUH WLPPDULQQDQGX DQYlQGHUWHOHIRQHQI UVWDJnQJHQ ) UVWDJnQJHQGXODGGDUHWWQ\WWHOOHUKHOWXUODGGDWEDWWHULNDQGHWWD QnJUDPLQXWHULQQDQGXNDQVHDWWEDWWHULHWODGGDVLQGLNHULQJVODPSDQ OlQJVWXSSSnWHOHIRQHQO\VHULQWHR KEDWWHULPlWDUHQV\QVLQWHL WH NHQI QVWUHW%nGHLQGLNHULQJVODPSDQR KEDWWHULPlWDUHQDNWLYHUDV GR NHIWHUHWWOLWHWWDJ 2EVHUYHUD'XNDQLQWHVOnSnWHOHIRQHQLQQDQLQGLNDWRUQWlQGVR K EDWWHULPlWDUHQYLVDVLWH NHQI QVWUHW (WWEDWWHULVRPLQWHDQYlQWVXQGHUHQOlQJUHWLGPnVWHODGGDVXUKHOW R KVHGDQODGGDVXSSLJHQ± JnQJHUI UDWWXSSQnIXOONDSD LWHW 2PGXEHK YHUODGGDXUEDWWHULHWDQYlQGHUGXWHOHIRQHQVRPYDQOLJW WLOOVEDWWHULHWEOLUXUODGGDW.RPPDLJnQJ

9 1lUVNDEDWWHULHWODGGDV" 1lUEDWWHULHWPnVWHODGGDVK UVHQOMXGVLJQDOR KLQGLNHULQJVODPSDQ XSSWLOOSnWHOHIRQHQEOLQNDUU WW(WWPHGGHODQGHRPDWWEDWWHULQLYnQ luonjylvdvlwh NHQI QVWUHW'XNDQODGGDEDWWHULHWQlUGXYLOOXWDQDWW GHWSnYHUNDUWHOHIRQHQVSUHVWDQGD 2EVHUYHUD7HOHIRQHQVWlQJVDYDXWRPDWLVNWQlUEDWWHULHWlUI U VYDJW /DGGQLQJ /DGGDEDWWHULHWPHGKMlOSDYODGGDUHQVRPPHGI OMHU'XNDQDQYlQGD GLJDYODGGDUHIUnQDQGUD(UL VVRQWHOHIRQHUVRPKDUVDPPDDQVOXWQLQJV NRQWDNWWH[7HOOHU5V 9DUQLQJ8QGYLNGLUHNWVRO0\ NHWK JDWHPSHUDWXUHUUHGX HUDU EDWWHULHWVNDSD LWHWSHUPDQHQW8QGYLNDWWODGGDXSSHWWIXOODGGDW HOOHUQlVWDQIXOODGGDWEDWWHUL %RUWWDJQLQJR KLQVlWWQLQJDYEDWWHUL 6nKlUWDUGXERUWEDWWHULHW 6HWLOODWWOX NDQlUVWlQJG 6HWLOODWWWHOHIRQHQlUDYVWlQJG 9DUQLQJ'HWlUYLNWLJWDWWGXDOOWLGVWlQJHUDYWHOHIRQHQLQQDQGXWDU XWEDWWHULHW2PGXLQWHJ UGHWNDQLQIRUPDWLRQJnI UORUDG 7U\ NSnIULJ ULQJVVSlUUHQOlQJVWXSSSnEDWWHULHWR KWDORVVGHW IUnQWHOHIRQHQ 6nKlUVlWWHUGXLEDWWHULHW 6HWLOODWWOX NDQlUVWlQJG 3OD HUDI UVWQHGHUGHOHQDYEDWWHULHWSnWHOHIRQHQR KWU\ NVHGDQ Sn YHUGHOHQWLOOVHWWNOL NOMXGK UV.RPPDLJnQJ

10 6nKlUDQYlQGHUGXEDWWHULODGGDUHQ 6HWLOODWWEDWWHULHWVLWWHUIDVWSnWHOHIRQHQ $QVOXWODGGDUHQWLOOWHOHIRQHQSnI OMDQGHVlWW %OL[WV\PEROHQ SnNRQWDNWHQPnVWHYDUDYlQGXSSnW 'XKLWWDUEOL[WV\PEROHQYLGWHOHIRQHQVXWWDJ /XWDNRQWDNWHQHQDQLQJQHGnWQlUGXDQVOXWHUGHQWLOOXWWDJHW ) UNRQWDNWHQQHGnWR KVHWLOODWWGHQVLWWHURUGHQWOLJWIDVWL XWWDJHW $QVOXWODGGDUHQWLOOHWWQlWXWWDJ 6nKlUWDUGXERUWNRQWDNWHQ 9ULGNRQWDNWHQXSSnWR KGUDXWGHQIUnQWHOHIRQHQVXWWDJ 9DUQLQJ.RQWDNWHQWLOOQlWXWWDJHWNDQVHROLNDXWEHURHQGHSn YlJJXWWDJHQLGLWWODQG$QVOXWLQWHGHQPHGI OMDQGHQlWNRQWDNWHQWLOO QnJRWDQQDWlQGLQ(UL VVRQ7UDYHO&KDUJHU&75$YOlJVQDGHQ LQWHIUnQODGGDUHQGnGHQVLWWHULYlJJXWWDJHW /DGGQLQJLQGLNHUDVDYI OMDQGH EDWWHULLQGLNDWRUQLWH NHQI QVWUHWSXOVHUDURDYEUXWHW LQGLNHULQJVODPSDQOlQJVWXSSSnWHOHIRQHQO\VHUPHGHWWIDVWU WW VNHQHOOHUPHGHWWJU QWRPWHOHIRQHQlUSnVODJHQ 2EVHUYHUD$YVlNHUKHWVVNlOODGGDVDQGUDEDWWHULHUlQ(UL VVRQV OnQJVDPW 2EVHUYHUD2PGXODGGDUHWWXUODGGDWEDWWHULHOOHUHWWEDWWHULVRP LQWHKDUDQYlQWVSnOlQJHNDQGHWGU MDHQVWXQGLQQDQGXNDQVHL WH NHQI QVWUHWDWWODGGQLQJHQKDUSnE UMDWV.RPPDLJnQJ

11 1lUEDWWHULHWlUIXOODGGDWYLVDVDOODVWUH NHQLEDWWHULLQGLNDWRUQR K LQGLNHULQJVODPSDQO\VHUJU QW 7LSV7HOHIRQHQNDQDQYlQGDVVRPYDQOLJWXQGHUODGGQLQJ /DGGQLQJHQWDUGR NOlQJUHWLGGn 9DUQLQJ.RQWDNWHQWLOOQlWXWWDJHWVRPPHGI OMHUODGGDUHQNDQVH ROLNDXWEHURHQGHSnYlJJXWWDJHQLGLWWODQG$QYlQGHQGDVW VWL NNRQWDNWHQVRPPHGI OMHU(UL VVRQODGGDUHQ 2EVHUYHUD0HULQIRUPDWLRQILQQVLDYVQLWWHW 9,.7,*,1)250$7,2120%$77(5,(5 SnVLGDQ 6,0NRUWHW 1lUGXWH NQDUDERQQHPDQJPHGHQQlWRSHUDW UInUGXHWW6,0NRUW PHGHQSHUVRQOLJ,'QXPPHUHQVN3,1NRG6,0NRUWHWVRP LQQHKnOOHUSHUVRQOLJDGDWDRPGLWWDERQQHPDQJVlWWHUGXLQLWHOHIRQHQ 6,0NRUWKnOODUHQVLWWHUXQGHUEDWWHULHW 6nKlUVlWWHUGXL6,0NRUWHW 6HWLOODWWWHOHIRQHQlUDYVWlQJGR KDWWOX NDQlUVWlQJG 7DERUWEDWWHULHW 6NMXWLQ6,0NRUWHWL6,0NRUWKnOODUHQ SIM SIM 6lWWWLOOEDNDEDWWHULHW 2EVHUYHUD2PGXUHGDQKDUHWW6,0NRUWVRPLQQHKnOOHU WHOHIRQQXPPHUNDQGXLPSRUWHUDGHPWLOOGLQ5V0HUILQQVL DYVQLWWHW,PSRUWDYWHOHIRQERNIUnQ6,0NRUWHW SnVLGDQ 6nKlUWDUGXERUW6,0NRUWHW 9DUQLQJ.RSSODDOOWLGERUWODGGDUHR KDQGUDWLOOEHK UIUnQ WHOHIRQHQLQQDQGXVlWWHULHOOHUWDUERUW6,0NRUWHW 6HWLOODWWWHOHIRQHQlUDYVWlQJGR KDWWOX NDQlUVWlQJG 7DERUWEDWWHULHW 'UDXW6,0NRUWHWIUnQ6,0NRUWKnOODUHQ.RPPDLJnQJ

12 6OnDYSn 12NQDSSHQSnNQDSSVDWVHQVOnUSnDYWHOHIRQHQ 7LSV8WWU\ NHW WU\ NSnNQDSSHQR KKnOOGHQLQWU\ NW LQQHElUDWW NQDSSHQVNDKnOODVLQWU\ NW D VHNXQGHU 6nKlUVOnUGXSnWHOHIRQHQ 6HWLOODWW6,0NRUWHWlULVDWWDWWEDWWHULHWlUODGGDWR KDWWOX NDQ luvwlqjg 7U\ NSnNQDSSHQ R KKnOOGHQLQWU\ NWWLOOVGXK UHQ VLJQDOR KWH NHQI QVWUHWWlQGV 6nKlUVOnUGXDYWHOHIRQHQ 1lUWHOHIRQHQlULYlQWHOlJHWU\ NSn R KKnOOGHQLQWU\ NW WLOOVGXK UHQVLJQDO $QJH3,1NRG 9LVVD6,0NRUWVN\GGDVPHGHQ3,1NRG 2P$QJH3,1YLVDVLWH NHQI QVWUHWHIWHUDWWGXKDUVODJLWSn WHOHIRQHQ 6NULYLQ3,1NRGHQ2PGXVNULYHULQIHOVLIIUDUDGHUDUGXGHQ JHQRPDWWWU\ NDSn.RGHQYLVDVVRPDVWHULVNHUL WH NHQI QVWUHWVnYLGDLQWHVLIIUDQHOOHUDQJHVI UVWYLONHW EHW\GHUDWWPDQULQJHUHWWODUPQXPPHU 7U\ NSn 1lUHWWQlWYHUNKLWWDWVYLVDVGHVVQDPQLWH NHQI QVWUHW 2EVHUYHUD2PGXDQJHUIHO3,1NRGWUHJnQJHULI OMGVSlUUDV6,0 NRUWHW'XOnVHUXSSNRUWHWPHGGLQ38.NRG0HULQIRUPDWLRQILQQVL DYVQLWWHW 6lNHUKHW SnVLGDQ 2EVHUYHUD2P$QJHNRGYLVDVLWH NHQI QVWUHWQlUWHOHIRQHQlUOnVW DQJHGnGLQWHOHIRQOnVNRG0HULQIRUPDWLRQILQQVLDYVQLWWHW 6lNHUKHW SnVLGDQ 6OnSnWHOHIRQHQI UI UVWDJnQJHQ 1lUGXVOnUSnWHOHIRQHQI UI UVWDJnQJHQRPEHGVGXDWWYlOMDVSUnN 6nKlUYlOMHUGXVSUnN %OlGGUDPHG I UDWWKLWWDR KPDUNHUDGLWWYDO 7U\ NSn I UDWWEHNUlIWDGLWWYDO 6WlQJDYWHOHIRQHQR KVOnSnGHQLJHQI UDWWDNWLYHUDVSUnNHW.RPPDLJnQJ

13 6WlQJGOX ND 0HGVWlQJGOX NDlUYLVVDIXQNWLRQHUDNWLYD1HGDQI OMHUHQNRUW YHUVLNW 9lQWHOlJH 1lUGXKDUVODJLWSnWHOHIRQHQR KDQJHWWGLQ3,1NRGV NHUGHQ HIWHUHWWQlW 1lUWHOHIRQHQInUQlWNRQWDNWK UVWUHNRUWDOMXGVLJQDOHU,QGLNHULQJV ODPSDQXSSWLOOSnWHOHIRQHQEOLQNDUJU QWHQJnQJLVHNXQGHQR K QDPQHWSnQlWRSHUDW UHQYDQOLJWYLVLI UNRUWDGIRUPYLVDVL WH NHQI QVWUHW 2EVHUYHUD6H )HOV NQLQJ SnVLGDQ RPWHOHIRQHQLQWHI UVlWWV LYlQWHOlJH,YlQWHOlJHNDQGXULQJDR KWDHPRWVDPWDODQYlQGDWHOHIRQERNHQ DNWLYHUDLQDNWLYHUDYLVVDLQVWlOOQLQJDUOlVDHSRVW606PHGGHODQGHQ Q\KHWHUQDR KDWWJ UDOLVWRUQD $QGUDOlJHQ 2PLQJHWQlWYLVDVSnVNlUPHQNDQDQOHGQLQJHQYDUDQnJRQDY I OMDQGH (QGDVWQ GVDPWDO 2P(QGDVWQ GVDPWDOYLVDVEHILQQHUGXGLJLQRPHWWQlWVWl NQLQJV RPUnGHPHQGXInULQWHDQYlQGDGHW,HQQ GVLWXDWLRQNDQGXGR N DOOWLGULQJD626DODUPQXPUHWL6WRUEULWDQQLHQR K 1RUGLUODQG'HVVXWRPEOLQNDULQWHGHQU GDLQGLNHULQJVODPSDQ OlQJVWXSSSnWHOHIRQHQ 2EVHUYHUD'HQQDVHUYL HlUQlWEHURHQGH$OODQlWWLOOnWHULQWHDWW GXULQJHUQ GVDPWDO,QJHWQlW 2PPHGGHODQGHW,QJHWQlWYLVDVILQQVGHWDQWLQJHQLQJHWQlWLQRP Ul NKnOOHOOHUVnlUGHQPRWWDJQDVLJQDOHQI UVYDJ'nPnVWHGX I UIO\WWDGLJWLOOVGXInUHQWLOOUl NOLJWVWDUNVLJQDO1lWVW\UNHPlWDUHQL WH NHQI QVWUHWVYlQVWUDK UQlQGUDVWLOOHQVWUH NDGOLQMHRPVLJQDOHQ lui UVYDJ'HVVXWRPEOLQNDULQWHGHQU GDLQGLNHULQJVODPSDQOlQJVW XSSSnWHOHIRQHQ gsshqox ND 1lUGX SSQDUOX NDQYLVDVSURJUDPYDUDQSnVNULYERUGHWLIRUPDY SURJUDPIOLNDULNRQHUR KIXQNWLRQHU3HNDPHGGHWPHGI OMDQGH SHNGRQHWSnVNlUPHQI UDWWYlOMDIXQNWLRQ.RPPDLJnQJ

14 3HNGRQHW 3HNGRQHWVLWWHUSnWHOHIRQHQVEDNVLGDLHQKnOODUHSnEDWWHULHW'UDXW SHNGRQHWI UVLNWLJW1lUGXYLOOVlWWDWLOOEDNDSHNGRQHWWU\ NHUGXLQ GHWLKnOODUHQWLOOVGHWIDOOHUSnSODWV 7DERUWSHNGRQHWIUnQKnOODUHQ 2EVHUYHUD3HNGRQHWDQYlQGVHQGDVWQlUOX NDQlU SSHQ * UGLWWYDOPHGKMlOSDYSHNGRQHW.OL NDOlWWSnVNlUPHQPHGSHNGRQHWI UDWWPDUNHUDGLWWYDO'XNDQ lyhqdqylqgdilqjuduqdi UDWWNOL NDSnVNlUPHQPHQGHWlUElVWDWW DQYlQGDSHNGRQHW'nVOLSSHUGXILQJHUDYWU\ NSnVNlUPHQR KYDOHQ EOLUPHUH[DNWD 9DUQLQJ/nWLQWHEDUQOHNDPHGGLQ5VHIWHUVRPGHNDQVNDGD EnGHVLJVMlOYDR KWHOHIRQHQ.RQWUROOHUDDOOWLGDWWSHNGRQHWVLWWHUL KnOODUHQQlUOX NDQlUVWlQJG 'UDSHNGRQHW 9LVVDDYOLVWRUQDLGLQWHOHIRQWLOOnWHUDWWGXGUDUSHNGRQHWI UDWW PDUNHUDSRVWHU'XNDQWH[UDGHUDPHGGHODQGHQLLQNRUJHQ 2PHQSRVWUHGDQlUPDUNHUDGQlUGXGUDUSHNGRQHW YHUHQHOOHUIOHUD SRVWHUNRPPHUI UHJnHQGHSRVWDWWI UEOLPDUNHUDGR KGHQQ\D SRVWHQSRVWHUQDPDUNHUDVR NVn 2PGXVHGDQGUDUWLOOEDNDSHNGRQHWWLOOUDGHQGlUGXE UMDGHNRPPHU GHPDUNHUDGHUDGHUQDDWWDYPDUNHUDV 'HOLQMHUVRPPDUNHUDGHVYLGHQI UHJnHQGHU UHOVHNRPPHUDWWI UEOL PDUNHUDGH 6NULYERUGHW 1lUGX SSQDUOX NDQYLVDUWHOHIRQHQPRWVYDUDQGHHOOHUQlUPDVW OLJJDQGHIXQNWLRQVRPYDUDNWLYQlUOX NDQYDUVWlQJG2PHQ NRQWDNWLWHOHIRQERNHQYLVDVR KOX NDQ SSQDVNRPPHU NRQWDNWSRVWHQXQGHU.RQWDNWHUDWWYLVDVLWH NHQI QVWUHW.RPPDLJnQJ

15 2EVHUYHUD) UGHIXQNWLRQHUVRPLQWHKDUQnJRQPRWVYDULJKHW PHOODQ SSHQR KVWlQJGOX NDNRPPHUVNULYERUGHWDWWYLVDV 3URJUDPIOLNDU 1DPQOLVW 3URJUDPLNRQHU 6NULYERUGHWNDQGHODVXSSLWUHGHODU 3URJUDPIOLNDUVRPLQQHIDWWDUVH[IXQNWLRQVJUXSSHU'HVLWWHU YHUVWSnVNlUPHQ 3URJUDPLNRQHUVRPVWDUWDUGHROLNDIXQNWLRQHUVRPlU WLOOJlQJOLJDSnYDUMHSURJUDPIOLN'HVLWWHUQHGHUVWSnVNlUPHQ 1DPQOLVWVRPDQJHUYLONHWSURJUDPVRPlUDNWLYW'HQVLWWHU GLUHNWXQGHUSURJUDPIOLNDUQD $QYLVQLQJDU +lui OMHUQnJUDDOOPlQQDDQYLVQLQJDURPKXUGXDUEHWDUPHG SSHQ OX ND 6nKlUYlOMHUGXHQIXQNWLRQ 7DXWSHNGRQHWIUnQKnOODUHQSnEDWWHULHW gssqdox NDQ 9lOM QVNDGSURJUDPIOLNSnVNULYERUGHW.OL NDSn QVNDGSURJUDPLNRQ'HWLOOJlQJOLJDSURJUDPLNRQHUQD VNLIWDUEHURHQGHSnYLONHQSURJUDPIOLNGXKDUYDOW.OL NDSn QVNDGIXQNWLRQR KXWI UXSSJLIWHQ 6NULYERUGVLNRQ.OL NDSnVNULYERUGVLNRQHQ I UDWWnWHUJnWLOOVNULYERUGHW.RPPDLJnQJ

16 2EVHUYHUD1lUGXnWHUJnUWLOOVNULYERUGHWIUnQHWWSURJUDPNRPPHU GHVVQDPQOLVWR KLNRQHUDWWYLVDVWLOOVDPPDQVPHGDOODDQGUDIOLNDU 6NULYDLQLQIRUPDWLRQ 1lUOX NDQlU SSHQNDQGXDQYlQGDGLJDYQnJRQDYI OMDQGH PHWRGHUI UDWWVNULYDLQLQIRUPDWLRQ 'HWILQQVHWWWDQJHQWERUGSnVNlUPHQVRPGXNDQDQYlQGDI U DWWVNULYDLQLQIRUPDWLRQVRPVHGDQYLVDVLWLOOlPSOLJWIlOW 7H NHQLJHQNlQQLQJVRPNDQDQYlQGDVI UDWWVNULYDSnVNlUPHQ PHGSHNGRQHW,QIRUPDWLRQHQNlQQVLJHQR KYLVDVLWLOOlPSOLJW IlOW 0HULQIRUPDWLRQILQQVLDYVQLWWHW 6NULYDLQLQIRUPDWLRQ SnVLGDQ ) UVWDLQVWlOOQLQJDUQD ) UHQHIIHNWLYDQYlQGQLQJDYWHOHIRQHQUHNRPPHQGHUDVDWWGXJ U YLVVDLQVWlOOQLQJDU1RUPDOWVHWWNDQLQVWDOODWLRQHUHQGDVWJ UDVGn OX NDQlU SSHQ'HWLQNOXGHUDUGHIOHVWDIXQNWLRQHUWLOOJlQJOLJDPHG VWlQJGOX ND3HNGRQHWR KGHWOlWWLOOJlQJOLJDPHQ\V\VWHPHWVRP DQYlQGVPHG SSHQOX NDHUVlWWHUGHQWUDGLWLRQHOODWHNQLNHQPHG SLODUVRPDQYlQGVGnOX NDQlUVWlQJG 7LGR KGDWXP 3URJUDPPHQL0HGGHODQGHQR K.DOHQGHUlUEHURHQGHDYNRUUHNW WLGVR KGDWXPLQVWlOOQLQJ,QVWlOOQLQJHQJ UVLSURJUDPPHW.OR ND 6nKlUNRPPHUGXWLOOSURJUDPPHW.OR ND 9lOMIOLNHQ)OHUSURJUDPI UDWWYLVDIXQNWLRQHUQD.OL NDSnLNRQHQ.OR ND,HWWI QVWHUYLVDVWLGR KGDWXP.RPPDLJnQJ

17 6nKlUYlOMHUGXQXYDUDQGHWLGV]RQR KGHVWLQDWLRQV]RQ.OL NDSn R KYlOM7LGV]RQHU) QVWUHW7LGV]RQHUYLVDV 9lOM$XWRPDWLVNWLGV]RQI UDWWDQJHRPQlWYHUNHWVWLGVNDOO DQYlQGDVI UPRWWDJDUNOR NDQ'XNDQYlOMD3nHOOHU$YL UXOOJDUGLQVPHQ\Q2PGHQDXWRPDWLVNDWLGV]RQHQlULQVWlOOGWLOO3n R KHQXSSGDWHULQJDYQlWYHUNVWLGHQKDUJMRUWVYLVDVI OMDQGH PHGGHODQGHLWH NHQI QVWUHW 7LGHQKDUXSSGDWHUDWV 9lOM2. 2EVHUYHUD1lWYHUNVWLGHQVW GVLQWHDYDOODQlW ) UDWWDQJHKXUWLGV]RQHUQDVNDOOYLVDVNOL NDUGXSn9LVQLQJDY WLGV]RQR KYlOMHU87&WLGVVNLOOQDG87&VWnUI U&RRUGLQDWHG 8QLYHUVDO7LPHDQWDOWLPPDULWLGVVNLOOQDGHOOHU=RQQDPQGYV &(7&HQWUDO(XURSHDQ7LPH DQWDOWLPPDULWLGVVNLOOQDG IUnQ87& 9lOM+HP]RQR KDQYlQGYlQVWHUR KK JHUSLOWDQJHQWHUI UDWW YlOMD QVNDGWLGV]RQ 9lOM'HVWLQDWLRQV]RQR KDQYlQGYlQVWHUR KK JHUSLOWDQJHQWHUI U DWWYlOMD QVNDGWLGV]RQ 9lOMGHQLQVWlOOQLQJI U6RPPDUWLGVRPGXYLOOlQGUDGYV+HPPD HOOHU'HVWLQDWLRQR KYlOM3nHOOHU-D.OL NDSn OK I UDWWD HSWHUDR KVSDUDlQGULQJDUDYWLGV]RQHUQD.OR NI QVWUHWYLVDVLJHQ 2EVHUYHUD2PGXYLOODYEU\WDLQVWlOOQLQJDUQDRYDQLQnJRWVNHGH YlOMHUGX.OR NI QVWUHWYLVDVLJHQ 6nKlUVWlOOHUGXNOR NDQ.OL NDSn R KYlOM6WlOOLQWLG) QVWUHW6WlOOLQWLGYLVDV $QYlQGSLONQDSSDUQDI UDWWVWlOODNOR NDQHOOHUNOL NDSnXUWDYODQ R KIO\WWDWLPR KPLQXWYLVDUQDWLOO QVNDGWLG 2PGDWXPIRUPDWHWlULQVWlOOWSn)0(0NOL NDUGXSn I UDWW lqgudwlghqvrpylvdvphg WLPPDU.RPPDLJnQJ

18 .OL NDSn LJHQ OK I UDWWEHNUlIWDGHQQ\DWLGHQ.OR NI QVWUHWYLVDV 2EVHUYHUD2PGXYLOODYEU\WDLQVWlOOQLQJDUQDRYDQLQnJRWVNHGH YlOMHUGX.OR NI QVWUHWYLVDVLJHQ 6nKlUVWlOOHUGXLQGDWXPHW.OL NDSn R KYlOM6WlOOLQGDWXP) QVWUHW6WlOOLQGDWXPYLVDV $QYlQGYlQVWHUR KK JHUSLOWDQJHQWHUI UDWWYlOMDPnQDGR KnU R KYlOMGDJJHQRPDWWNOL NDSnUHVSHNWLYHGDJLNDOHQGHUQ.OL NDSn OK I UDWWEHNUlIWDGHWQ\DGDWXPHW.OR NI QVWUHWYLVDV LJHQ 2EVHUYHUD2PGXYLOODYEU\WDLQVWlOOQLQJDUQDRYDQLQnJRWVNHGH YlOMHUGX.OR NI QVWUHWYLVDVLJHQ0HULQIRUPDWLRQILQQVL DYVQLWWHW *OREDODLQVWlOOQLQJDU SnVLGDQ 3HUVRQXSSJLIWHU 'HWlUYLNWLJWDWWWHOHIRQHQLQQHKnOOHULQIRUPDWLRQRPlJDUHQRPGHQ VNXOOHEOLVWXOHQHOOHUI UNRPPD'HVVXWRPlUGHWP MOLJWDWWVNL ND ljdulqirupdwlrqyldlqiudu GSRUWWLOOHQDQQDQHQKHWHOOHUWLOOVDPPDQV PHGHSRVWQlUGXNQ\WHUQ\DNRQWDNWHU 9DUQLQJ,QIRUPDWLRQHQLGLQ5VNDQLQQHElUDHQVlNHUKHWVULVN RPWHOHIRQHQEOLUVWXOHQHOOHUWDSSDVERUWWLOOVDPPDQVPHGQ\ NODU HOOHUNUHGLWNRUW'lUI UE UGXI UYDUDVnGDQDWLOOK ULJKHWHUVHSDUDW 6nKlUDQJHUGXSHUVRQXSSJLIWHU 9lOM.RQWDNWHU.OL NDSn3HUVRQXSSJLIWHUR KVNULYLQGLQDSHUVRQXSSJLIWHU 6NULYLQGLWWQDPQLGHWI UVWDIlOWHW )RUWVlWWPHGI OMDQGHIlOWJHQRPDWWNOL NDSn 2PGXYLOOJn WLOOEDNDWLOOI UHJnQGHIlOWNOL NDUGXSn.OL NDSn I UDWWYLVDGHSHUVRQXSSJLIWHUVRPGXKDUI UWLQ.RPPDLJnQJ

19 .OL NDSn OK I UDWWVSDUDLQIRUPDWLRQHQR KVHGDQnWHUJnWLOO VNULYERUGHW HOOHU 2PGXNOL NDUSn KDUGXP MOLJKHWDWWDYEU\WDLQQDQGXnWHUJnU WLOOVNULYERUGHW.OL NDSn-DRPGXLQWHYLOOVSDUDLQIRUPDWLRQHQ HOOHU1HMRPGXYLOOnWHUJnWLOOI QVWUHW3HUVRQXSSJLIWHU HOOHU 2PGXNOL NDUSn KDUGXP MOLJKHWDWWVSDUDLQQDQGXnWHUJnU WLOOVNULYERUGHW.OL NDSn-DRPGXYLOOVSDUDLQIRUPDWLRQHQHOOHU Sn1HMRPGXYLOODYVOXWDXWDQDWWVSDUD.DOLEUHULQJDYVNlUP 6NlUPHQlUI UNDOLEUHUDGHQOLJWIDEULNVVWDQGDUG'HWlUGR NLQWH VlNHUWDWWGHW YHUHQVVWlPPHUPHGKXUGXDQYlQGHUSHNGRQHW.DOLEUHULQJHQJ UVPHGKlQV\QWLOOSHNGRQHWVJHQRPVQLWWVKDVWLJKHW R KVWlOOHWPDQSHNDUSnQlUPDQJ UVLWWYDO'XNOL NDUNDQVNH VQDEEWR KOLWHnWK JHULVWlOOHWI ULPLWWHQ 6nKlUNDOLEUHUDUGXRPSHNGRQHW 9lOM)OHUSURJUDP.OL NDSn6\VWHP.OL NDSn.DOLEUHULQJDYVNlUPR KVNlUPLQVWlOOQLQJHQYLVDVL WH NHQI QVWUHW.OL NDHQJnQJLPLWWHQDYSXQNWHUQDLQXPPHURUGQLQJ 1 Kalibrera pekskärm Klicka mitt på punkt (IWHUDWWKDNOL NDWSnGHQWUHGMHSXQNWHQYLVDVPHGGHODQGHW.DOLEUHULQJVOXWI UG LWH NHQI QVWUHW.OL NDSn-DI UDWW EHNUlIWDR KVSDUDlQGULQJDUQD6NlUPHQNRPPHUQXDWWUHDJHUD LHQOLJKHWPHGLQVWlOOQLQJDUQD'XNRPPHUDXWRPDWLVNWWLOOEDND WLOOI QVWUHWPHGV\VWHPIXQNWLRQHU.OL NDSn I UDWWnWHUJnWLOOVNULYERUGHW.RPPDLJnQJ

20 ,PSRUWDYWHOHIRQERNIUnQ6,0NRUWHW 2PGXKDUQDPQR KQXPPHUVSDUDGHLHQWHOHIRQERNSn6,0NRUWHW NDQGXLPSRUWHUDGHVVDWLOOGLQWHOHIRQ 6nKlULPSRUWHUDUGXWHOHIRQERNHQIUnQ6,0NRUWHW 9lOM.RQWDNWHU.OL NDSn,QQHKnOOVI UWH NQLQJ R KYlOM,PSRUWHUDIUnQ6,0NRUW.OL NDSn ) QVWUHW,PSRUWHUDIUnQ6,0NRUWYLVDV 2PGXYLOOLPSRUWHUDHWWQXPPHUEOlGGUDUGXIUDPWLOO QVNDW QXPPHUR KPDUNHUDUGHW(QUXOOJDUGLQVPHQ\YLVDVL WH NHQI QVWUHWPHGI OMDQGHYDOP MOLJKHWHU,PSRUWHUDVRPI UQDPQ,PSRUWHUDVRPHIWHUQDPQ,PSRUWHUDVRPI UHWDJ 9lOM QVNDGLQVWlOOQLQJ R KYlOM,PSRUWHUDDOODVRPI UQDPQ,PSRUWHUDDOODVRPHIWHUQDPQHOOHU,PSRUWHUD DOODVRPI UHWDJ,PSRUWHUDDOODWHOHIRQQXPPHUJHQRPDWWNOL NDSn 1XPUHQLPSRUWHUDVVHGDQWLOOGDWDEDVHQ.RQWDNWHUR KHWW LQIRUPDWLRQVI QVWHUEHNUlIWDU YHUI ULQJHQ 2EVHUYHUD'HQ\LPSRUWHUDGHQXPUHQNRPPHUVRPVWDQGDUGDWW NODVVLIL HUDVVRPPRELOWHOHIRQQXPPHU2PHWWLPSRUWHUDWWHOHIRQ QXPPHULQWHlUHWWPRELOQXPPHUPnVWHGXWLOOGHODQXPUHWNRUUHNW HWLNHWWGYVDUEHWHKHPRVY2PGXLQWHJ UGHWR KI UV NHUVlQGDHWW NRUWPHGGHODQGH606WLOOHWWLPSRUWHUDWWHOHIRQQXPPHUVRPLQWHlU HWWPRELOQXPPHUNRPPHUPHGGHODQGHWLQWHDWWVlQGDV.RPPDLJnQJ

21 6lNHUKHW 3,1NRG 3,1NRGHQ3HUVRQDO,GHQWLIL DWLRQ1XPEHUlUWLOOI UDWWLGHQWLILHUD DQYlQGDUHQR KVN\GGDPRWREHK ULJDQYlQGQLQJDYWHOHIRQHQ 9DQOLJWYLVPnVWHGXDQJH3,1NRGHQQlUGXVOnUSnWHOHIRQHQ,QIRUPDWLRQRPKXUGXlQGUDU3,1NRGHQILQQVLDYVQLWWHW 6nKlU lqgudugx3,13,1nrg SnVLGDQ 8SSOnVQLQJVNRGHQ38. 2PGXDQJHUIHO3,1NRGWUHJnQJHULI OMGNRPPHU6,0NRUWHWDWW EOR NHUDV) UDWWOnVDXSS6,0NRUWHWPnVWHGXDQJH38.NRGHQ 3HUVRQDO8QEOR NLQJ.H\VRPPHGI OMHUDERQQHPDQJHWIUnQ QlWRSHUDW UHQ 6nKlUOnVHUGXXSS6,0NRUWHW $QJHXSSOnVQLQJVNRGHQVRPYDQOLJWYLVEHVWnUDYnWWDWLOOVH[WRQ VLIIURUR KNOL NDSn 2EVHUYHUD$YVlNHUKHWVVNlOYLVDVVLIIURUQDVRPDVWHULVNHU 0D[LPDOWWLRI UV NWLOOnWV.RQWDNWDGLQQlWRSHUDW URPNRUWHWLQWH OnVHVXSS,GHWWDOlJHNDQGXIRUWIDUDQGHULQJDQ GVDPWDO 2PXSSOnVQLQJVNRGHQD HSWHUDVRPEHGVGXVNULYDLGLQQ\D3,1 NRG$QJHGLQ3,1NRGR KNOL NDSn 7HOHIRQOnVNRG 7HOHIRQOnVHWDNWLYHUDUHWWQXPPHUVRPLGHQWLILHUDUDQYlQGDUHQR K VRPVN\GGDUPRWREHK ULJDQYlQGQLQJDYWHOHIRQHQRPGHQEOLU VWXOHQR KRP6,0NRUWHWE\WVXW6N\GGHWlULQWHDNWLYHUDWQlUGX N SHUWHOHIRQHQ'XNDQlQGUDWHOHIRQOnVNRGHQlUVWDQGDUGWLOO HQSHUVRQOLJNRGEHVWnHQGHDYWUHWLOOnWWDVLIIURU 7HOHIRQOnVHWKDUWUHP MOLJDLQVWlOOQLQJDU $YOnVHWlULQWHDNWLYHUDW $XWRPDWLVNOnVHWDNWLYHUDVQlU6,0NRUWHWE\WVXW 3nOnVHWlUDNWLYHUDWR KGXRPEHGVDQJHOnVNRGHQQlUGXVOnUSn WHOHIRQHQ 0HULQIRUPDWLRQILQQVLDYVQLWWHW 6nKlUlQGUDUGXWHOHIRQOnVNRG Sn VLGDQ.RPPDLJnQJ

22 6WlQJGOX ND,GHWKlUDYVQLWWHWEHVNULYVYLONDIXQNWLRQHUR KLQVWlOOQLQJDUVRPlU WLOOJlQJOLJDQlUOX NDQlUVWlQJG'XNDQKDQWHUDGHROLNDPHQ\UQD JHQRPDWWDQYlQGDNQDSSNRPELQDWLRQHU0HQ\YDOHQYLVDVL WH NHQI QVWUHW 7LSV9LUHNRPPHQGHUDUDWWGXYlQMHUGLJYLGIXQNWLRQHUQDR K LQVWlOOQLQJDUQDI UVWlQJGOX NDSnVDPPDVlWWVRPPHGDQGUD PRELOWHOHIRQHU'HYDQOLJDVWHLQVWlOOQLQJDUQDVRPRPIDWWDUOlJHQD EnGHI UVWlQJGR K SSHQOX NDKDQWHUDVQlUOX NDQlU SSHQ0HU LQIRUPDWLRQRP SSHQOX NDILQQVLUHVSHNWLYHSURJUDPNDSLWHO 7HOHIRQ.RQWDNWHU0HGGHODQGHQ.DOHQGHU:$3WMlQVWHUR K)OHU SURJUDP,QIRUPDWLRQRPKXUGXVWDUWDU5VILQQVL 6OnDYSn SnVLGDQ 9RO\PNQDSS 5 VWDQWH NQLQJDU NÄTVERK :00.QDSSVDWV 7HOHIRQNQDSSDU 3nWHOHIRQHQV YUHGHOVLWWHUYRO\PNQDSSHQR K U VWDQWH NQLQJVNQDSSHQ'HKDUHQHOOHUIOHUDVlUVNLOGDIXQNWLRQHU 0HGYRO\PNQDSSHQNDQGXJ UDI OMDQGH + MDHOOHUVlQNDYRO\PHQLK JWDODUHQ'UDGHQXSSnWI UDWWK MD YRO\PHQR KQHGnWI UDWWVlQNDYRO\PHQ 6WDUWDU VWDNWLYHULQJQlUGXULQJHUJHQRPDWWGUDNQDSSHQR K KnOODGHQLQWU\ NW 6OnSnEHNUlIWDR KVWlQJDYKDQGVIUHHOlJHW0HULQIRUPDWLRQ ILQQVLDYVQLWWHW + JWDODUOlJH SnVLGDQ 6OnSnEHO\VQLQJHQ'UDXSSNQDSSHQR KVHGDQQHUHOOHUWYlUWRP 6WlQJGOX ND

23 6nKlUVSHODUGXLQHQU VWDQWH NQLQJPHG U VWDQWH NQLQJVNQDSSHQ 7U\ NSnNQDSSHQR KKnOOGHQLQWU\ NWLXQJHIlU VHNXQGHUI U DWWVWDUWDU VWDQWH NQLQJHQ 7U\ NLJHQI UDWWVWRSSDU VWDQWH NQLQJHQ 6nKlUVSHODUGXXSSHQU VWDQWH NQLQJPHG U VWDQWH NQLQJVNQDSSHQ 7U\ NSnNQDSSHQI UDWWVSHODXSSU VWDQWH NQLQJHQ 7U\ NLJHQI UDWWVWRSSDU VWDQWH NQLQJHQ.QDSSVDWVHQVIXQNWLRQHU.QDSSDUQDSnNQDSSVDWVHQVHOOHUOX NDQVQHGUHGHOSn5VKDUHQ HOOHUIOHUDVlUVNLOGDIXQNWLRQHU 7LSV8WWU\ NHW WU\ NSnNQDSSHQR KKnOOGHQLQWU\ NW LQQHElUDWW NQDSSHQVNDKnOODVLQWU\ NW D VHNXQGHU 0HGNQDSSHQ<(6NDQGXJ UDI OMDQGH 5LQJDHWWVDPWDOQlUGXKDUVNULYLWLQHWWWHOHIRQQXPPHU %HVYDUDHWWLQNRPPDQGHVDPWDO 9lOMDHQPDUNHUDGSRVWSnHQPHQ\XQGHUPHQ\HOOHULQVWlOOQLQJ 9LVDOLVWDQ YHUVHQDVWXSSULQJGDQXPPHU 3DUNHUDSnJnHQGHVDPWDO $NWLYHUDU VWXSSULQJQLQJJHQRPDWWKnOODNQDSSHQLQWU\ NW cwhuxsswdsdunhudghvdpwdo 0HGNQDSSHQ12NDQGXJ UDI OMDQGH 6OnSnR KDY5QlUNQDSSHQKnOOVLQWU\ NW $YVOXWDSnJnHQGHVDPWDO $YYLVDHWWLQNRPPDQGHVDPWDOR KVlQGDHQXSSWDJHWWRQ cwhujnwlooylqwholjhsnhqphq\wu\ NSnNQDSSHQR KKnOOGHQ LQWU\ NW *nwlooedndhwwvwhjlphq\huqddyvoxwdhqlqvwlooqlqjhoohuolpqd HQLQVWlOOQLQJRI UlQGUDG 0HGYlQVWHUR KK JHUSLONQDSSNDQGXJ UDI OMDQGH 9lOMDGHQ YHUVWDPHQ\QLYnQ *nphoodqphq\iolnduqd 0HGXSSR KQHGSLONQDSSDUQDNDQGXJ UDI OMDQGH %OlGGUDLHQPHQ\HOOHUHQOLVWD 6WlQJGOX ND

24 0HG&NQDSSHQNDQGXJ UDI OMDQGH 5DGHUDVNULYQDWH NHQVLIIURUIUnQWH NHQI QVWUHWHQR KHQ 5DGHUDHQKHOUDGDYVNULYQDWH NHQVLIIURUJHQRPDWWWU\ NDSn NQDSSHQR KKnOODGHQLQWU\ NW.RSSODERUWPLNURIRQHQVHNUHWHVVIXQNWLRQQlUHWWVDPWDOSnJnU JHQRPDWWWU\ NDSnNQDSSHQR KKnOODGHQLQWU\ NW 6WlQJDDYULQJVLJQDOHQXQGHULQNRPPDQGHVDPWDO 6lWWD5VLW\VWOlJHYLGYlQWHOlJHJHQRPDWWWU\ NDSnNQDSSHQ R KKnOODGHQLQWU\ NW 0HGWHOHIRQERNHQVNRUWNRPPDQGRNQDSSNDQGXJ UDI OMDQGH *nlqlwhohirqernhqgluhnw 0HGVLIIHUNQDSSDUQDNDQGXJ UDI OMDQGH 6NULYDVLIIURUQDWLOO 6NULYWLOOK UDQGHWH NHQHOOHUXWI UHQWLOOK UDQGHIXQNWLRQWLOO H[HPSHO NQDSSHQVNULYHUGHWLQWHUQDWLRQHOODWH NQHWQlUGHQKnOOV LQWU\ NW NQDSSHQULQJHUXSSWHOHIRQVYDUDUHQQlUGHQKnOOVLQWU\ NW 6NULYDHWWNRUWNRPPDQGRWLOOHQSRVWLWHOHIRQERNHQJHQRPDWW WU\ NDSnNQDSSHQR KKnOODGHQLQWU\ NW 0HGVWMlUQDQHOOHUDVWHULVNHQNDQGXJ UDI OMDQGH 6NULYDWH NQHW 6NULYDLQHWWSSDXVWH NHQJHQRPDWWKnOODNQDSSHQLQWU\ NW 0HGNQDSSHQI\UNDQWNDQGXJ UDI OMDQGH 6NULYDWH NQHW $YVOXWDLQPDWQLQJDY3,1R KVlNHUKHWVNRGHU 6 NDHIWHUWHOHIRQQXPPHULWHOHIRQERNHQSn6,0NRUWHWDQJH QXPUHWSnPLQQHVSRVLWLRQHQR KWU\ NVHGDQSn,QGLNDWRUHULWH NHQI QVWUHW 1lUGXDQVOXWHU5VWLOOQlWRSHUDW UHQI UVlWWVWHOHIRQHQL YlQWHOlJH,WH NHQI QVWUHWYLVDVHWWDQWDOROLNDLQGLNDWRUHURPGH DNWLYHUDV! 1lUWH NHQI QVWUHWlULYlQWHOlJHlUGHWLQGHODWLWUHGHODU 6WDWXVLQGLNDWRUHU YHUVWR KLPLWWHQSnWH NHQI QVWUHW 7H[WR KVLIIHULQGLNDWRUHULPLWWHQ,QGLNDWRUHUI UVLJQDOVW\UNDR KEDWWHULQHGHUVWLWH NHQI QVWUHW 6WlQJGOX ND

25 ,QGLNDWRUHU 5LQJVLJQDOLQVWlOOGSn5LQJVLJQDOHQlUDYVWlQJG 7\VWOlJH$OODOMXGVLJQDOHUlUDYVWlQJGD 7H[WPHGGHODQGHPRWWDJHW(WWPHGGHODQGHKDUPRWWDJLWV 9LGDUHNRSSOLQJ$OODLQNRPPDQGHVDPWDOYLGDUHNRSSODV RYLOONRUOLJWWLOOHWWDQJLYHWWHOHIRQQXPPHU 6HNUHWHVV0LNURIRQHQlUDYVWlQJG! $YNU\SWHULQJ3nJnHQGHVDPWDOlULQWHOlQJUHNU\SWHUDWR KlU GlUPHGLQWHSULYDW'HQQDIXQNWLRQI OMVDYHQYDUQLQJVVLJQDO,QGLNDWRUQYLVDVLWH NHQI QVWUHWWLOOVNU\SWHULQJHQnWHUWDVHOOHU VDPWDOHWDYVOXWDVEHURHQGHSnYLONHWVRPVNHUI UVW 2EVHUYHUD.U\SWHULQJlUHQQlWIXQNWLRQVRPI UYUlQJHUVDPWDOR K PHGGHODQGHQI UDWWJH NDGVlNHUKHW 5 VWPHGGHODQGH(WWLQNRPPDQGHU VWPHGGHODQGHKDUPRWWDJLWV,QIUDU G'HQLQIUDU GDSRUWHQlUDNWLYHUDG 5 VWVW\UQLQJlUDNWLYHUDG2PU VWXSSULQJQLQJlUDNWLYHUDG YLVDVGHWLWH NHQI QVWUHW /DUP/DUPHWlULQVWlOOWR KDNWLYHUDW.QDSSOnV.QDSSVDWVHQlUOnVWI UDWWI UKLQGUDRDYVLNWOLJ DQYlQGQLQJ 7H[WR KVLIIURU 1lW$NWXHOOWQlWYLVDV 'DWXP9LVDUDNWXHOOWGDWXPLQDWLRQHOOWIRUPDW 7LG9LVDUDNWXHOOWLGLQDWLRQHOOWIRUPDW 6LJQDOVW\UNDR KEDWWHULODGGQLQJ 0lWDUHI UQlWVLJQDOVW\UND-XIOHUVWDSODUVRPYLVDVGHVWR VWDUNDUHlUVLJQDOHQ± HQKHWHU %DWWHULPlWDUH-XPHUI\OOGLNRQHQlUGHVWRElWWUHlUEDWWHULHW ODGGDW± HQKHWHU 6WlQJGOX ND

26 $QGUDLQGLNDWRUHU )XOOW606PLQQH0HGGHODQGHPLQQHWL5VlUIXOOWR KLQJD 606PHGGHODQGHQNDQWDVHPRW,QIRUPDWLRQRPKXUGXUDGHUDU VSDUDGH606PHGGHODQGHQIUnQ5VILQQVL 7DERUW PHGGHODQGHQ SnVLGDQ 6DPWDOVPlWDUH,QIRUPDWLRQRPWRWDOVDPWDOVWLGIUnQVDPWDOHWVVWDUW WLOOVGHWlUDYVOXWDW.RQIHUHQV,QGLNHUDUDWWHWWIOHUSDUWVVDPWDOSnJnU 8SSNRSSODWQXPPHU1XPUHWVRPNRSSODWVXSSDQWLQJHQWLOOHWW LQNRPPDQGHHOOHUHWWXWJnHQGHVDPWDO 2EVHUYHUD3nJUXQGDYUHVWULNWLRQHUlUGHWLQWHDOOWLGP MOLJWDWW YLVDHWWLQNRPPDQGHVDPWDOVQXPPHU'nYLVDVLVWlOOHWRNlQWHOOHUGROW QXPPHULWH NHQI QVWUHW 8SSNRSSODWQDPQ1DPQHWSnGHQSHUVRQGXWDODUPHGYLVDVL WH NHQI QVWUHWRPGHWILQQVHWWQXPPHUNRSSODWWLOOQDPQHWL WHOHIRQERNHQHOOHUL6,0NRUWHWVWHOHIRQERN 8SSNRSSOLQJVI UORSS,QIRUPDWLRQRPVDPWDOVVWDWXVI USnJnHQGH VDPWDOWLOOH[HPSHO5LQJHUXSS$QVOXWHUHOOHU8SSWDJHW +LWWDLPHQ\V\VWHPHW 1lUOX NDQlUVWlQJGILQQVHWWEHJUlQVDWDQWDOIXQNWLRQHUVRPGXNDQ DQYlQGDYLDHQKXYXGPHQ\7U\ NSn HOOHU XWLIUnQ WH NHQI QVWUHWVYlQWHOlJHI UDWWYLVDKXYXGPHQ\DOWHUQDWLYHQ 'HWILQQVI\UDDOWHUQDWLYSnIOLNDUQDK JVWXSSLWH NHQI QVWUHW +XYXGPHQ\HUQDlU 7HOHIRQPHQ\±DNWLYHUDUR KDYDNWLYHUDULQVWlOOQLQJDU.DOHQGHU±YLVDUP WHQDWWJ UDR KKlQGHOVHU,QNRUJ±YLVDUPHGGHODQGHQVRPGXKDUWDJLWHPRW 7HOHIRQERN±YLVDUR KULQJHUVDPWDO 9lOMR KJnPHOODQPHQ\HUQDJHQRPDWWDQYlQGDI OMDQGHNQDSSDU HOOHU I UDWWPDUNHUDKXYXGPHQ\HUQD HOOHU I UDWWEOlGGUDLPHQ\DOWHUQDWLYHQ 7U\ NSn I UYlOMD 7LSV1lUGXJnULQLPHQ\HUNDQGXWU\ NDSn I UDWWJn WLOOEDNDWLOOKXYXGPHQ\Q*nWLOOEDNDWLOOYlQWHOlJHWJHQRPDWWWU\ ND Sn R KKnOODGHQLQWU\ NW 6WlQJGOX ND

27 5LQJDR KWDHPRWVDPWDO,QVWUXNWLRQHUQDLGHWWDDYVQLWWXWJnULIUnQDWW5VlULYlQWHOlJHQlU GXULQJHUR KWDUHPRWVDPWDO ) UDWWXSSQnYlQWHOlJHPnVWHI OMDQGHYLOONRUXSSI\OODV 5VVNDYDUDSnVODJHQ 5VVNDYDUDLQRPHWWQlWVWl NQLQJVRPUnGH 6,0NRUWHWVNDYDUDLVDWWR K3,1NRGHQNRUUHNWDQJLYHQ 2EVHUYHUD1lUGXlUXWRPODQGVNDQDQGUDQlWDQYlQGDVI UXWVDWW DWWGLQKHPQlWRSHUDW UKDUVNULYLWLQLDYWDOHWDWWGXNDQDQYlQGD DQGUDQlW 6nKlUULQJHUGXLQULNHVVDPWDO 6NULYLQULNWQXPPHUR KWHOHIRQQXPPHU1lWWLGR KGDWXP I UVYLQQHUR KQXPUHWVRPVNDVOnVYLVDV 2EVHUYHUD2PGXYLOOUDGHUDHQVLIIUDWU\ NHUGXSn 2PGX YLOOUDGHUDDOODVLIIURUWU\ NHUGXSn R KKnOOHUGHQLQWU\ NWWLOOV VLIIURUQDI UVYLQQHU 7LSV6NULYLQODQGVQXPPHUULNWQXPPHUXWDQLQOHGDQGHQROODR K WHOHIRQQXPPHUQlUGXVNULYHULQQXPPHULWHOHIRQERNHQR KVSDUDU GHP1XPUHQNDQGnOlWWDQYlQGDVQlUGXlUKHPPDHOOHUXWRPODQGV 1lUNRUUHNWQXPPHUKDUVNULYLWVLQWU\ NHUGXSn 7H NHQI QVWUHWYLVDU5LQJHUXSSXWJnHQGHVDPWDOKDUSnE UMDWV I OMWDY$QVOXWHUHQOLQMHKDUWLOOGHODWV1lUVDPWDOHWEHVYDUDV EHWUDNWDVGHWVRPSnJnHQGH(QVDPWDOVLQGLNDWRUVWDUWDUGnR K YLVDUI UIOXWHQWLGLPLQXWHUR KVHNXQGHU $YVOXWDVDPWDOHWJHQRPDWWWU\ NDSn 2EVHUYHUD7LGVLQGLNDWRUQNDQYLVDI UIOXWHQVDPWDOVWLGLWLPPDU PLQXWHUR KVHNXQGHU7LPPDUYLVDVLQWHI UUlQVDPWDOHWSnJnWWPHU lqhqwlpph 2PVDPWDOHWLQWHEHVYDUDVQXPUHWlUXSSWDJHWHOOHUNRQWDNWLQWH XSSQnVWU\ NHUGXSn 1XPUHWVSDUDVLHWWNRUWWLGVPLQQHVnDWW GHWOlWWNDQULQJDVXSSLJHQ 6nKlUULQJHUGXXSSVHQDVWXSSULQJGDQXPPHULJHQ 7U\ NSn 7H NHQI QVWUHWYLVDUOLVWDQ YHUVHQDVWVODJQD QXPPHUPHGGHWDOOUDVHQDVWXSSULQJGDQXPUHWPDUNHUDW 7U\ NSn HQJnQJWLOOI UDWWULQJDXSSQXPUHW 6WlQJGOX ND

28 'XNDQlYHQEOlGGUDLOLVWDQPHG HOOHU WLOOQnJRWDYGHDQGUD QXPUHQR KVHGDQWU\ NDSn I UDWWULQJDXSSQXPUHW $XWRPDWLVNnWHUXSSULQJQLQJ 2PXSSNRSSOLQJHQDYVDPWDOHWPLVVO\ NDVHOOHUDQYlQGDUHQlU XSSWDJHQR KPRWWDJDUHQVQlWEHNUlIWDUGHWWDYLVDVcWHUXSSULQJQLQJ"L WH NHQI QVWUHWL VHNXQGHUHOOHUWLOOVQnJRQDQQDQIXQNWLRQYlOMV 1lUcWHUXSSULQJQLQJ"YLVDVLWH NHQI QVWUHWJ UGXI OMDQGH 7U\ NSn RPGXYLOOULQJDXSSQXPUHWLJHQHOOHUSn RPGXLQWHYLOOGHW2PGXWU\ NHUSn ULQJVQXPUHWXSS DXWRPDWLVNWWLOOVVDPWDOHWEHVYDUDVHOOHUWLOOVPD[LPDOWDQWDOI UV N KDUJMRUWV$QWDOHWnWHUXSSULQJQLQJVI UV NEHURUSnRUVDNHQWLOODWW XSSNRSSOLQJHQLQWHO\ NDGHVWH[XSSWDJHWLQJHWVYDU2PGX WU\ NHUSnQnJRQNQDSSHOOHUInUHWWLQNRPPDQGHVDPWDOPHGDQ cwhuxssulqjqlqj"ludnwlyhudgdyeu\wvnwhuxssulqjqlqjhq 2PnWHUXSSULQJQLQJHQO\ NDVULQJHU5VHQVLJQDO 8WODQGVVDPWDO 1lUGXULQJHUXWODQGVVDPWDOPnVWHGXDQJHXWODQGVSUHIL[HWI OMWDY ULNWQXPUHWR KWHOHIRQQXPUHW 2EVHUYHUD6OnLQWHLQOHGDQGHQROODLHXURSHLVNDULNWQXPPHUQlUGX ULQJHUXWODQGVVDPWDO'HWWDJlOOHUlYHQQnJUDDQGUDULNWQXPPHU 6nKlUULQJHUGXXWODQGVVDPWDO 7U\ NSnR KKnOOGHQLQWU\ NWWLOOVGHWLQWHUQDWLRQHOODWH NQHW YLVDVLWH NHQI QVWUHW'HWE\WVDXWRPDWLVNWXWPRWXWODQGVSUHIL[HW I UGHWODQGGXULQJHUIUnQ 6NULYLQODQGVQXPUHWULNWQXPUHWXWDQLQOHGDQGHQROODR K WHOHIRQQXPUHW 7U\ NSn I UDWWULQJDXSSWHOHIRQQXPUHW 1 GVDPWDO ) UXWVDWWDWWGXEHILQQHUGLJLQRPHWWQlWVWl NQLQJVRPUnGHNDQGHW LQWHUQDWLRQHOODODUPQXPUHWQRUPDOWULQJDVlYHQRPGHWLQWHVLWWHU QnJRW6,0NRUWL5V 2EVHUYHUD9LVVDQlWNUlYHUDWWGXKDUVDWWLHWW6,0NRUWLWHOHIRQHQ R KLYLVVDIDOOlYHQDQJHWW3,1NRGHQ 6WlQJGOX ND

OKIFAX 5680. hjälpguide

OKIFAX 5680. hjälpguide OKIFAX 5680 hjälpguide 9DUMHnWJlUGKDUYLGWDJLWVI UDWWJDUDQWHUDDWWLQIRUPDWLRQHQLGHWWDGRNXPHQWlU IXOOVWlQGLJULNWLJRFKDNWXHOO7LOOYHUNDUHQSnWDUVLJLQJHWDQVYDUI UUHVXOWDWDYIHO XWDQI U VLQ NRQWUROO 7LOOYHUNDUHQ

Läs mer

$QYlQGDUKDQGERN. Creative Sound Blaster Audigy Creative Audio Software

$QYlQGDUKDQGERN. Creative Sound Blaster Audigy Creative Audio Software $QYlQGDUKDQGERN Creative Sound Blaster Audigy Creative Audio Software,QIRUPDWLRQHQLGHWKlUGRNXPHQWHWNDQlQGUDVXWDQI UHJnHQGHPHGGHODQGHRFKPHGI ULQJDXWIlVWHOVHUIUnQ&UHDWLYH7HFKQRORJ\/WG,QJHQGHODYGHQKlU KDQGERNHQInUUHSURGXFHUDVHOOHU

Läs mer

Pdf- filer kräver et t hjälpprogram som het er Adobe Acrobat Reader. Acrobat Reader är en grat is programvara som du kan hämt a på den här sidan.

Pdf- filer kräver et t hjälpprogram som het er Adobe Acrobat Reader. Acrobat Reader är en grat is programvara som du kan hämt a på den här sidan. 1(5/$''1,1* 2&+,167$//$7,21 $9 $&52%$7 5($'(5 3GIGRNXPHQW Pdf- filer kräver et t hjälpprogram som het er Adobe Acrobat Reader. Acrobat Reader är en grat is programvara som du kan hämt a på den här sidan.

Läs mer

Börja med at t st art a programmet Word. menyfält et. välj däreft er at t klicka på %LOGREMHNW och vidare på :RUG$UW. Tillbaka.

Börja med at t st art a programmet Word. menyfält et. välj däreft er at t klicka på %LOGREMHNW och vidare på :RUG$UW. Tillbaka. I den här kursen har jag använt Word 2002. Några mindre skillnader kan f örekomma med t idigare versioner men jag t ror at t du lät t kan gå igenom den här lat hunden oberoende av Word- v ersion. Känner

Läs mer

2!+%, n NYTT RADIOKOMMUNIKATIONSSYSTEM 0OLISMYNDIGHETEN I 6ØSTRA ' TA LAND PLANERAR ATT B RJA ANVØNDA SIG AV DET NYA RADIOKOMMUNIKA TIONSSYSTEMET 2!+%, I FEBRUARI!LLA vbl»sljusmyndigheterv SKA ANVØNDA

Läs mer

$QYlQGDUKDQGERN. Creative Sound Blaster Live! Ljudprogramvara från Creative

$QYlQGDUKDQGERN. Creative Sound Blaster Live! Ljudprogramvara från Creative $QYlQGDUKDQGERN Creative Sound Blaster Live! Ljudprogramvara från Creative,QIRUPDWLRQHQLGHQKlUKDQGERNHQNDQNRPPDDWWlQGUDVXWDQDWWGHWPHGGHODVR KLQQHElULQWHQnJRWnWDJDQGHI U&UHDWLYH7H KQRORJ\/WG,QJHQGHODYGHQ

Läs mer

.DQGLGDWXSSVDWVL6WDWLVWLN (QMlPI UDQGHVWXGLHDY KlOVDRFKKlOVRUHODWHUDGOLYVNYDOLWHW L/LQN SLQJRFK1RUUN SLQJ 0DULD0XUSK\ ) URUG 8SSGUDJVJLYDUHQI UH[DPHQVDUEHWHWlU)RONKlOVRYHWHQVNDSOLJW&HQWUXPL /LQN SLQJ8SSVDWVlPQHWDWWXQGHUV

Läs mer

Vad är bra och dåligt med lån?

Vad är bra och dåligt med lån? En tidni ng om p engar + Hu spar r kan j a a pe nga g + Va r? d jag hände inte r beta om lar? + Va d är akti er? Vad är bra och dåligt med lån? Hur beta lar man sma rtas 3 t oc h ka n ja g sk affa ban

Läs mer

Kirunakortet. Fiska i Norrbottens fjällvatten. Fiska i Kiruna. Välkommen till Norrbottensfjällen!

Kirunakortet. Fiska i Norrbottens fjällvatten. Fiska i Kiruna. Välkommen till Norrbottensfjällen! kortet 2014 I länet är landets samtliga större nationalparker och UNESCO:s världsarvsområde, Laponia, belägna. Laponia är ett 9 400 km² stort område med höga natur- och kulturvärden där sju samebyar lever

Läs mer

Bruksanvisning Directions for use

Bruksanvisning Directions for use Bruksanvisning Directions for use CV, KV, RS, LPK, RK, RKB, RKBI IRE, IFK, IFA, TKK, TKS, TKC, RF, RB, DF, CAU Fresh air from SVENSK/ENGLISH VERSION EG-FÖRSÄKRAN OM ÖVERENSSTÄMMELSE Vi intygar härmed att

Läs mer

Text och foto: Erik Söderholm.

Text och foto: Erik Söderholm. TEST ÅTTA NAVIGATORER ALDRIG MERA VILSE Nu har du inte längre någon ursäkt för att ringa och fråga efter vägbeskrivningen. Vi har testat sommarens hetaste gps-appar och QDYLJDWRUHU 'H HVWD U ULNWLJW SULVY

Läs mer

VECKANS LILLA POSTKODVINST á 1.000 kronor Inom nedanstående postkoder vinner följande 245 lottnummer 1.000 kronor vardera:

VECKANS LILLA POSTKODVINST á 1.000 kronor Inom nedanstående postkoder vinner följande 245 lottnummer 1.000 kronor vardera: Dragningsresultat vecka 42-2015 Här nedan kan du se om du är en av de lyckliga vinnarna i veckans utlottning i Svenska PostkodLotteriet. När du har vunnit betalar vi automatiskt ut dina vinstpengar till

Läs mer

AVFUKTARE MUD 340 OCH 340 S

AVFUKTARE MUD 340 OCH 340 S AVFUKTARE MUD 340 OCH 340 S Drift och skötselinstruktion Innehållsförteckning: 1. Allmänna säkerhetsregler 2. Funktionsprincip sorptionsavfuktare 3. Maskinfunktioner 4. Installationsanvisningar 5. Drifttagning,

Läs mer

Melbye kompositmast. Framtidens lösning idag. Melbye kompositmaster på licens från

Melbye kompositmast. Framtidens lösning idag. Melbye kompositmaster på licens från elbye kompositmast Framtidens lösning idag elbye kompositmaster på licens från Dagens konsumenter förväntar sig att elektrisk energi DOOWLG QQV WLOOJlQJOLJ 1\WlQNDQGH LQRP VWROSWHNQRORJL krävs. Det ökande

Läs mer

VIKTIGT: Funktionen för återuppladdning kan endast användas tillsammans med det specialdesignade batteripaketet.

VIKTIGT: Funktionen för återuppladdning kan endast användas tillsammans med det specialdesignade batteripaketet. Bruksanvisning UTTAG FÖR NÄTADAPTER LCD-SKÄRM HÖGTALARE MONITOR (AVLYSSNING) PÅ/AV UTTAG FÖR HÖRLUR ANTENN CALL MODE TALK /+ - Indikator för mottagning och sändning - Knapplås - Ringsignal - Anropsalarm

Läs mer

FINLANDS FÖRFATTNINGSSAMLINGS FÖRDRAGSSERIE ÖVERENSKOMMELSER MED FRÄMMANDE MAKTER

FINLANDS FÖRFATTNINGSSAMLINGS FÖRDRAGSSERIE ÖVERENSKOMMELSER MED FRÄMMANDE MAKTER FINLANDS FÖRFATTNINGSSAMLINGS FÖRDRAGSSERIE ÖVERENSKOMMELSER MED FRÄMMANDE MAKTER 1999 Utgiven i Helsingfors den 22 september 1999 Nr 99 101 INNEHÅLL Nr Sidan 99 Lag om godkännande av vissa bestämmelser

Läs mer

CISPR-emission Fordon Blandat Produktstandarder, EMC Radioutrustning och System, EMC Radioutrustning och System, Tekniska egenskaper

CISPR-emission Fordon Blandat Produktstandarder, EMC Radioutrustning och System, EMC Radioutrustning och System, Tekniska egenskaper Ackreditering för EMC Ackrediteringar Generell standard FCC/ ANSI IEC-61000 CISPR-emission Fordon Blandat Produktstandarder, EMC Radioutrustning och System, EMC Radioutrustning och System, Tekniska egenskaper

Läs mer

VECKANS LILLA POSTKODVINST á 1.000 kronor Inom nedanstående postkoder vinner följande 172 lottnummer 1.000 kronor vardera:

VECKANS LILLA POSTKODVINST á 1.000 kronor Inom nedanstående postkoder vinner följande 172 lottnummer 1.000 kronor vardera: Dragningsresultat vecka 12-2015 Här nedan kan du se om du är en av de lyckliga vinnarna i veckans utlottning i Svenska PostkodLotteriet. När du har vunnit betalar vi automatiskt ut dina vinstpengar till

Läs mer

Hej! På dessa sidor t änkt e vi hjälpa er med hur man loggar in mot en server och " lägger ut " sidor på I nternet.

Hej! På dessa sidor t änkt e vi hjälpa er med hur man loggar in mot en server och  lägger ut  sidor på I nternet. Hej! På dessa sidor t änkt e vi hjälpa er med hur man loggar in mot en server och " lägger ut " sidor på I nternet. För at t flyt t a filerna behövs et t program, et t så kallat " filt ransport program".

Läs mer

.RPPLVVLRQHQEHVOXWDURPHQRPIDWWDQGHUHIRUPDY NRQNXUUHQVUHJOHUQDI UELOI UVlOMQLQJRFKELOVHUYLFH

.RPPLVVLRQHQEHVOXWDURPHQRPIDWWDQGHUHIRUPDY NRQNXUUHQVUHJOHUQDI UELOI UVlOMQLQJRFKELOVHUYLFH ,3 Bryssel den 17 juli 2002.RPPLVVLRQHQEHVOXWDURPHQRPIDWWDQGHUHIRUPDY NRQNXUUHQVUHJOHUQDI UELOI UVlOMQLQJRFKELOVHUYLFH (XURSHLVND NRPPLVVLRQHQ KDU LGDJ DQWDJLW HQ GMlUY PHQ EDODQVHUDG UHIRUP DY NRQNXUUHQVUHJOHUQD

Läs mer

Jokkmokkskortet. Fiska i Norrbottens fjällvatten. Välkommen till Norrbottensfjällen! Fiska i Jokkmokk

Jokkmokkskortet. Fiska i Norrbottens fjällvatten. Välkommen till Norrbottensfjällen! Fiska i Jokkmokk skortet 2014, OlQHW lu ODQGHWV VDPWOLJD VW UUH QDWLRQDOSDUNHU RFK 81(6&2 V YlUOGVDUYVRPUnGH /DSRQLD EHOlJQD /DSRQLD lu HWW NPð VWRUW RPUnGH PHG K JD QDWXU RFK NXOWXUYlUGHQ GlU VMX VDPHE\DU OHYHU RFK DUEHWDU

Läs mer

MZF och MZP montageanvisning (1/5)

MZF och MZP montageanvisning (1/5) MZF och MZP montageanvisning (1/5) Säkerhetsupplysningar Bryt inkommande spänning innan installationen påbörjas. Anslutande ledningar måste vara spänningslösa vid installationen. Kontrollera med spänningsprovare

Läs mer

POSTKODVINSTER á 1.000 kronor Inom nedanstående postkoder vinner följande 307 lottnummer 1.000 kronor vardera:

POSTKODVINSTER á 1.000 kronor Inom nedanstående postkoder vinner följande 307 lottnummer 1.000 kronor vardera: Dragningsresultat vecka 05-2015 Här nedan kan du se om du är en av de lyckliga vinnarna i veckans utlottning i Svenska PostkodLotteriet. När du har vunnit betalar vi automatiskt ut dina vinstpengar till

Läs mer

Handledning - Ipad. En enkel handledning för hur ni kommer igång med din ipad. Ingela Anderstrid 2013-09-05. e-samordnare

Handledning - Ipad. En enkel handledning för hur ni kommer igång med din ipad. Ingela Anderstrid 2013-09-05. e-samordnare Handledning - Ipad En enkel handledning för hur ni kommer igång med din ipad. Ingela Anderstrid e-samordnare Hörby kommun 242 80 Hörby Besöksadress: Ringsjövägen 4 Tel: 0415-37 80 00 Fax: 0415-134 77 kommunen@horby.se

Läs mer

- från idé 2ll produkt

- från idé 2ll produkt Centrum för Innova3va Drycker - från idé 2ll produkt En resurs för dig som vill utveckla unika drycker från lokala råvaror Kort presenta3on av Hortonom: inriktning gene2k och växaörädling VäxAörädlare:

Läs mer

Bruksanvisning Directions for use

Bruksanvisning Directions for use Bruksanvisning Directions for use CK 100, CK 125, CK 150, CK 160, CK 200, CK 250, CK 315 SVENSK/ENGLISH VERSION EG-FÖRSÄKRAN OM ÖVERENSSTÄMMELSE Vi intygar härmed att våra produkter uppfyller kraven i

Läs mer

Rapport Biogas till fordonsgas i Umeåregionen en förstudie

Rapport Biogas till fordonsgas i Umeåregionen en förstudie Rapport Biogas till fordonsgas i Umeåregionen en förstudie Anna Säfvestad Albinsson 2011 Förord Denna förstudie är initierad av Näringslivsservice i Vännäs AB, LRF Västerbotten och BioFuel Region AB. Studien

Läs mer

Bruksanvisning Directions for use

Bruksanvisning Directions for use Bruksanvisning Directions for use CK 100, CK 125, CK 150, CK 160, CK 200, CK 250, CK 315 Fresh air from SVENSK/ENGLISH VERSION EG-FÖRSÄKRAN OM ÖVERENSSTÄMMELSE Vi intygar härmed att våra produkter uppfyller

Läs mer

Uppdraget. Växtstrategi för den lilla staden ² GHW ÀQQV UHFHSW. rubriker enligt programmets uppdragsbeskrivning:

Uppdraget. Växtstrategi för den lilla staden ² GHW ÀQQV UHFHSW. rubriker enligt programmets uppdragsbeskrivning: Uppdraget rubriker enligt programmets uppdragsbeskrivning: 0...... 7. Inledning om Växtstrategi Blandad stad med mötesplatser - mångfald Tillgänglighet och koppling till omgivningen. Integration med stadskärnan

Läs mer

Snabbinstallationsguide för anslutningskabel CA-42

Snabbinstallationsguide för anslutningskabel CA-42 Snabbinstallationsguide för anslutningskabel CA-42 9234594 Upplaga 2 Nokia, Nokia Connecting People och Pop-Port är registrerade varumärken som tillhör Nokia Corporation. Copyright 2005 Nokia. Alla rättigheter

Läs mer

5HVXOWDWWDYODQ I U GHQ LQUH PDUNQDGHQ YLVDU DWW IUDPVWHJ JMRUWV PHQ IRUWIDUDQGH ILQQV GHW KDQGHOVKLQGHU

5HVXOWDWWDYODQ I U GHQ LQUH PDUNQDGHQ YLVDU DWW IUDPVWHJ JMRUWV PHQ IRUWIDUDQGH ILQQV GHW KDQGHOVKLQGHU ,3 Bryssel den 16 maj 2002 5HVXOWDWWDYODQ I U GHQ LQUH PDUNQDGHQ YLVDU DWW IUDPVWHJ JMRUWV PHQ IRUWIDUDQGH ILQQV GHW KDQGHOVKLQGHU (QOLJW GHQ VHQDVWH UHVXOWDWWDYODQ I U GHQ LQUH PDUNQDGHQ lu I UVHQLQJDUQD

Läs mer

Induktiv slinga LPS-4 Användarhandbok. 9354812 Upplaga 3

Induktiv slinga LPS-4 Användarhandbok. 9354812 Upplaga 3 Induktiv slinga LPS-4 Användarhandbok 9354812 Upplaga 3 KONFORMITETSDEKLARATION Vi, NOKIA CORPORATION, tillkännager under vårt ensamma ansvar att produkten LPS-4 uppfyller villkoren i följande EU-direktiv:

Läs mer

POSTKODVINSTER á 1.000 kronor Inom nedanstående postkoder vinner följande 234 lottnummer 1.000 kronor vardera:

POSTKODVINSTER á 1.000 kronor Inom nedanstående postkoder vinner följande 234 lottnummer 1.000 kronor vardera: Dragningsresultat vecka 04-2015 Här nedan kan du se om du är en av de lyckliga vinnarna i veckans utlottning i Svenska PostkodLotteriet. När du har vunnit betalar vi automatiskt ut dina vinstpengar till

Läs mer

0,/-g%,/' $QYLVQLQJDUI UVPnKXVE\JJDUHL6LEER

0,/-g%,/' $QYLVQLQJDUI UVPnKXVE\JJDUHL6LEER 6,3221.817$ Tekniikka- ja ympäristöosasto Rakennusvalvonta 6,%%2.20081 Avdelningen för teknik och miljö Byggnadstillsyningen %5$60c+86%

Läs mer

,QI UDQGHW DY HXURQ NRPPLVVLRQHQ UHGRJ U LQJnHQGH I U I UEHUHGHOVHUQD RFK I UHVOnU WMXJR

,QI UDQGHW DY HXURQ NRPPLVVLRQHQ UHGRJ U LQJnHQGH I U I UEHUHGHOVHUQD RFK I UHVOnU WMXJR ,3 Bryssel den 3 april 2001,QI UDQGHW DY HXURQ NRPPLVVLRQHQ UHGRJ U LQJnHQGH I U I UEHUHGHOVHUQD RFK I UHVOnU WMXJR OlPSOLJDnWJlUGHU GDJDU I UH HXURGDJHQ ODGH NRPPLVVLRQHQ IUDP HWW PHGGHODQGH RP I UEHUHGHOVHUQDI

Läs mer

VECKANS SMÅVINSTER - POSTKOD, 500 kronor vanns av följande postkoder:

VECKANS SMÅVINSTER - POSTKOD, 500 kronor vanns av följande postkoder: Dragningsresultat den 19 juni Här nedan kan du se om du är en av de lyckliga vinnarna i månadens utlottning av vinsterna i Svenska PostkodLotteriet. När du har vunnit betalar vi automatiskt ut dina vinstpengar

Läs mer

Din manual NOKIA STREAMER http://sv.yourpdfguides.com/dref/828662

Din manual NOKIA STREAMER http://sv.yourpdfguides.com/dref/828662 Du kan läsa rekommendationerna i instruktionsboken, den tekniska specifikationen eller installationsanvisningarna för NOKIA STREAMER. Du hittar svar på alla dina frågor i instruktionsbok (information,

Läs mer

Instruktion Syremätare OXY

Instruktion Syremätare OXY Instruktion Syremätare OXY Innehållsförteckning Inledning... 3 Mekanisk installation... 4 Mekanisk installation... 5 Elektrisk installation... 6 Driftsättning, initial uppstart... 8 Kalibrering... 9 Underhåll...

Läs mer

Din manual PIONEER PRS-X320 http://sv.yourpdfguides.com/dref/1234153

Din manual PIONEER PRS-X320 http://sv.yourpdfguides.com/dref/1234153 Du kan läsa rekommendationerna i instruktionsboken, den tekniska specifikationen eller installationsanvisningarna för PIONEER PRS-X320. Du hittar svar på alla dina frågor i PIONEER PRS-X320 instruktionsbok

Läs mer

Grattis Yvonne Augustin

Grattis Yvonne Augustin 5HJLRQEXOOHWLQHQ Nyhetsbrev för socialdemokraterna i Region Skåne Nr 16 vecka 19 år 2008 Grattis Yvonne Augustin Socialdemokraterna i Region Skåne: - Bakåtsträvande taktik att avskaffa akutläkarbilarna!

Läs mer

Användarhandbok. Xperia P TV Dock DK21

Användarhandbok. Xperia P TV Dock DK21 Användarhandbok Xperia P TV Dock DK21 Innehåll Inledning...3 TV Dock baksida, översikt...3 Komma igång...4 LiveWare -hanteraren...4 Uppgradera LiveWare -hanteraren...4 Använda TV Dock...5 Ladda telefonen...5

Läs mer

HBZ montageanvisning (1/5)

HBZ montageanvisning (1/5) HBZ montageanvisning (1/5) Säkerhetsupplysningar Montering av fästkrok Bryt inkommande spänning innan installationen påbörjas. Anslutande ledningar måste vara spänningslösa vid installationen. Kontrollera

Läs mer

DVCompact. Tillufts-/frånluftsaggregat

DVCompact. Tillufts-/frånluftsaggregat Tillufts-/frånluftsaggregat Dokument översatt från engelska 2083831-SE 2014-02-20 A001 Innehåll 1 Intyg om överensstämmelse... 1 2 Varningar... 2 3 Produktbeskrivning... 3 3.1 Allmänt... 3 3.2 Tekniska

Läs mer

USB simkortshållare för mobiltelefon, till MEMOplanner

USB simkortshållare för mobiltelefon, till MEMOplanner Bruksanvisning USB simkortshållare för mobiltelefon, till MEMOplanner Art. nr. 462 623 Rev C SE USB simkortshållare för mobiltelefon Med hjälp av USB simkortshållare kan SMS-meddelanden skickas från Memoplanner.

Läs mer

Produkt. MASTER LEDspot LV AR111

Produkt. MASTER LEDspot LV AR111 03, Mars 6 Produkt MASTER LEDspot LV AR Med sin varma halogenliknande accentstråle är MASTER LEDspot AR en idealisk retrofit lösning för spot- och allmänbelysning inom hotell, restaurang och butik. Den

Läs mer

Bruksanvisning Multimeter Elma 805 / Elma 807

Bruksanvisning Multimeter Elma 805 / Elma 807 Bruksanvisning Multimeter Elma 805 / Elma 807 Elma 805/807 sida 1 INNEHÅLLSFÖRTECKNING 1) Säkerhet... 2 Föreskriften IEC1010 Överspänningskategori... 2 2) EMC Direktivet... 3 3) Instrument beskrivning...

Läs mer

Boka mobilt med WAP! Så fungerar dagsvyn 7 Så fungerar bokningssidan 8 Så fungerar informationssidan 11

Boka mobilt med WAP! Så fungerar dagsvyn 7 Så fungerar bokningssidan 8 Så fungerar informationssidan 11 Boka mobilt med WAP! Innehållsförteckning Mobilt Internet med WAP 2 Hur får man igång det? 3 Så loggar du in i systemet 4 Så väljer du dag och objekt 5 Så fungerar dagsvyn 7 Så fungerar bokningssidan 8

Läs mer

Användarmanual. UV-handlampa 97050/97051

Användarmanual. UV-handlampa 97050/97051 Användarmanual UV-handlampa 97050/97051 Innehåll Svenska 1 Var vänlig observera följande...3 1.1 Viktigt...3 1.2 Medföljande delar...3 1.3 Säkerhet...3 1.4 Användning...3 2 Beskrivning...4 3 Tekniska data...4

Läs mer

Miljökonsekvensbeskrivning

Miljökonsekvensbeskrivning D: F8-/A A: 6--4 Ju O J-N M c - MK u Vh M U T R ED N I N G A T ER N AT I V. f f N ch N h f h. f h f. M N ch K u f Ö f Å ch K. f N ch h f. D. J ch f. N f c. u f. D,, ch h f. Mf h. D f u u uuu. V f u f.

Läs mer

Adobe Photoshop Album Starter Edition 3.0

Adobe Photoshop Album Starter Edition 3.0 Adobe Photoshop Album Starter Edition 3.0 INGEN GARANTI Tredjepartsprogrammen som levereras med enheten kan ha skapats av och ägas av personer eller företag som inte är dotterbolag till Nokia eller till

Läs mer

Sätt i SIM-kortet och sätt fast batteriet på telefonen innan du påbörjar laddningen. Anslut laddaren till ett nätuttag och sedan till telefonen.

Sätt i SIM-kortet och sätt fast batteriet på telefonen innan du påbörjar laddningen. Anslut laddaren till ett nätuttag och sedan till telefonen. Viktig information om batterier Det kan ta upp till 30 minuter för ett nytt batteri att börja laddas. Sätt i SIM-kortet och sätt fast batteriet på telefonen innan du påbörjar laddningen. Anslut laddaren

Läs mer

WebAccess och dess moduler

WebAccess och dess moduler V8-10 för ECL Comfort 200 / 300 Beskrivning WebAccess-satsen möjliggör: Fjärrövervakning och styrning via Internet / Intranet Konfigureringsbara larminställningar och meddelanden till externa mottagare

Läs mer

SEK Handbok 449 Utgåva 1

SEK Handbok 449 Utgåva 1 Potentialutjämning i industriella elanläggningar SEK Handbok 449 Utgåva 1 SEK Handbok 449 Utgåva 1 Mars 2009 Potentialutjämning i industriella elanläggningar En handbok utgiven av SEK Svensk Elstandard.

Läs mer

Det svenska sökbeteendet 2013

Det svenska sökbeteendet 2013 Det svenska sökbeteendet 2013 Webbenkät i 11 år Ca 4 500 respondenter 55 frågor Största undersökningen i sitt slag i Sverige Vi kan bryta ut statistiken per ort, kön, ålder, utbildning etc. Vi tar vårt

Läs mer

Användarhandbok. Stereomikrofon STM10

Användarhandbok. Stereomikrofon STM10 Användarhandbok Stereomikrofon STM10 Innehåll Basinformation...3 Funktioner översikt...3 Maskinvara översikt...3 Montering...4 Använda mikrofonen...5 Spela in ljud...5 Spela in ljud för videor...8 Juridisk

Läs mer

EMC vad é de? Magnus Stridsman. Säkerhetschef Medicinsk Teknik Östergötland Ledamot TK 62 / MT 23

EMC vad é de? Magnus Stridsman. Säkerhetschef Medicinsk Teknik Östergötland Ledamot TK 62 / MT 23 EMC vad é de? Magnus Stridsman Säkerhetschef Medicinsk Teknik Östergötland Ledamot TK 62 / MT 23 E-fält (teori) Maxwells andra ekvation Termer Elektromagnetisk kompabilitet (EMC) En eller flera apparaters

Läs mer

FÖRETAGSPRESENTATION STARS AND STRIPES TRADEMARK AB

FÖRETAGSPRESENTATION STARS AND STRIPES TRADEMARK AB FÖRETAGSPRESENTATION STARS AND STRIPES TRADEMARK AB Inledning BAKGRUND Sveriges nyaste sportbar bjuder på en fantastisk miljö, som är inrett i en varm och modern stil. Med flera TV-skärmar än någonsin

Läs mer

Uppgradera Digital SLR-kamerans firmware

Uppgradera Digital SLR-kamerans firmware Uppgradera Digital SLR-kamerans firmware Tack för att du valde en Nikon-produkt. Denna handbok beskriver hur du utför firmwareuppgraderingen. Om du känner dig osäker kan du överlåta uppdateringen till

Läs mer

Säker på Taket. Taksäkerhetsprodukter från

Säker på Taket. Taksäkerhetsprodukter från Säker på Taket Prislista Taksäkerhetsprodukter från Lathund löpmeterpriser Räcke, snörasskydd och takbrygga baserat på 24 meter. Skyddsräcke / st. Takstegar på 4,5 meter. Varmförzinkat Lackerat 1-rör 3-rör

Läs mer

Användarhandbok för Nokia Musikställ MD Utgåva 1

Användarhandbok för Nokia Musikställ MD Utgåva 1 Användarhandbok för Nokia Musikställ MD-1 9235760 Utgåva 1 KONFORMITETSDEKLARATION Vi, NOKIA CORPORATION, tillkännager under vårt ensamma ansvar att produkten MD-1 uppfyller villkoren i följande EU-direktiv:

Läs mer

Din manual SONY ERICSSON T250I http://sv.yourpdfguides.com/dref/820457

Din manual SONY ERICSSON T250I http://sv.yourpdfguides.com/dref/820457 Du kan läsa rekommendationerna i instruktionsboken, den tekniska specifikationen eller installationsanvisningarna för SONY ERICSSON T250I. Du hittar svar på alla dina frågor i instruktionsbok (information,

Läs mer

Snabbguide Konftel 55Wx

Snabbguide Konftel 55Wx SVENSKA Snabbguide Konftel 55Wx Konftel 55Wx är en konferensenhet som kan anslutas till din bordstelefon, mobiltelefon och dator. Den omvandlar dina kommunikationsverktyg till konferenstelefoner med Konftels

Läs mer

2.7$*21(1. +DQGOHGQLQJ I U WLOOlPSQLQJ Sn HQVNLOGD RUJDQLVDWLRQHU. (1 0(72' )g5.$3$&,7(76%('g01,1* 3HWHU :LQDL $QGHUV,QJHOVWDP -XQL 5334

2.7$*21(1. +DQGOHGQLQJ I U WLOOlPSQLQJ Sn HQVNLOGD RUJDQLVDWLRQHU. (1 0(72' )g5.$3$&,7(76%('g01,1* 3HWHU :LQDL $QGHUV,QJHOVWDP -XQL 5334 2.7$*21(1 (1 0(72' )g5.$3$&,7(76%('g01,1* +DQGOHGQLQJ I U WLOOlPSQLQJ Sn HQVNLOGD RUJDQLVDWLRQHU 3HWHU :LQDL $QGHUV,QJHOVWDP -XQL 5334 *UlQVRUJDQLVDWLRQHU $%,QWHU0DQDJH ZZZ1JRDE1VH INTRODUKTION 1 Syftet

Läs mer

FlexShade B20 XD Rullgardin / Manuell. 25 mar 2013, 11:03 B20 XD. Monteringsanvisning

FlexShade B20 XD Rullgardin / Manuell. 25 mar 2013, 11:03 B20 XD. Monteringsanvisning 25 mar 2013, 11:03 FlexShade B20 XD B20 XD Monteringsanvisning Tack för att ni valt Draper Solskyddssytem! Vi hoppas ni ska vara nöjda med ert val och att produkten skänker precis den solskyddseffekt som

Läs mer

BaanERP Referenshandbok

BaanERP Referenshandbok BaanERP Referenshandbok Copyright 1998 Baan Development B.V. The Netherlands Informationen i det här dokumentet kan ändras utan föregående varning. Ingen del av det här dokumentet får återges, lagras eller

Läs mer

DAGLIGA VINSTER - POSTKOD, 500 kronor vanns av följande postkoder:

DAGLIGA VINSTER - POSTKOD, 500 kronor vanns av följande postkoder: Dragningsresultat den 14 mars Här nedan kan du se om du är en av de lyckliga vinnarna i månadens utlottning av vinsterna i Svenska PostkodLotteriet. När du har vunnit betalar vi automatiskt ut dina vinstpengar

Läs mer

Fiska i Norrbottens fjällvatten. Välkommen till Norrbottensfjällen! Fiska i Arjeplog. Arjeplogskortet

Fiska i Norrbottens fjällvatten. Välkommen till Norrbottensfjällen! Fiska i Arjeplog. Arjeplogskortet skortet 2014 I länet är landets samtliga större nationalparker och UNESCO:s världsarvsområde, Laponia, belägna. Laponia är ett 9 400 km² stort område med höga natur- och kulturvärden där sju samebyar lever

Läs mer

Bruksanvisning - S. Screening Audiometer AS208

Bruksanvisning - S. Screening Audiometer AS208 Bruksanvisning - S Screening Audiometer AS208 Datum: 1998-01-19 1/5 Avsedd användning AS208 undersökningsaudiometer är konstruerad att vara en apparat för undersökning av dövhet. Denna apparats utdata

Läs mer

Bruksanvisning Svensk. Larmenhet & Sensorplåster

Bruksanvisning Svensk. Larmenhet & Sensorplåster Bruksanvisning Svensk Larmenhet & Sensorplåster Bruksanvisning Larmenhet & Sensorplåster Svensk version 2009 Redsense Medical AB Box 287 301 07 Halmstad www.redsensemedical.com RM-1-RM014 Innehåll Varningar

Läs mer

ORO FÖR PERSONLIG INTEGRITET PÅ NÄTET ANNIKA BERGSTRÖM

ORO FÖR PERSONLIG INTEGRITET PÅ NÄTET ANNIKA BERGSTRÖM ORO FÖR PERSONLIG INTEGRITET PÅ NÄTET ANNIKA BERGSTRÖM Förklaringsfaktorer till oro vid användning Egen erfarenhet av internet och olika digitala applikationer Personliga karaktäristika som kön, ålder

Läs mer

,QUH PDUNQDGHQ.RPPLVVLRQHQ ODQVHUDU JUDWLVWMlQVWHU I U UnGJLYQLQJ RFK SUREOHPO VQLQJ I U HQVNLOGDRFKI UHWDJ

,QUH PDUNQDGHQ.RPPLVVLRQHQ ODQVHUDU JUDWLVWMlQVWHU I U UnGJLYQLQJ RFK SUREOHPO VQLQJ I U HQVNLOGDRFKI UHWDJ ,3 Bryssel den 22 juli 2002,QUH PDUNQDGHQ.RPPLVVLRQHQ ODQVHUDU JUDWLVWMlQVWHU I U UnGJLYQLQJ RFK SUREOHPO VQLQJ I U HQVNLOGDRFKI UHWDJ +DU GX SUREOHP PHG DWW In HQ H[DPHQ JRGNlQG HOOHU DWW VNDIID GLJ VRFLDOI

Läs mer

SmartDock for Xperia ion Användarhandbok

SmartDock for Xperia ion Användarhandbok SmartDock for Xperia ion Användarhandbok Innehåll Inledning...3 SmartDock-översikt...3 Ladda med SmartDock...3 Komma igång...5 LiveWare -hanteraren...5 Uppgradera LiveWare -hanteraren...5 Välja ett startprogram...5

Läs mer

Guide för AirPrint. Den här dokumentationen gäller bläckstrålemodeller. Version B SWE

Guide för AirPrint. Den här dokumentationen gäller bläckstrålemodeller. Version B SWE Guide för AirPrint Den här dokumentationen gäller bläckstrålemodeller. Version B SWE Tillämpliga modeller Den här guiden gäller följande modeller. DCP-J40DW, MFC-J430DW/J440DW/J450DW/J460DW/J470DW Definitioner

Läs mer

Family Terrassmarkis. 31 maj 2013, 11:05. Family. Monteringsanvisning

Family Terrassmarkis. 31 maj 2013, 11:05. Family. Monteringsanvisning 31 maj 2013, 11:05 Family Family Monteringsanvisning Tack för att ni valt Draper Solskyddssytem! Vi hoppas ni ska vara nöjda med ert val och att produkten skänker precis den solskyddseffekt som ni förväntat

Läs mer

Teknisk specifikation

Teknisk specifikation Teknisk specifikation APP 700/APX 700 Styr- och övervakningsenheter 97019_01 Data Produkt APP 700/APX 700-serien är särskilt utformad för avloppsoch renvattensystem, både vad gäller konstruktion och funktionalitet.

Läs mer

Utskrift online 4.0. Utgåva 1

Utskrift online 4.0. Utgåva 1 Utskrift online 4.0 Utgåva 1 2008 Nokia. Alla rättigheter förbehållna. Nokia, Nokia Connecting People och Nseries är varumärken eller registrerade varumärken som tillhör Nokia Corporation. Nokia tune är

Läs mer

Value of audit trails as evidence 1

Value of audit trails as evidence 1 Value of audit trails as evidence 1 Per Falk & Roger Lindblom Department of Computer and System Sciences Stockholm University / Royal Institute of Technology February 2005 Abstract Within crime investigations

Läs mer

IT-INFRASTRUKTURPROGRAM FÖR FALKENBERGS KOMMUN 2001-12-13

IT-INFRASTRUKTURPROGRAM FÖR FALKENBERGS KOMMUN 2001-12-13 IT-INFRASTRUKTURPROGRAM FÖR FALKENBERGS KOMMUN 2001-12-13 FALKENBERGS KOMMUN 2001-12 13 Ekonomienheten Vår ref: Thorbjörn Larsson 2 IT-infrastrukturprogram för Falkenbergs kommun. Kommunens policy i IT-frågor.

Läs mer

Tillfälliga elanläggningar

Tillfälliga elanläggningar Tillfälliga elanläggningar Vägledning vid planering, utförande och underhåll SEK Handbok 415 Utgåva 2.1 SEK Handbok 415 Utgåva 2.1 September 2007 Tillfälliga elanläggningar Vägledning vid planering, utförande

Läs mer

Aastra 6731i fast IP-telefon i 3Växel.

Aastra 6731i fast IP-telefon i 3Växel. Aastra 67i fast IP-telefon i Växel. För att använda Softphone i dator och mobil samt i fasta IP-telefoner behöver du skaffa tilläggstjänsten Softphone. När du har det kan du använda alla IP-telefonitjänster

Läs mer

eberspächer värmare A WORLD OF COMFORT ES_GSM_Install_135x170.indd 1 2012-03-28 12.20

eberspächer värmare A WORLD OF COMFORT ES_GSM_Install_135x170.indd 1 2012-03-28 12.20 Fordonsvärmare Teknisk dokumentation se monteringsanvisning Easysta gsm tc 202 TeLefonstyrning för eberspächer värmare A WORLD OF COMFORT ES_GSM_Install_135x170.indd 1 2012-03-28 12.20 2 Fordonsvärmare

Läs mer

Riktlinjer och tillverkardeklaration Elektromagnetiska emissioner & immunitet

Riktlinjer och tillverkardeklaration Elektromagnetiska emissioner & immunitet Riktlinjer och tillverkardeklaration Elektromagnetiska emissioner & immunitet Svenska Sidan AirSense 10 AirCurve 10 1-3 S9 Serie 4-6 Stellar 7-9 ApneaLink ApneaLink Plus ApneaLink Air 10-12 S8 y S8 Serie

Läs mer

Handbok för Din Turs mobila tjänster - för äldre mobiler som inte är smartphones

Handbok för Din Turs mobila tjänster - för äldre mobiler som inte är smartphones Handbok för Din Turs mobila tjänster - för äldre mobiler som inte är smartphones Innehåll Innan du startar...1 Komma igång med programmet MobiTime...1 Ladda ned tidtabeller... 4 Uppdatera tidtabeller...7

Läs mer

Meddelandeblad. Mobiltelefoni och annan radiokommunikation på sjukhus

Meddelandeblad. Mobiltelefoni och annan radiokommunikation på sjukhus Meddelandeblad Mottagare: Hälso och sjukvården Oktober 2003 Mobiltelefoni och annan radiokommunikation på sjukhus Socialstyrelsens rådgivande nämnd för medicinteknisk säkerhet har i tidigare meddelandeblad

Läs mer

Icarus Skicka SMS via GSM-modem.

Icarus Skicka SMS via GSM-modem. Icarus Skicka SMS via GSM-modem. Rev 1.20, Keylogic AB, 2014-07-03. GSM modemet Keylogic AB säljer modem av märket Indunium. Modemet levereras med en antenn med ca 1m kabel. Anslutningen är RS232. Strömadapter

Läs mer

SNABBGUIDE FÖR MODEM OPTIONS FOR NOKIA 7650

SNABBGUIDE FÖR MODEM OPTIONS FOR NOKIA 7650 SNABBGUIDE FÖR MODEM OPTIONS FOR NOKIA 7650 Copyright 2002 Nokia. Alla rättigheter förbehållna 9354489 Issue 2 Innehåll 1. INLEDNING...1 2. INSTALLERA MODEM OPTIONS FOR NOKIA 7650...1 3. ANVÄNDA TELEFONEN

Läs mer

Nokia Trådlöst laddningsställ DT-910 Användarhandbok

Nokia Trådlöst laddningsställ DT-910 Användarhandbok Nokia Trådlöst laddningsställ DT-910 Användarhandbok Utgåva 1.1 2 Om din trådlösa laddare Med Nokia Trådlöst laddningsställ DT-910 kan du ladda din telefon trådlöst. Placera bara telefonen på laddaren

Läs mer

Information om utgåvan. Information om licens. Säkerhetsinformation. Var försiktig! och varningar. Information om elektronisk strålning

Information om utgåvan. Information om licens. Säkerhetsinformation. Var försiktig! och varningar. Information om elektronisk strålning om utgåvan Varumärken om licens Säkerhetsinformation Var försiktig! och varningar om elektronisk strålning Energy Star om laser 1 om utgåvan 2 Maj 2001 Följande stycke gäller inte i länder där sådana bestämmelser

Läs mer

Handbok för Energimyndighetens e-tjänster

Handbok för Energimyndighetens e-tjänster Handling Datum 1 (13) Handbok för s e-tjänster EM4500 W-4.0, 2010-11-22 Handling Datum 2 (13) Innehåll 1 Inledning 3 2 Att logga in 4 2.1 Logga in med mobilt BankID... 5 2.2 Logga in med BankID på fil...

Läs mer

Användarhandbok. T280i. This is the Internet version of the User's guide. Print only for private use.

Användarhandbok. T280i. This is the Internet version of the User's guide. Print only for private use. Användarhandbok T280i Tack för att du valde en Sony Ericsson T280i. Mer telefoninnehåll finns på www.sonyericsson.com/fun. Registrera dig nu, så får du tillgång till gratis onlinelagringsutrymme och specialerbjudanden

Läs mer

C45. Vad säger din telefon om dig? Be inspired. Hitta ditt eget uttryck med färger, ringsignaler och bilder

C45. Vad säger din telefon om dig? Be inspired. Hitta ditt eget uttryck med färger, ringsignaler och bilder 0437-01-JWT C45 Leaflet_S 20.09.2001 18:48 Uhr Seite 12 Vad säger din telefon om dig? Teknisk profil Mått 109 x 46 x 23 mm (L xb x H) Volym 82 cm 3 Vikt Passningstid Taltid Batteri 107 gram Upp till 220

Läs mer

www.vaggmaterial.se Tel 0300-56 38 88

www.vaggmaterial.se Tel 0300-56 38 88 sta lagret spackel SPK RIM SJäLVhäFTNE hörnsky FÖR GIPSSkIVOR PO7H - P1H - P12H - en exklusva Ta slätar ut båda desgn enkel re a skyddet tll Telefon: 3-56 an av skyddet. pruta. let aktverats. Känn ska

Läs mer

Dagordning. Pågående planering Information om kommunalt VA Hur påverkar VA utbyggnaden fastighetsägaren? Information om avgifter mm Frågor

Dagordning. Pågående planering Information om kommunalt VA Hur påverkar VA utbyggnaden fastighetsägaren? Information om avgifter mm Frågor Daordi Pååede plaeri Iformatio om kommualt VA Hur påverkar VA utbyade fastihetsäare? Iformatio om avifter mm Fråor Pååede plaeri yv ä V ä yv sb ä l v ä me sb y lv Ka a d ö T3 by rs kv ä E ä rsb å e l v

Läs mer

Bruksanvisning Mobil Slaggrind Thor

Bruksanvisning Mobil Slaggrind Thor Bruksanvisning Mobil Slaggrind Thor Innehåll 1. EG-försäkran om överensstämmelse... 4 2. Inledning... 5 2.1 Tillverkare... 5 2.2 Typbeteckning... 5 2.3 Märkning... 5 2.4 Avsedd användning... 5 2.5 Referensdokument...

Läs mer

$1;%UDQGODUPFHQWUDO. 6N WVHORFKXQGHUKnOOVLQVWUXNWLRQ (OWHN$%

$1;%UDQGODUPFHQWUDO. 6N WVHORFKXQGHUKnOOVLQVWUXNWLRQ (OWHN$% $1;%UDQGODUPFHQWUDO 6N WVHORFKXQGHUKnOOVLQVWUXNWLRQ 27631B42.GEM Utgåva 3 Aug 1998 (OWHN$% $GUHVV 7HOHIRQ 7HOHID[ (PDLO 2UJQU Möllersvärdsgatan 12 019-12 20 60 018-12 20 35 fire.safety@eltek.se 556345-9899

Läs mer

Användarmeddelande (november 2015) Ny programversion. FLEX Lön. Version 16.1a

Användarmeddelande (november 2015) Ny programversion. FLEX Lön. Version 16.1a Användarmeddelande (november 2015) Ny programversion FLEX Lön Version 16.1a Bäste kund! På följande sidor kan du läsa om de nyheter som har tillkommit i FLEX Lön i version 16.1a. Bland nyheterna kan nämnas

Läs mer

STRUKTURSKISS - Helhetssyn på Campusområdet med omgivningar

STRUKTURSKISS - Helhetssyn på Campusområdet med omgivningar STRUKTURSKISS - Hlhy på Cpuåd d ii Udl fö fid blu i lik få J 2006 Gdkäd Kuyl 2006-01-25 Hållb häll li 1 ukui - Hlhy på Cpuåd d ii Udl fö fid blu i lik få Uppd D ld hökl bli i Cpu i Tllhä äll k på låiki,

Läs mer

Handbok för Energimyndighetens e-tjänster

Handbok för Energimyndighetens e-tjänster EM4500 W-4.0, 2010-11-22 Handling Datum 1 (14) Handbok för s e-tjänster Handling Datum 2 (14) Innehåll 1 Inledning 3 2 Att logga in 4 2.1 Logga in med mobilt BankID... 5 2.2 Logga in med BankID på fil...

Läs mer

Hela denna bilaga är en annons från bråviken bil

Hela denna bilaga är en annons från bråviken bil d b ä os få båk b Ö : Ö 1-17 Ö 1-17 5 6 O VÄ P Ö ORR F R Ö Ö Fä Å o Å Ö u F /F X u o F C o ä u F F C Å 2 % ouä öw cz Y Puo å 38 o u b s VÄj P j F Rju R V FRÄ 2, 5% FjP år: kbox hu sbå Pyso V 2 x V-skäm

Läs mer