VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:3. Print - Icakuriren. Webb - icakuriren.se

Save this PDF as:
 WORD  PNG  TXT  JPG

Storlek: px
Starta visningen från sidan:

Download "VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:3. Print - Icakuriren. Webb - icakuriren.se"

Transkript

1 VARUMÄRKESKORT Tertial 2015:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva/ ORVESTO Internet 2015 genomsnittlig dag ORVESTO Konsument 2015:3 genomsnittlig utgåva/ ORVESTO Internet Tertial genomsnittlig dag Bruttoräckvidd / vecka: ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva/ ORVESTO Internet 2015 genomsnittlig vecka ORVESTO Konsument 2015:3 genomsnittlig utgåva/ ORVESTO Internet Tertial genomsnittlig vecka Print - Icakuriren Räckvidd (helår): ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva Räckvidd (tertial): ORVESTO Konsument 2015:3 genomsnittlig utgåva TS-upplaga/utg (helår): TS 2015 RPC: 4,3 Utgåvor / år: 50 Webb - icakuriren.se Räckvidd / dag (helår): Räckvidd / vecka (helår): Räckvidd / dag (tertial): Räckvidd / vecka (tertial): Unika webbläsare / vecka: Besök / vecka: Sidvisningar / vecka: Besök / unika webbläsare: 1,8 Sidvisningar / besök: 1,8 Viewability: Annonsmöjlighet inloggade: ORVESTO Internet 2015 genomsnittlig dag ORVESTO Internet 2015 genomsnittlig vecka ORVESTO Internet Tertial genomsnittlig dag ORVESTO Internet Tertial genomsnittlig vecka OAS Analytics 2015 Tertial 3 genomsnittlig vecka Ja Egen uppgift Nej Egen uppgift All contents of this page are copyright by. All rights reserved.

2 ÖVRIGA ANNONSMÖJLIGHETER Nyhetsbrev - Icakuriren Nyhetsbrev Antal mottagare / utgåva: TS- intyg Tertial Öppnade / utgåva: 14 % CTR: 4 % Periodicitet: 2/vecka Sociala medier Facebook Icakuriren Likes: Engagemang: 100 Tertial Twitter Icakuriren Följare: Snabbfakta (egen uppgift) Icakuriren är en konsumentupplysande familjetidning och skriver om vardagslivet. Tidningen innehåller allt från recept på god och snabblagad mat för veckans alla dagar, råd och tips i konsumentfrågor, resor till världens alla hörn och härlig inspiration för hem och trädgård. Icakuriren.se är precis som tidningen en sajt om allt som hör livet till - både vardag och fest. All contents of this page are copyright by. All rights reserved.

3 TSMediefaktasuppdrag TSMediefaktaharentydliguppgift. TSverkarpåmedieköparnasuppdragoch ReviderarochKvalitetssäkrarÖverenskomnasiffrorföratt skapajämförbarhetimedievalet. FörattutvecklaochsäkerställadebranschöverenskommelsersomliggertillgrundförTSarbeteså verkartsiflerakommittéerochforum. TSMediekommitté medrepresentanterfråntu,sverigestidskrifter,sveriges AnnonsörerochSverigesMediebyråer. SverigesAnnonsörersVerkställandeutskott. DetforumförMediebyråersomTSskapatochträffarochstämmeravmedvia återkommandemöten. Varumärkeskort Påenalltmerfragmentiseradmediemarknad medmånganyaannonsmöjligheter,menockså tydligautmaningariattskapaöverblickochjämförbarhet harts,isamrådmedbranschenochvåra kommittéer,tagitframdetnyaverktygetvarumärkeskortet. Kortethjälpermedieköparnaattfåöverblickochattväljamedjämförbaraochkvalitetssäkradesiffror somgrund.kortetgerocksåmediernaenunik,sammanfattandeochjämförbarmöjlighetattvisaalla deplattformarsomdeagerarpå. Etteffektivtverktygförmedieköparna ochenunikmöjlighetförmediernaattvisasinastyrkorialla plattformar.

4 Definitioner Nettoräckvidd Antalpersoner,netto,ibefolkningen1680årsomläst,tittatpå,lyssnatpånågonavdekanalersom mätsiorvestoochorvestointernetochsomfinnsredovisadeidettavarumärkeskort.dubbeltäckning mellanplattformarnaförekommerinte. Bruttoräckvidd Antalpersoner,brutto,ibefolkningen1680årsomläst,tittatpå,lyssnatpånågonavdekanalersom mätsiorvestoochorvestointernetochsomfinnsredovisadeidettavarumärkeskort.bruttotär därmedsummanavrespektiveräckviddsplattformochinkluderardubbeltäckningmellan plattformarna. Räckvidd Antalpersoner,netto,ibefolkningen1680årsomläst,tittatpå,lyssnatpådenredovisade plattformen. TSupplaga Genomsnittligupplaga. Varavdigitalaexemplar. AndeldigitalaexemplaravTSupplagan.Dedigitalaexemplarenskatillmerän50%haett gemensamtredaktionelltinnehållmeddentrycktatidningenochiövrigtuppfylladefinitionenav tidningenligttsbestämmelser. RPC ReadersPerCopy.Antalläsareperupplagexemplarförföregåendeår.RPC=Räckvidd/TSUpplaga. Betalningsgrad HurstorandelavTSUpplagansomärbetaldtillordinariefulltpris. HHTUtgivningskommun Andelhushålltidningennårinomsinutgivningskommun. Utgåvor/vecka Antalutgåvorpervecka. UnikaWebbläsare Ettgenomsnittavtotaltantalunikawebbläsare(t.ex.InternetExplorer,Safari)perveckaförden aktuellamätperioden.

5 Varavinloggade Andelsomharloggatinpåsajten. Besök Ettgenomsnittavtotaltantalbesökperveckafördenaktuellamätperioden. Sidvisningar Genomsnittligtantalsidvisningarperveckafördenaktuellamätperioden.Ensidvisninguppstårdå besökarengenomaktivhandlingväljerattbesökaensida. Viamobil Andelavbesökaresomkommerviamobil. VaravIOSochAndroid AndelavbesökaresomanvänderIOSrespektiveAndroid. Timespent Genomsnittligtidperbesökunderaktuellmätperiod.Besökaresombarabesökerensida(s.k.single pagevisits)exkluderasurmätningen. Viewability (Ja/Nej) Finnsmöjlighetenattfåinformationomhurstorandelavannonsensomharvaritsynlig. Startadeströmmar AntaletvisningaravwebbTV.TVklippetmåstehastartatsgenomenaktivhandling,vilketinnebär attautomatisktstartadewebbtvklippejkanmedräknas.

6 VASTComplete TheIAB svideoadservingtemplate(vast)äreninternationellxmlspecifikation/standardvid WebbTVannonsering.Redovisartrafikperkvartil. Frekvensstyrning(Ja/Nej) Finnsmöjlighetattstyrahuroftaenannonssynsienåterkommandebesökaresflöde. Annonsmöjlighetinloggade Finnsmöjlighetattannonserapådelaravsajtensomendastsynsförbesökaresomharloggatin. RSdistribution Antaldistribueradeexemplarigenomsnittunderdenaktuellamätperioden. QRSIndex Sammanvägtindexöverhurmycket,huroftaochhurlängeentidskriftanvänds.Genomsnittligtindex församtligatidningarsomingickvidmättillfälletär100. Facebook(pagelikes) Totaltantalföljare (gilla-markeringar) för en facebooksidavidettvisstdatum. Facebook (Engagemang) Genomsnittligt antal, per vecka, gilla-markeringar, delningar och kommentarer för den aktuella Facebooksidan för aktuell mätperiod. Twitter(följare) Totaltantalprenumeranterpåmeddelandeflödenvidettvisstdatum. CTR(Clickthroughrate)förepost Antaletklickrelaterattillantaletutskickade ,dvs.hurstorandelklickarsigvidarefråneposten tillenwebbsida.

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2016:1. Print - Allt om Mat. Webb - alltommat.se

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2016:1. Print - Allt om Mat. Webb - alltommat.se VARUMÄRKESKORT Tertial 2016:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 499 200 ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva/ ORVESTO Internet 2015 genomsnittlig dag 470 800 ORVESTO Konsument 2016:1

Läs mer

Källa och period. Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min

Källa och period. Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min VARUMÄRKESKORT Tertial 2015:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 499 200 ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva/ ORVESTO Internet 2015 genomsnittlig dag 482 700 ORVESTO Konsument 2015:3

Läs mer

Källa och period. TS-upplaga/utg (helår): 22 600 TS 2015 RPC: 2,7 Betalningsgrad: 95 % HHT utgivningskommun: 50 % TS 2015 Utgåvor / vecka: 6

Källa och period. TS-upplaga/utg (helår): 22 600 TS 2015 RPC: 2,7 Betalningsgrad: 95 % HHT utgivningskommun: 50 % TS 2015 Utgåvor / vecka: 6 VARUMÄRKESKORT Tertial 2015:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 62 000 ORVESTO Konsument 2015:HELÅR genomsnittlig / ORVESTO Internet 2015 genomsnittlig dag 62 000 ORVESTO Konsument 2015:3 genomsnittlig

Läs mer

Källa och period. TS-upplaga/utg (helår): 12 800 TS 2014 Utgåvor / år: 11

Källa och period. TS-upplaga/utg (helår): 12 800 TS 2014 Utgåvor / år: 11 VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Print - Arkitekten TS-upplaga/utg (helår): 12 800 TS 2014 Utgåvor / år: 11 Webb Unika webbläsare / vecka: Besök / vecka: 10 200 Sidvisningar / vecka:

Läs mer

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:2. Print

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:2. Print VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 163 100 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 131 900 Print Länstidningen Östersund Räckvidd: 25 000 ORVESTO Konsument

Läs mer

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:2. Print

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:2. Print VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 114 200 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 100 100 Print Hudiksvalls Tidning Räckvidd: 25 000 ORVESTO Konsument

Läs mer

Källa och period. Räckvidd / dag: 18 900 Orvesto Internet Tertial 1 2015 Räckvidd / vecka: 61 300. Räckvidd / dag: Räckvidd / vecka:

Källa och period. Räckvidd / dag: 18 900 Orvesto Internet Tertial 1 2015 Räckvidd / vecka: 61 300. Räckvidd / dag: Räckvidd / vecka: VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 71 900 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 64 000 Print - Södermanlands Nyheter Räckvidd: 53 000 ORVESTO Konsument

Läs mer

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:1. Print - Svensk Jakt. Webb+Mobil - svenskjakt.se

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:1. Print - Svensk Jakt. Webb+Mobil - svenskjakt.se VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 232 000 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 232 000 Print - Svensk Jakt Mått Källa och period Räckvidd: 232

Läs mer

Bruttoräckvidd / dag: 50 000 ORVESTO Konsument Nettoräckvidd / dag: 50 000. Källa och period. Räckvidd / dag: Räckvidd / vecka:

Bruttoräckvidd / dag: 50 000 ORVESTO Konsument Nettoräckvidd / dag: 50 000. Källa och period. Räckvidd / dag: Räckvidd / vecka: VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 50 000 ORVESTO Konsument Nettoräckvidd / dag: 50 000 Print - Dagens ETC Räckvidd: 50 000 ORVESTO Konsument 2015:1 genomsnittlig

Läs mer

Källa och period. TS-upplaga/utg (helår): 38 200 TS 2014

Källa och period. TS-upplaga/utg (helår): 38 200 TS 2014 VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 161 800 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 139 200 Print Arbetarbladet Räckvidd: 44 000 ORVESTO Konsument 2015:1

Läs mer

Källa och period. TS-upplaga/utg (helår): 7 900 TS 2014 Varav digitala ex (helår): 1 100 TS (Varav digital publikation) 2014 Utgåvor / år: 8

Källa och period. TS-upplaga/utg (helår): 7 900 TS 2014 Varav digitala ex (helår): 1 100 TS (Varav digital publikation) 2014 Utgåvor / år: 8 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Print - Arkitektur TS-upplaga/utg (helår): 7 900 TS 2014 Varav digitala ex (helår): 1 100 TS (Varav digital publikation) 2014 Utgåvor / år: 8 Webb+Mobil

Läs mer

Källa och period. Räckvidd / dag: 43 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 117 800

Källa och period. Räckvidd / dag: 43 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 117 800 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 103 900 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 86 600 Print - Östersunds-Posten Räckvidd: 49 000 ORVESTO Konsument

Läs mer

Källa och period. Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min. Räckvidd / dag: 41 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 222 500

Källa och period. Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min. Räckvidd / dag: 41 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 222 500 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 503 900 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 489 900 Bruttoräckvidd / vecka: 684 500 Nettoräckvidd / vecka: 618

Läs mer

Bruttoräckvidd / dag: 101 000 ORVESTO Konsument Nettoräckvidd / dag: 101 000. Källa och period. Läsmängd: 81,4 % Lästillfällen: 3,0 Lästid: 1,38 tim

Bruttoräckvidd / dag: 101 000 ORVESTO Konsument Nettoräckvidd / dag: 101 000. Källa och period. Läsmängd: 81,4 % Lästillfällen: 3,0 Lästid: 1,38 tim VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 101 000 ORVESTO Konsument Nettoräckvidd / dag: 101 000 Print - Filter Räckvidd: 101 000 ORVESTO Konsument 2015:2 genomsnittlig utgåva

Läs mer

Källa och period. Läsmängd: 78,9 % Lästillfällen: 2,1 Lästid: 53 min. Räckvidd / dag: 68 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 204 800

Källa och period. Läsmängd: 78,9 % Lästillfällen: 2,1 Lästid: 53 min. Räckvidd / dag: 68 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 204 800 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 160 900 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 157 300 Bruttoräckvidd / vecka: 296 800 Nettoräckvidd / vecka: 279

Läs mer

Källa och period. Läsmängd: 72,4 % Lästillfällen: 1,9 Lästid: 39 min

Källa och period. Läsmängd: 72,4 % Lästillfällen: 1,9 Lästid: 39 min VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 235 200 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 228 600 Bruttoräckvidd / vecka: 331 500 Nettoräckvidd / vecka: 304

Läs mer

Källa och period. Läsmängd: 83,9 % Lästillfällen: 3,2 Lästid: 59 min. Räckvidd / dag: 33 800 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 152 000

Källa och period. Läsmängd: 83,9 % Lästillfällen: 3,2 Lästid: 59 min. Räckvidd / dag: 33 800 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 152 000 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 276 800 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 271 200 Bruttoräckvidd / vecka: 395 000 Nettoräckvidd / vecka: 364

Läs mer

Källa och period. TS-upplaga/utg (helår): 5 800 TS 2014 Varav digitala ex (helår): 300 Utgåvor / år: 6

Källa och period. TS-upplaga/utg (helår): 5 800 TS 2014 Varav digitala ex (helår): 300 Utgåvor / år: 6 VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Print - Form, Magasin för Nordisk Arkitektur och Design Mått Källa och period TS-upplaga/utg (helår): 5 800 TS 2014 Varav digitala ex (helår): 300 Utgåvor

Läs mer

Bruttoräckvidd / dag: 643 000 Nettoräckvidd / dag: 507 000 Orvesto Total Tertial 3 2014. Källa och period

Bruttoräckvidd / dag: 643 000 Nettoräckvidd / dag: 507 000 Orvesto Total Tertial 3 2014. Källa och period VARUMÄRKESKORT Tertial 2014:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 643 000 Nettoräckvidd / dag: 507 000 Orvesto Total Tertial 3 2014 Print - Dagens industri Räckvidd: 328 000 Orvesto Konsument 2014:3

Läs mer

1 836 000 (genomsnittlig dag) 2 234 300 (genomsnittlig dag)

1 836 000 (genomsnittlig dag) 2 234 300 (genomsnittlig dag) TERTIAL 2 2014 RÄCKVIDDSPLATTFORMAR Expressen GT KvP expressen.se Nettoräckvidd: Bruttoräckvidd: 1 836 000 (genomsnittlig dag) 2 234 300 (genomsnittlig dag) Räckvidd 685 000 Orvesto Konsument 2014:2 genomsnittlig

Läs mer

Bruttoräckvidd / dag: 113 000 Nettoräckvidd / dag: 113 000. Källa och period. Läsmängd: 80% Lästillfällen: 3,2 Lästid: 55 min.

Bruttoräckvidd / dag: 113 000 Nettoräckvidd / dag: 113 000. Källa och period. Läsmängd: 80% Lästillfällen: 3,2 Lästid: 55 min. VARUMÄRKESKORT Tertial 2014:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 113 000 Nettoräckvidd / dag: 113 000 Print - Runner s World Mått Källa och period Räckvidd: 113 000 Orvesto Konsument 2014:3 genomsnittlig

Läs mer

Kommunikation i sociala medier

Kommunikation i sociala medier Kommunikation i sociala medier. 2 Tur drabbar bara de skickliga! Hallå? 3 4 Kommunikation 2014 5 Facebook, Twitter, Linkedin, Google+, Tumbler, Wordpress, Youtube, Pinterest, Ello eller Instagram? "Istället

Läs mer

Nå dina kunder nära köp!

Nå dina kunder nära köp! Nå dina kunder nära köp! Vi hjälper dig att nå ditt mål Vill du få kunden att agera direkt, eller vill du profilera ditt varumärke? Oavsett vilket mål du har med din annonsering kan vi hitta en bra lösning

Läs mer

SOFIA FÖRSAMLINGS TRE FÖRSTA ÅR PÅ FACEBOOK

SOFIA FÖRSAMLINGS TRE FÖRSTA ÅR PÅ FACEBOOK SOFIA FÖRSAMLINGS TRE FÖRSTA ÅR PÅ FACEBOOK Rapport av David Rutström om Svenska kyrkan Sofia församlings i Stockholm verksamhet på Facebook för perioden 4 februari 2010 till och med 31 januari 2013. Förord

Läs mer

Facebookmarknadsföring

Facebookmarknadsföring Facebookmarknadsföring Gustav Bergman Kort om Kanban Marketing Google AdWords Facebook Webbyrå Sökmotoroptimering (SEO) gustav.bergman@kanban.se Kort om Kanban Marketing Google AdWords Facebook Webbyrå

Läs mer

Marknad Barntotal.se tillhör marknaden för gravida och mammor med bebis, barn och/eller tonåringar.

Marknad Barntotal.se tillhör marknaden för gravida och mammor med bebis, barn och/eller tonåringar. Slutprojekt Social Media Koordinator 2014 Företag: Barntotal.se Input Affärsmål och visioner Dubbla trafiken inom ett år. Att sidan ska betala sig självt i form av annonser. Utöka det redaktionella innehållet.

Läs mer

jobb & karriär PLATSANNONSER Priser & format för platsannonsering i jobb & karriär & på dagensmedicin.se

jobb & karriär PLATSANNONSER Priser & format för platsannonsering i jobb & karriär & på dagensmedicin.se jobb & karriär 2015 PLATSANNONSER Priser & format för platsannonsering i jobb & karriär & på dagensmedicin.se PLATSANNONSER Nå vårdens samtliga resurser, nyckelpersoner och studerande med din platsannons.

Läs mer

Nya Veckans AffArer VÅRA LÄSARE RÄCKVIDD & UPPLAGA

Nya Veckans AffArer VÅRA LÄSARE RÄCKVIDD & UPPLAGA Nya Veckans AffArer Nya Veckans Affärer är förstahandsvalet för näringslivet: Vi når 70 000 kvalificerade och köpstarka beslutsfattare inom svenskt näringsliv. I Veckans Affärer får de ny kunskap, nya

Läs mer

CONTENT MARKETING. 4 steg som hjälper dig att skapa en träffsäker strategi.

CONTENT MARKETING. 4 steg som hjälper dig att skapa en träffsäker strategi. CONTENT MARKETING 4 steg som hjälper dig att skapa en träffsäker strategi. Vad är nyttan med content marketing? Content marketing handlar om att använda egenproducerat innehåll i din marknadsföring för

Läs mer

2013-03-08. Hej, Här ser ni skillnaden mellan den GAMLA logotypen (t v) och den NYA logotypen (t h) i fyrfärg. Nyhetsbrev mars 2013

2013-03-08. Hej, Här ser ni skillnaden mellan den GAMLA logotypen (t v) och den NYA logotypen (t h) i fyrfärg. Nyhetsbrev mars 2013 Page 1 of 5 Nyhetsbrev mars 2013 Ser du inte nyhetsbrevet? Läs det i din webbläsare. Nyhetsbrev mars 2013 Hej, Här kommer mars månads nyhetsbrev från oss på kontoret. Var vänlig sprid det till alla medlemmar

Läs mer

FRÅGOR OM DITT RESANDE NORMALT Här vill vi att ni svarar hur ni brukar resa, när ni INTE är med i tävlingen Pedal for Medal

FRÅGOR OM DITT RESANDE NORMALT Här vill vi att ni svarar hur ni brukar resa, när ni INTE är med i tävlingen Pedal for Medal Startenkät Pedal for Medal Hej deltagare i Pedal for Medal. Bra cyklat - kul att tävlingen kommit igång på allvar! Denna enkät är ett underlag för att se hur du och ditt lag förbättras under tävlingen.

Läs mer

Koppla ihop intern och extern kommunikation med sociala medier Damra Muminovic och Johanna Snickars

Koppla ihop intern och extern kommunikation med sociala medier Damra Muminovic och Johanna Snickars Koppla ihop intern och extern kommunikation med sociala medier Damra Muminovic och Johanna Snickars Om Europeiska privat och tjänstereseförsäkringar 2 miljoner privatresenärer 1,5 miljoner tjänstereseresenärer

Läs mer

Driva Eget - direktkanalen till Sveriges småföretagare

Driva Eget - direktkanalen till Sveriges småföretagare MEDIAPLAN 2014 Driva Eget - direktkanalen till Sveriges småföretagare - Ökar med 14 % Tidning Sajt Mobil Event FAKTA OM TIDNINGEN Småföretagare 0-10 anställda Når beslutsfattare och VD Utgåvor per år:

Läs mer

Byggindustrin. Sveriges stora byggår. Tidning Webb Nyhetsbrev Mobil 2016 - ÖVERSIKT. Passion för affärer OFFICIELL MÄSSTIDNING NORDBYGG 2016

Byggindustrin. Sveriges stora byggår. Tidning Webb Nyhetsbrev Mobil 2016 - ÖVERSIKT. Passion för affärer OFFICIELL MÄSSTIDNING NORDBYGG 2016 OFFICIELL MÄSSTIDNING NORDBYGG 2016 Byggindustrin Tidning Webb Nyhetsbrev Mobil 2016 - Sveriges stora byggår ÖVERSIKT MÅLGRUPP: Byggsektorn ANTAL läsare: 20 000 Orvesto Näringsliv 2015 Helsida: 34 400

Läs mer

Email: david@davidhallstrom.se

Email: david@davidhallstrom.se David is the founder of 2 companies: Getfound and Pacific Fencing. Through his entrepreneurial career David has helped large corporations like Plan, ANZ Bank, Goodman and RipCurl make more money from the

Läs mer

Sociala medier för företag

Sociala medier för företag Sociala medier för företag EN INTRODUKTION Materialet tillhör Idenfors & Idenfors AB och får användas av dig som kursdeltagare eller prenumerant av vårt nyhetsbrev, men inte kopieras, säljas eller användas

Läs mer

Webbstrategi. Strategi. Fastställt av. Kommunikationsdirektör. Datum för fastställande 2010-12-06. Giltighetstid. Tillsvidare.

Webbstrategi. Strategi. Fastställt av. Kommunikationsdirektör. Datum för fastställande 2010-12-06. Giltighetstid. Tillsvidare. Webbstrategi Strategi Fastställt av Kommunikationsdirektör Datum för fastställande 2010-12-06 Giltighetstid Tillsvidare Ansvarig funktion Kommunikationsdirektör Målgrupp Alla förvaltningar i Sundsvalls

Läs mer

Slutprojekt 2010 Medieinstitutet. Förstudie Hur Icakuriren ska utveckla sin närvaro i sociala medier för att marknadsföra sig på webben

Slutprojekt 2010 Medieinstitutet. Förstudie Hur Icakuriren ska utveckla sin närvaro i sociala medier för att marknadsföra sig på webben Slutprojekt 2010 Medieinstitutet Förstudie Hur Icakuriren ska utveckla sin närvaro i sociala medier för att marknadsföra sig på webben http://www.youtube.com/watch?v=sifypqjyhv8 Problem, syfte och mål

Läs mer

Branding Att äga sitt varumärke Marknadsföring i Sociala Medier för HRT-branschen del 1 Robin Sörbom 2015

Branding Att äga sitt varumärke Marknadsföring i Sociala Medier för HRT-branschen del 1 Robin Sörbom 2015 Branding Att äga sitt varumärke Marknadsföring i Sociala Medier för HRT-branschen del 1 Robin Sörbom 2015 Marknadsföring har under de senaste 20 åren förändrats radikalt i grunden, så även inom HRTbranschen.

Läs mer

MEDIAKIT 2015. Online // Magasin // Email. Vill du nå kunder som älskar kameror och bilder? Annonsera i våra kanaler!

MEDIAKIT 2015. Online // Magasin // Email. Vill du nå kunder som älskar kameror och bilder? Annonsera i våra kanaler! MEDIAKIT 2015 Online // Magasin // Email Vill du nå kunder som älskar kameror och bilder? Annonsera i våra kanaler! Vill du hitta rätt målgrupp och maxa ROI? Genom våra kanaler når du både brett och pricksäkert

Läs mer

Materialet i detta nyhetsbrev är skyddat av upphovsrättslagen Copyright Sveriges Civilförsvarsförbund

Materialet i detta nyhetsbrev är skyddat av upphovsrättslagen Copyright Sveriges Civilförsvarsförbund Nytt från Civilförsvarsförbundet Sverige #1 (utgivningsdag torsdag 29 januari 2015) Kontaktuppgifter: E-post red@civil.se eller Box 2034, 169 02 Solna Materialet i detta nyhetsbrev är skyddat av upphovsrättslagen

Läs mer

98% av de som läser KONTAKTA OSS PÅ ONLINE. www.miljoaktuellt.se. Nå beslutsfattare som investerar i hållbar utveckling!

98% av de som läser KONTAKTA OSS PÅ ONLINE. www.miljoaktuellt.se. Nå beslutsfattare som investerar i hållbar utveckling! Nå beslutsfattare som investerar i hållbar utveckling! MILJÖAKTUELLT är Sveriges största oberoende miljö- och affärsmedia för personer som ska fatta avgörande beslut i omställningen till ett hållbart samhälle.

Läs mer

Mobilsurfande i Sverige

Mobilsurfande i Sverige Mobilsurfande i Sverige 1 Mobilsurfandet i Sverige ökar snabbt. Det är yngre, välutbildade storstadsbor som surfar mest idag, men det är rimligt att anta att också andra grupper inom en snar framtid kommer

Läs mer

Riktlinjer för arbete med sociala medier

Riktlinjer för arbete med sociala medier Kommunledningskontoret Sofia Magnusson, 0531-526003 sofia.magnusson@bengtsfors.se POLICY Antagen av Kommunfullmäktige 2011-05-18 1(5) Riktlinjer för arbete med 2 Inledning Sociala medier är kommunikationskanaler

Läs mer

MEDIAKIT 2014. Online // Magasin // Email. Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler!

MEDIAKIT 2014. Online // Magasin // Email. Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler! MEDIAKIT 2014 Online // Magasin // Email Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler! Vill du hitta rätt målgrupp och maxa ROI? Genom våra kanaler når du både brett och pricksäkert

Läs mer

Utveckling i antal träffar på ordet korvfestivalen i Google under Q1

Utveckling i antal träffar på ordet korvfestivalen i Google under Q1 Hej! Här kommer en kort rapport om hur Korvfestivalen synts i digitala och sociala kanaler under första kvartalet samt fokus på i mars och själva festivalen. Korvfestivalens synlighet i Google under Q1

Läs mer

MEDIAKIT 2015. Online -Magasin - Email. Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler!

MEDIAKIT 2015. Online -Magasin - Email. Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler! MEDIAKIT 2015 Online -Magasin - Email Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler! Vill du hitta rätt målgrupp och maxa ROI? Genom våra kanaler når du både brett och pricksäkert

Läs mer

Mirjamsdotter Media. Internet What s in it for you?

Mirjamsdotter Media. Internet What s in it for you? Internet What s in it for you? Sofia Mirjamsdotter Journalist med erfarenhet från radio, teve, tidning och webb Bloggare sedan 2005 Mamma till tre tonåringar Internetnörd Teknikrädd Jag bloggar Mirjamsdotter

Läs mer

Kommunikationsplan Samiska Apoteket

Kommunikationsplan Samiska Apoteket Kommunikationsplan Samiska Apoteket Kreatörer: Camilla Palm, Johan Skogqvist, Elin Leyonberg, Viyan Ateaa Målgrupp: Kvinnor mellan 35-60, intresserade av, kultur, historia, hälsa och hållbar utveckling.

Läs mer

P R O S P E K T : INFORMATION KRING FÖRSÄLJNING AV EN LAGOM DOS GRÖNT.SE ETT PROSPEKT AV UNITED PATTERN AB

P R O S P E K T : INFORMATION KRING FÖRSÄLJNING AV EN LAGOM DOS GRÖNT.SE ETT PROSPEKT AV UNITED PATTERN AB P R O S P E K T : INFORMATION KRING FÖRSÄLJNING AV EN LAGOM DOS GRÖNT.SE INFORMATION KRING EN LAGOM DOS GRÖNT.SE Del 1: Presentation i korthet Introduktion Position & konkurrenter Bakgrund till prospektet

Läs mer

Platsannonsera med Computer Sweden

Platsannonsera med Computer Sweden Hitta it-proffsen på rätt ställe Platsannonsera med Computer Sweden För att hitta rätt it-kompetens på en tuff marknad är det avgörande att välja rätt kanal för ditt rekryteringsbehov. Vi har över 30 års

Läs mer

Your business is tested every day meeting with customers

Your business is tested every day meeting with customers Your customer You Your competition Your problem Your business is tested every day meeting with customers 2 Everywhere all the time in all aspects 3 1 Copyright 2010 SAS Institute Inc. All rights reserved.

Läs mer

Future City 2014 2015. Så här kan ditt företag delta i Future City:

Future City 2014 2015. Så här kan ditt företag delta i Future City: Så här kan ditt företag delta i Future City: Future City 2014 2015 Guldarrangör, max sex Silverarrangör, max sex Partner Uppsats Partner Minecraft Dela ut ett pris, max tre Supporter Annonsering 100 000

Läs mer

Slutrapport Norgeskampanjen Sverige 2013 Elinor Eriksson Innovasjon Norge

Slutrapport Norgeskampanjen Sverige 2013 Elinor Eriksson Innovasjon Norge Slutrapport Norgeskampanjen Sverige 2013 Elinor Eriksson Innovasjon Norge 1 Parters och fördelning av budget - Norgeskampanjen totalt Totalbudget för kampanjen: 6,6 MNOK Partners: Fjord Norge Nord Norsk

Läs mer

MATTER CONTENT INTEGRATION TOOLS 1.0

MATTER CONTENT INTEGRATION TOOLS 1.0 MATTER CONTENT INTEGRATION TOOLS 1.0 Läsaranalys, Kanalinventering & Benchmark Engagemang. Tre verktyg Matter delar med sig av till Webbdagarnas publik 2015. @MatterHQ (Twitter) matter.se @MatterHQ (Instagram)

Läs mer

Detta whitepaper har t ex hashtag #vadmenasmedhashtags eller #hashtagstrategiforetag Så om du delar detta vidare, ange gärna någon av dessa.

Detta whitepaper har t ex hashtag #vadmenasmedhashtags eller #hashtagstrategiforetag Så om du delar detta vidare, ange gärna någon av dessa. 7 steg för att skapa en Hashtag- strategi för B2B- företag Marketinghouse (källor: Google, Hubspot, Twitter, Instagram och olika bloggar) Detta whitepaper har t ex hashtag #vadmenasmedhashtags eller #hashtagstrategiforetag

Läs mer

Låt Allas bli din lugna stund i vardagen

Låt Allas bli din lugna stund i vardagen Låt Allas bli din lugna stund i vardagen Allas är kreativ, färgstark och mångsidig! Tidningen bjuder på inspirerande recept, intressant läsning, hälsa och roligt mode men också skön avkoppling mitt i veckan.

Läs mer

Räckviddsutveckling. ORVESTO Konsument 2002:1 2010:3

Räckviddsutveckling. ORVESTO Konsument 2002:1 2010:3 Räckviddsutveckling ORVESTO Konsument 22:1 21:3 1 Morgonpress Dagens Industri Dagens Nyheter, vardag Dagens Nyheter, söndag Direktpress Stockholm/Innerstadspress Göteborgs-Posten, vardag Göteborgs-Posten,

Läs mer

Acano cospace Solution

Acano cospace Solution Acano cospace Solution Acano Klienten Snabbstarts Guide Acano 1.0 October 2013 Innehåll Contents 1 Introduktion 3 2 Hålla en ad-hoc audio and video möte 4 3 Skapa ett cospace 5 4 Ansluta till ett cospace

Läs mer

EUROPEAN CAPITALOF CULruRE. #mnea2014 Digital Strategi

EUROPEAN CAPITALOF CULruRE. #mnea2014 Digital Strategi EUROPEAN CAPITALOF CULruRE #mnea2014 Digital Strategi Digital personlighet Umeå2014s tonalitet Personlighet Kommunikationen skall kännas levande, inspirerande, lekfull och i nuet. De sociala medierna är

Läs mer

Staffanstorps kommun. Öppen kommentarsfunktion

Staffanstorps kommun. Öppen kommentarsfunktion Staffanstorps kommun Öppen kommentarsfunktion Staffanstorp 2011 lanserade Staffanstorp Framtidens webb Responsiv sajt med öppen kommentarsfunktion Kommentarer kan lämnas av alla medborgare En moderator

Läs mer

Målgrupper. Med målgrupper menar vi. Syfte. Målgrupperna. Vad händer inom fallskärmsvärlden?

Målgrupper. Med målgrupper menar vi. Syfte. Målgrupperna. Vad händer inom fallskärmsvärlden? Målgrupper Med målgrupper menar vi - Ett behovs- eller beteendemönster - i relation till fallskärmsförbundets kommunikation - som är relevant för vårt syfte Syfte - Transparens och insyn ger delaktighet,

Läs mer

Relate Public Edition för sociala webbplatser och communitys. Relate Intranet Edition för intranät och extranät

Relate Public Edition för sociala webbplatser och communitys. Relate Intranet Edition för intranät och extranät Public Edition för sociala er och communitys Intranet Edition för intranät och extranät EPiServer gav oss den ideala grunden att bygga GOCityGirlsiten på. Genom att använda personaliserings- och communityverktygen

Läs mer

Vi når mediebranschens beslutsfattare!

Vi når mediebranschens beslutsfattare! "Det närmaste DN Debatt man kommer för mediebranschen" Mikael Marklund Axel Andén Lisa Bjurwald Thomas Mattsson, chefredaktör Expressen Vi når mediebranschens beslutsfattare! n Medievärlden bevakar affärerna

Läs mer

Strategi i sociala medier för att lyfta Region Västerbotten som organisation

Strategi i sociala medier för att lyfta Region Västerbotten som organisation Strategi i sociala medier för att lyfta Region Västerbotten som organisation Vi har i det här arbetet tagit fasta på några av de personlighetsdrag som kännetecknar Region Västerbotten. I uppdragsbeskrivningen

Läs mer

VAD ÄR CONTENT MARKETING?

VAD ÄR CONTENT MARKETING? VAD ÄR CONTENT MARKETING? Content marketing är kommunikation som är relevant och intressant för mottagaren. Det bygger på principen att själva INNEHÅLLET I SIG HAR ETT STORT VÄRDE för mottagaren. Genom

Läs mer

FÖRETAGARPAKETET WEB

FÖRETAGARPAKETET WEB Vi växer FÖRETAGARPAKETET WEB Sveriges enda kvalitetsnätverk till småföretagare 01 När Paketet du vill nå företagare och entreprenörer ÅTTA KVALITESSAJTER Om Paketet Här når du på ett enkelt sätt direkt

Läs mer

Future City 2016 2017. Så här kan ditt företag delta i Future City:

Future City 2016 2017. Så här kan ditt företag delta i Future City: Så här kan ditt företag delta i Future City: Future City 2016 2017 Guldarrangör, max sex 100 000 kr Silverarrangör, max sex 50 000 kr Bronsarrangör 25 000 kr Dela ut ett pris, max tre 15 000 kr Supporter

Läs mer

Riktlinjer för native advertising

Riktlinjer för native advertising Riktlinjer för native advertising www.iabsverige.se IAB Sverige 2014 Riktlinjer för native advertising Copyright IAB Sverige info@iabsverige.se www.iabsverige.se juni 2014 1 Innehållsförteckning 1. Introduktion

Läs mer

TOPPEN TIPS Lyssna på Mister Maker och följ hans råd och rön. Skicka in dina bästa skapelser till vårt galleri. Du kan vinna ett pris!

TOPPEN TIPS Lyssna på Mister Maker och följ hans råd och rön. Skicka in dina bästa skapelser till vårt galleri. Du kan vinna ett pris! P2 Entertainment App snabbguide Mister Maker: Nu skapar vi! FÖR FÖRÄLDRAR Mister Maker: Nu skapar vi! innehåller en mängd unika och roliga funktioner låter barns kreativa fantasi löpa fritt. Mister Maker

Läs mer

STRATEGIER FÖR SOCIALA MEDIER KONSTEN ATT INTE GÖRA SAMMA SAK I ALLA KANALER. stakston.skl.projekt

STRATEGIER FÖR SOCIALA MEDIER KONSTEN ATT INTE GÖRA SAMMA SAK I ALLA KANALER. stakston.skl.projekt STRATEGIER FÖR SOCIALA MEDIER KONSTEN ATT INTE GÖRA SAMMA SAK I ALLA KANALER stakston.skl.projekt KOMMUNIKATION UR OMVÄRLDENS ÖGON Transparens Kunskapstörst Informationssökande Starka nätverk Värderingsbaserade

Läs mer

Rabattkoder : Kupongerna.se

Rabattkoder : Kupongerna.se Rabattkoder : Kupongerna.se Kupongerna.se letar upp och publicerar rabattkoder och erbjudanden över internet. Det är som konsument en djungel att hitta bland alla rabattsidor, detta vill vi på Kupongerna

Läs mer

VECKANS AFFÄRER VÅRA LÄSARE RÄCKVIDD & UPPLAGA

VECKANS AFFÄRER VÅRA LÄSARE RÄCKVIDD & UPPLAGA VECKANS AFFÄRER Veckans Affärer är förstahandsvalet för näringslivet: Vi når nära 300 000 kvalificerade och köpstarka beslutsfattare inom svenskt näringsliv via vårt magasin, webb/mobil och nyhetsbrev.

Läs mer

Lyssna på nätet med Social Media Analytics

Lyssna på nätet med Social Media Analytics Lyssna på nätet med Social Media Analytics Christopher Broxe Text Analytics Manager EMEA Agenda Introduktion till SAS Social Media Analytics Textanalys (Content Categorization, NLP och Sentimentanalys)

Läs mer

MEDIAKIT 2015 Online - Magasin - Email

MEDIAKIT 2015 Online - Magasin - Email MEDIAKIT 2015 Online - Magasin - Email Vill du nå var,ärde svensk man mellan 35-44 år? Annonsera i våra kanaler! Vill du hi=a rä= målgrupp och maxa ROI? Genom våra kanaler når du både bre= och pricksäkert

Läs mer

VECKANS AFFÄRER VÅRA LÄSARE RÄCKVIDD & UPPLAGA

VECKANS AFFÄRER VÅRA LÄSARE RÄCKVIDD & UPPLAGA VECKANS AFFÄRER Veckans Affärer är förstahandsvalet för näringslivet: Vi når nära 300 000 kvalificerade och köpstarka beslutsfattare inom svenskt näringsliv via vårt magasin, webb/mobil och nyhetsbrev.

Läs mer

www.kennedyandersson.com

www.kennedyandersson.com www.kennedyandersson.com 7x step to inbound marke2ng paradise. Inboundmarke9ng check-list A?raherar du e? ökande antal besökare 9ll din hemsida? 1. Hur nöjd är du med antal besökare 9ll din hemsida? a)

Läs mer

Presentation den 25 maj 2016. Skolforskningsinstitutets. verksamhet

Presentation den 25 maj 2016. Skolforskningsinstitutets. verksamhet Presentation den 25 maj 2016 Skolforskningsinstitutets verksamhet Skolforskningsinstitutets roller Systematiska översikter (sekundärforskning/kunskapsproduktion) Mediering (kunskapsdelning av våra produkter)

Läs mer

Räckvidds- och upplageutveckling 1998 2007

Räckvidds- och upplageutveckling 1998 2007 s- och upplageutveckling 1998 2007 ORVESTO Konsument Helår & TS 2008-02-22 4 Wheel Drive Affärsvärlden Aftonbladet Söndag TS-upplaga dagspress Aftonbladet Vardag TS-upplaga dagspress Aktiespararen Allas

Läs mer

Annonsera med säkerhet

Annonsera med säkerhet 2011 Lennart Kriisa, chefredaktör Uppslag 49 900:- Satsyta 486x327 Utfallande 518x348 + 3 mm Arbetarskydd är Sveriges största nyhetstidning på arbetsmiljöområdet. Arbetarskydd står för en kritisk granskning

Läs mer

Enkelt på bara två A-4sidor så det går snabbt att få en uppfattning om företaget. Faktablad - framsida. 1 av 5 2016-04-10 13:16

Enkelt på bara två A-4sidor så det går snabbt att få en uppfattning om företaget. Faktablad - framsida. 1 av 5 2016-04-10 13:16 1 av 5 2016-04-10 13:16 Ditt erbjudande är viktigt! View this email in your browser Senaste halvåret har vi haft flera kontakter med fiskeresearrangörer från bl.a. USA, Tyskland, Polen och Holland som

Läs mer

På Kryss håller drömmarna vid liv...

På Kryss håller drömmarna vid liv... mot nya horisonter På Kryss håller drömmarna vid liv... Om På Kryss På Kryss är tidningen för de riktigt inbitna båtlivsentusiasterna. Tidningen bjuder på allt från intressanta reportage om fascinerande

Läs mer

Kvinnor är våra favoriter

Kvinnor är våra favoriter Kvinnor är våra favoriter För oss på Bonnier Tidskrifter är skönhet ett av de viktigaste segmenten både innehållsmässigt i våra varumärken och gentemot våra annonsörer, läsare och besökare. Med våra varumärken

Läs mer

Tidskrifter säljer produkter!

Tidskrifter säljer produkter! säljer produkter! engagerar! är det medium man generellt värdesätter högst. Dessutom sysslar man sällan med annat samtidigt som man läser. Konsumenterna i Ball States undersökning ägnade sitt främsta intresse

Läs mer

Digital strategi för Miljöpartiet

Digital strategi för Miljöpartiet 2012-03-12 Digital strategi för Miljöpartiet Bakgrund Vår webbplats ska förnyas och i processen med att upphandla en ny dök frågan upp om vilket syfte den skulle ha i relation till övrig webbnärvaro. I

Läs mer

Volymen av bokningar som görs online

Volymen av bokningar som görs online Ställ ut på Sportfiskemässan i Älvsjö. Angeln i Duisburg. Fiskeguidens erfarenheter. Säljkanaler View this email in your browser Vi har med 10 snabba frågor kollat läget med guiden och fiskeprofilen Mikael

Läs mer

Bygg din egen tidning med nya Flipboard 2.0

Bygg din egen tidning med nya Flipboard 2.0 Bygg din egen tidning med nya 7 Håll koll på dina sociala nätverk 7 Ett av de bästa sätten att läsa nyheter 7 Skicka din egen tidning till kompisarna. Sätt samman din egen tidning Med Flipboard skapar

Läs mer

Bilden av. boras.com

Bilden av. boras.com Bilden av 27 april 2010 Vem vill bli vän med Borås Stad? Vi måste finnas där människor söker information. Dagens samhälle, 3 mars 2010 Succé för fullmäktige på webben När det gäller politiker och Internet

Läs mer

Denna information är till för att förhindra personskador och till och med dödsfall, och användaren bör följa dessa säkerhetsregler.

Denna information är till för att förhindra personskador och till och med dödsfall, och användaren bör följa dessa säkerhetsregler. 120 Denna information är till för att förhindra personskador och till och med dödsfall, och användaren bör följa dessa säkerhetsregler. Denna information är till för att förhindra skada på apparaten eller

Läs mer

MARKNADSFÖR ERT LOPP! utveckla svensk löpning med. Foto: Markus Westbeck

MARKNADSFÖR ERT LOPP! utveckla svensk löpning med. Foto: Markus Westbeck MARKNADSFÖR ERT LOPP! utveckla svensk löpning med Foto: Markus Westbeck VÅR AMBITION Spring ska vara magasinet och sajten ingen löpare kan vara utan den där sista pusselbiten som krävs för att nå nya mål.

Läs mer

Hur ska Länsförsäkringar Fastighetsförmedling i Roslagen dra nytta av sociala medier?

Hur ska Länsförsäkringar Fastighetsförmedling i Roslagen dra nytta av sociala medier? ABSTRACT Hur ska Länsförsäkringar Fastighetsförmedling i Roslagen dra nytta av sociala medier? Den här förstudien undersöker frågan Hur ska Länsförsäkringar Fastighetsförmedling i Roslagen dra nytta av

Läs mer

Guide för dig som ska köpa rekryteringstjänster. - Specialister & Chefer. Ett kostnadsfritt whitepaper utgivet av Level Recruitment

Guide för dig som ska köpa rekryteringstjänster. - Specialister & Chefer. Ett kostnadsfritt whitepaper utgivet av Level Recruitment Guide för dig som ska köpa rekryteringstjänster - Specialister & Chefer Ett kostnadsfritt whitepaper utgivet av Level Recruitment Level Recruitment AB - 2016 Konsten att hitta rätt företag Att hitta rätt

Läs mer

Nyckeln till föreningens kommunikation och administration. Hemsidehantering

Nyckeln till föreningens kommunikation och administration. Hemsidehantering Nyckeln till föreningens kommunikation och administration Hemsidehantering Upplägg söndag 10.30-12.30 PowerPoint: - Allmänt om hemsidan och funktionerna på hemsidedelen - Tips och råd På IdrottOnline-sida:

Läs mer

Lägg in basinformationen. Starta här om du inte redan har fyllt i basinformationen på ditt företags sida. Klicka Redigera uppe till höger i verktyget.

Lägg in basinformationen. Starta här om du inte redan har fyllt i basinformationen på ditt företags sida. Klicka Redigera uppe till höger i verktyget. 7 steg för att skapa en företagssida på LinkedIn LinkedIn lanserar ständigt nya förbättringar i applikationen för företagssidor på LinkedIn. Nu senast bl. a s.k showcase- sidor. Detta e- blad fungerar

Läs mer

Marknadskanaler Visit Linköping & Co AB

Marknadskanaler Visit Linköping & Co AB Marknadskanaler En upplevelse börjar långt före själva evenemanget. För publiken handlar det om längtan. För oss handlar det inte minst om marknadsföring. En del av Visit Linköping & Co AB Box 1397 581

Läs mer

annonsinformation Annonsera på en av landets mest besökta turistportaler!

annonsinformation Annonsera på en av landets mest besökta turistportaler! sid 1/5 Annonsera på en av landets mest besökta turistportaler! annonsinformation Gotland.net marknadsför Gotland 365 dagar om året. Med i snitt 27.700 besök och nära 100.000 sidvisningar på sajten varje

Läs mer

500 000 beslutsfattare!

500 000 beslutsfattare! 500 000 beslutsfattare! Vilka vill du nå? Bil & Verkstad Tidningen Bil & Verkstad distribueras till Sveriges samtliga verkstäder för person- och lastbilar, bilel, bilelektronik, däckservice, bensin stationer,

Läs mer

STUDIECIRKELUPPLÄGG MAKTEN ÖVER MATEN 5-10 TRÄFFAR OM HUR VI TILLSAMMANS KAN LÄRA OSS MER OM, PÅVERKA OCH MINSKA VÅRT KLIMATAVTRYCK MED FOKUS PÅ MAT

STUDIECIRKELUPPLÄGG MAKTEN ÖVER MATEN 5-10 TRÄFFAR OM HUR VI TILLSAMMANS KAN LÄRA OSS MER OM, PÅVERKA OCH MINSKA VÅRT KLIMATAVTRYCK MED FOKUS PÅ MAT STUDIECIRKELUPPLÄGG MAKTEN ÖVER MATEN 5-10 TRÄFFAR OM HUR VI TILLSAMMANS KAN LÄRA OSS MER OM, PÅVERKA OCH MINSKA VÅRT KLIMATAVTRYCK MED FOKUS PÅ MAT 1 MAKTEN ÖVER MATEN 5-10 TRÄFFAR MOT EN KLIMATSMART,

Läs mer

RÄTT! Vi hjälper dig att välja. Denna bilaga handlar om Råd & Rön och hur vi gör våra tester. Riktiga tester som du kan lita på!

RÄTT! Vi hjälper dig att välja. Denna bilaga handlar om Råd & Rön och hur vi gör våra tester. Riktiga tester som du kan lita på! Vi hjälper dig att välja RÄTT! Denna bilaga handlar om Råd & Rön och hur vi gör våra tester. Riktiga tester som du kan lita på! Oberoende professionella tester Varje år får hundratals produkter genomgå

Läs mer

Fakta. Upplaga: Räckvidd: 50 000 läsare (Orvesto konsument 2012) Frekvens: 12 nr/år + 4 temautgåvor. Målgrupp

Fakta. Upplaga: Räckvidd: 50 000 läsare (Orvesto konsument 2012) Frekvens: 12 nr/år + 4 temautgåvor. Målgrupp kamera&bild ANNONSpriser 2013 Fakta Upplaga: 20 000 ex varav ca 7 000 är prenumeranter. Räckvidd: 50 000 läsare (Orvesto konsument 2012) Frekvens: 12 nr/år + 4 temautgåvor Målgrupp Privatpersoner Kamera

Läs mer