Källa och period. Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min

Save this PDF as:
 WORD  PNG  TXT  JPG

Storlek: px
Starta visningen från sidan:

Download "Källa och period. Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min"

Transkript

1 VARUMÄRKESKORT Tertial 2015:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva/ ORVESTO Internet 2015 genomsnittlig dag ORVESTO Konsument 2015:3 genomsnittlig utgåva/ ORVESTO Internet Tertial genomsnittlig dag Bruttoräckvidd / vecka: ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva/ ORVESTO Internet 2015 genomsnittlig vecka ORVESTO Konsument 2015:3 genomsnittlig utgåva/ ORVESTO Internet Tertial genomsnittlig vecka Print - Allt om Mat Räckvidd (helår): ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva Räckvidd (tertial): ORVESTO Konsument 2015:3 genomsnittlig utgåva TS-upplaga/utg (helår): TS 2015 RPC: 6,0 Utgåvor / år: 18 QRS-index: 126 TNS Sifo Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min Webb - alltommat.se Räckvidd / dag (helår): Räckvidd / vecka (helår): Räckvidd / dag (tertial): Räckvidd / vecka (tertial): Unika webbläsare / vecka: Besök / vecka: Sidvisningar / vecka: Besök / unika webbläsare: 1,3 Sidvisningar / besök: 2,2 Viewability: Annonsmöjlighet inloggade: ORVESTO Internet 2015 genomsnittlig dag ORVESTO Internet 2015 genomsnittlig vecka ORVESTO Internet Tertial genomsnittlig dag ORVESTO Internet Tertial genomsnittlig vecka Burt 2015: Tertial 3 genomsnittlig vecka All contents of this page are copyright by. All rights reserved.

2 Mobil - alltommat.se mobil Unika webbläsare / vecka: Besök / vecka: Sidvisningar / vecka: Besök / unika webbläsare: 1,3 Sidvisningar / besök: 1,1 Viewability: Annonsmöjlighet inloggade: Burt 2015: Tertial 3 genomsnittlig vecka All contents of this page are copyright by. All rights reserved.

3 ÖVRIGA ANNONSMÖJLIGHETER Nyhetsbrev Allt om mat Fredagsmeny Antal mottagare / utgåva: TS- intyg Tertial Öppnade / utgåva: 46 % Periodicitet: CTR: 13 % 1/vecka Allt om mat nyhetsbrev Antal mottagare / utgåva: TS- intyg Tertial Öppnade / utgåva: 32 % Periodicitet: CTR: 7 % 2/vecka Allt om mat Vinbrev Antal mottagare / utgåva: TS- intyg Tertial Öppnade / utgåva: 26 % Periodicitet: CTR: 2 % 2/vecka Sociala medier Facebook Allt om mat Likes: Engagemang: 300 Tertial Instagram Allt om mat Följare: Twitter Allt om mat Följare: Övrig info - Allt om Mat Resor: Skräddarsydda mat & vinresor Mässor: Deltar på Matmässan och i Bak & chokladfestivalen. Liksom på Bok & Biblioteksmässan Webbshop: Finns på Bokutgivning: Ja, ett antal per år, t ex Fredagsgourmet Specialutgåvor/temanr: Bakspecial, Festspecial, Grillspecial, Julspecial, Vardagsspecial och Vin special Snabbfakta (egen uppgift) Allt om Mat är den självklara inspiratören och följeslagaren i köket, både för nybörjaren och den mer avancerade hemmakocken. Här finns den snabba och enkla maten som underlättar en stressig vardag, men även läckra menyer som sätter guldkant på helgmiddagen, festen eller högtidsdagarna. I Allt om Mat:s provkök lagas alla recept för att garantera att maten är god och att resultatet blir lyckat när läsarna provar recepten hemma. Allt om Mat startade redan 1970 och är sedan dess Sveriges i särklass största matmagasin med en mycket hög trovärdighet och lojala prenumeranter som behåller tidningen år efter år. På alltommat.se finns en receptbank med sökbara recept, som alla är provlagade. All contents of this page are copyright by. All rights reserved.

4 TSMediefaktasuppdrag TSMediefaktaharentydliguppgift. TSverkarpåmedieköparnasuppdragoch ReviderarochKvalitetssäkrarÖverenskomnasiffrorföratt skapajämförbarhetimedievalet. FörattutvecklaochsäkerställadebranschöverenskommelsersomliggertillgrundförTSarbeteså verkartsiflerakommittéerochforum. TSMediekommitté medrepresentanterfråntu,sverigestidskrifter,sveriges AnnonsörerochSverigesMediebyråer. SverigesAnnonsörersVerkställandeutskott. DetforumförMediebyråersomTSskapatochträffarochstämmeravmedvia återkommandemöten. Varumärkeskort Påenalltmerfragmentiseradmediemarknad medmånganyaannonsmöjligheter,menockså tydligautmaningariattskapaöverblickochjämförbarhet harts,isamrådmedbranschenochvåra kommittéer,tagitframdetnyaverktygetvarumärkeskortet. Kortethjälpermedieköparnaattfåöverblickochattväljamedjämförbaraochkvalitetssäkradesiffror somgrund.kortetgerocksåmediernaenunik,sammanfattandeochjämförbarmöjlighetattvisaalla deplattformarsomdeagerarpå. Etteffektivtverktygförmedieköparna ochenunikmöjlighetförmediernaattvisasinastyrkorialla plattformar.

5 Definitioner Nettoräckvidd Antalpersoner,netto,ibefolkningen1680årsomläst,tittatpå,lyssnatpånågonavdekanalersom mätsiorvestoochorvestointernetochsomfinnsredovisadeidettavarumärkeskort.dubbeltäckning mellanplattformarnaförekommerinte. Bruttoräckvidd Antalpersoner,brutto,ibefolkningen1680årsomläst,tittatpå,lyssnatpånågonavdekanalersom mätsiorvestoochorvestointernetochsomfinnsredovisadeidettavarumärkeskort.bruttotär därmedsummanavrespektiveräckviddsplattformochinkluderardubbeltäckningmellan plattformarna. Räckvidd Antalpersoner,netto,ibefolkningen1680årsomläst,tittatpå,lyssnatpådenredovisade plattformen. TSupplaga Genomsnittligupplaga. Varavdigitalaexemplar. AndeldigitalaexemplaravTSupplagan.Dedigitalaexemplarenskatillmerän50%haett gemensamtredaktionelltinnehållmeddentrycktatidningenochiövrigtuppfylladefinitionenav tidningenligttsbestämmelser. RPC ReadersPerCopy.Antalläsareperupplagexemplarförföregåendeår.RPC=Räckvidd/TSUpplaga. Betalningsgrad HurstorandelavTSUpplagansomärbetaldtillordinariefulltpris. HHTUtgivningskommun Andelhushålltidningennårinomsinutgivningskommun. Utgåvor/vecka Antalutgåvorpervecka. UnikaWebbläsare Ettgenomsnittavtotaltantalunikawebbläsare(t.ex.InternetExplorer,Safari)perveckaförden aktuellamätperioden.

6 Varavinloggade Andelsomharloggatinpåsajten. Besök Ettgenomsnittavtotaltantalbesökperveckafördenaktuellamätperioden. Sidvisningar Genomsnittligtantalsidvisningarperveckafördenaktuellamätperioden.Ensidvisninguppstårdå besökarengenomaktivhandlingväljerattbesökaensida. Viamobil Andelavbesökaresomkommerviamobil. VaravIOSochAndroid AndelavbesökaresomanvänderIOSrespektiveAndroid. Timespent Genomsnittligtidperbesökunderaktuellmätperiod.Besökaresombarabesökerensida(s.k.single pagevisits)exkluderasurmätningen. Viewability (Ja/Nej) Finnsmöjlighetenattfåinformationomhurstorandelavannonsensomharvaritsynlig. Startadeströmmar AntaletvisningaravwebbTV.TVklippetmåstehastartatsgenomenaktivhandling,vilketinnebär attautomatisktstartadewebbtvklippejkanmedräknas.

7 VASTComplete TheIAB svideoadservingtemplate(vast)äreninternationellxmlspecifikation/standardvid WebbTVannonsering.Redovisartrafikperkvartil. Frekvensstyrning(Ja/Nej) Finnsmöjlighetattstyrahuroftaenannonssynsienåterkommandebesökaresflöde. Annonsmöjlighetinloggade Finnsmöjlighetattannonserapådelaravsajtensomendastsynsförbesökaresomharloggatin. RSdistribution Antaldistribueradeexemplarigenomsnittunderdenaktuellamätperioden. QRSIndex Sammanvägtindexöverhurmycket,huroftaochhurlängeentidskriftanvänds.Genomsnittligtindex församtligatidningarsomingickvidmättillfälletär100. Facebook(pagelikes) Totaltantalföljare (gilla-markeringar) för en facebooksidavidettvisstdatum. Facebook (Engagemang) Genomsnittligt antal, per vecka, gilla-markeringar, delningar och kommentarer för den aktuella Facebooksidan för aktuell mätperiod. Twitter(följare) Totaltantalprenumeranterpåmeddelandeflödenvidettvisstdatum. CTR(Clickthroughrate)förepost Antaletklickrelaterattillantaletutskickade ,dvs.hurstorandelklickarsigvidarefråneposten tillenwebbsida.

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2016:1. Print - Allt om Mat. Webb - alltommat.se

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2016:1. Print - Allt om Mat. Webb - alltommat.se VARUMÄRKESKORT Tertial 2016:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 499 200 ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva/ ORVESTO Internet 2015 genomsnittlig dag 470 800 ORVESTO Konsument 2016:1

Läs mer

Källa och period. Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min. Räckvidd / dag: 41 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 222 500

Källa och period. Läsmängd: 77,4 % Lästillfällen: 2,8 Lästid: 39 min. Räckvidd / dag: 41 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 222 500 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 503 900 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 489 900 Bruttoräckvidd / vecka: 684 500 Nettoräckvidd / vecka: 618

Läs mer

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:3. Print - Icakuriren. Webb - icakuriren.se

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:3. Print - Icakuriren. Webb - icakuriren.se VARUMÄRKESKORT Tertial 2015:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 435 000 ORVESTO Konsument 2015:HELÅR genomsnittlig utgåva/ ORVESTO Internet 2015 genomsnittlig dag 424 300 ORVESTO Konsument 2015:3

Läs mer

Källa och period. TS-upplaga/utg (helår): 22 600 TS 2015 RPC: 2,7 Betalningsgrad: 95 % HHT utgivningskommun: 50 % TS 2015 Utgåvor / vecka: 6

Källa och period. TS-upplaga/utg (helår): 22 600 TS 2015 RPC: 2,7 Betalningsgrad: 95 % HHT utgivningskommun: 50 % TS 2015 Utgåvor / vecka: 6 VARUMÄRKESKORT Tertial 2015:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 62 000 ORVESTO Konsument 2015:HELÅR genomsnittlig / ORVESTO Internet 2015 genomsnittlig dag 62 000 ORVESTO Konsument 2015:3 genomsnittlig

Läs mer

Källa och period. TS-upplaga/utg (helår): 12 800 TS 2014 Utgåvor / år: 11

Källa och period. TS-upplaga/utg (helår): 12 800 TS 2014 Utgåvor / år: 11 VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Print - Arkitekten TS-upplaga/utg (helår): 12 800 TS 2014 Utgåvor / år: 11 Webb Unika webbläsare / vecka: Besök / vecka: 10 200 Sidvisningar / vecka:

Läs mer

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:2. Print

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:2. Print VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 163 100 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 131 900 Print Länstidningen Östersund Räckvidd: 25 000 ORVESTO Konsument

Läs mer

Källa och period. Läsmängd: 83,9 % Lästillfällen: 3,2 Lästid: 59 min. Räckvidd / dag: 33 800 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 152 000

Källa och period. Läsmängd: 83,9 % Lästillfällen: 3,2 Lästid: 59 min. Räckvidd / dag: 33 800 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 152 000 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 276 800 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 271 200 Bruttoräckvidd / vecka: 395 000 Nettoräckvidd / vecka: 364

Läs mer

Källa och period. Läsmängd: 72,4 % Lästillfällen: 1,9 Lästid: 39 min

Källa och period. Läsmängd: 72,4 % Lästillfällen: 1,9 Lästid: 39 min VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 235 200 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 228 600 Bruttoräckvidd / vecka: 331 500 Nettoräckvidd / vecka: 304

Läs mer

Bruttoräckvidd / dag: 50 000 ORVESTO Konsument Nettoräckvidd / dag: 50 000. Källa och period. Räckvidd / dag: Räckvidd / vecka:

Bruttoräckvidd / dag: 50 000 ORVESTO Konsument Nettoräckvidd / dag: 50 000. Källa och period. Räckvidd / dag: Räckvidd / vecka: VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 50 000 ORVESTO Konsument Nettoräckvidd / dag: 50 000 Print - Dagens ETC Räckvidd: 50 000 ORVESTO Konsument 2015:1 genomsnittlig

Läs mer

Källa och period. Läsmängd: 78,9 % Lästillfällen: 2,1 Lästid: 53 min. Räckvidd / dag: 68 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 204 800

Källa och period. Läsmängd: 78,9 % Lästillfällen: 2,1 Lästid: 53 min. Räckvidd / dag: 68 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 204 800 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 160 900 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 157 300 Bruttoräckvidd / vecka: 296 800 Nettoräckvidd / vecka: 279

Läs mer

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:2. Print

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:2. Print VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 114 200 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 100 100 Print Hudiksvalls Tidning Räckvidd: 25 000 ORVESTO Konsument

Läs mer

Källa och period. Räckvidd / dag: 18 900 Orvesto Internet Tertial 1 2015 Räckvidd / vecka: 61 300. Räckvidd / dag: Räckvidd / vecka:

Källa och period. Räckvidd / dag: 18 900 Orvesto Internet Tertial 1 2015 Räckvidd / vecka: 61 300. Räckvidd / dag: Räckvidd / vecka: VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 71 900 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 64 000 Print - Södermanlands Nyheter Räckvidd: 53 000 ORVESTO Konsument

Läs mer

Källa och period. TS-upplaga/utg (helår): 38 200 TS 2014

Källa och period. TS-upplaga/utg (helår): 38 200 TS 2014 VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 161 800 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 139 200 Print Arbetarbladet Räckvidd: 44 000 ORVESTO Konsument 2015:1

Läs mer

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:1. Print - Svensk Jakt. Webb+Mobil - svenskjakt.se

VARUMÄRKESKORT RÄCKVIDDSPLATTFORMAR. Tertial 2015:1. Print - Svensk Jakt. Webb+Mobil - svenskjakt.se VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 232 000 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 232 000 Print - Svensk Jakt Mått Källa och period Räckvidd: 232

Läs mer

Bruttoräckvidd / dag: 101 000 ORVESTO Konsument Nettoräckvidd / dag: 101 000. Källa och period. Läsmängd: 81,4 % Lästillfällen: 3,0 Lästid: 1,38 tim

Bruttoräckvidd / dag: 101 000 ORVESTO Konsument Nettoräckvidd / dag: 101 000. Källa och period. Läsmängd: 81,4 % Lästillfällen: 3,0 Lästid: 1,38 tim VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 101 000 ORVESTO Konsument Nettoräckvidd / dag: 101 000 Print - Filter Räckvidd: 101 000 ORVESTO Konsument 2015:2 genomsnittlig utgåva

Läs mer

Källa och period. TS-upplaga/utg (helår): 7 900 TS 2014 Varav digitala ex (helår): 1 100 TS (Varav digital publikation) 2014 Utgåvor / år: 8

Källa och period. TS-upplaga/utg (helår): 7 900 TS 2014 Varav digitala ex (helår): 1 100 TS (Varav digital publikation) 2014 Utgåvor / år: 8 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Print - Arkitektur TS-upplaga/utg (helår): 7 900 TS 2014 Varav digitala ex (helår): 1 100 TS (Varav digital publikation) 2014 Utgåvor / år: 8 Webb+Mobil

Läs mer

Källa och period. Räckvidd / dag: 43 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 117 800

Källa och period. Räckvidd / dag: 43 900 ORVESTO Internet Tertial 2 2015 Räckvidd / vecka: 117 800 VARUMÄRKESKORT Tertial 2015:2 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 103 900 ORVESTO Konsument/ORVESTO Internet Nettoräckvidd / dag: 86 600 Print - Östersunds-Posten Räckvidd: 49 000 ORVESTO Konsument

Läs mer

Källa och period. TS-upplaga/utg (helår): 5 800 TS 2014 Varav digitala ex (helår): 300 Utgåvor / år: 6

Källa och period. TS-upplaga/utg (helår): 5 800 TS 2014 Varav digitala ex (helår): 300 Utgåvor / år: 6 VARUMÄRKESKORT Tertial 2015:1 RÄCKVIDDSPLATTFORMAR Print - Form, Magasin för Nordisk Arkitektur och Design Mått Källa och period TS-upplaga/utg (helår): 5 800 TS 2014 Varav digitala ex (helår): 300 Utgåvor

Läs mer

Bruttoräckvidd / dag: 643 000 Nettoräckvidd / dag: 507 000 Orvesto Total Tertial 3 2014. Källa och period

Bruttoräckvidd / dag: 643 000 Nettoräckvidd / dag: 507 000 Orvesto Total Tertial 3 2014. Källa och period VARUMÄRKESKORT Tertial 2014:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 643 000 Nettoräckvidd / dag: 507 000 Orvesto Total Tertial 3 2014 Print - Dagens industri Räckvidd: 328 000 Orvesto Konsument 2014:3

Läs mer

Bruttoräckvidd / dag: 113 000 Nettoräckvidd / dag: 113 000. Källa och period. Läsmängd: 80% Lästillfällen: 3,2 Lästid: 55 min.

Bruttoräckvidd / dag: 113 000 Nettoräckvidd / dag: 113 000. Källa och period. Läsmängd: 80% Lästillfällen: 3,2 Lästid: 55 min. VARUMÄRKESKORT Tertial 2014:3 RÄCKVIDDSPLATTFORMAR Bruttoräckvidd / dag: 113 000 Nettoräckvidd / dag: 113 000 Print - Runner s World Mått Källa och period Räckvidd: 113 000 Orvesto Konsument 2014:3 genomsnittlig

Läs mer

1 836 000 (genomsnittlig dag) 2 234 300 (genomsnittlig dag)

1 836 000 (genomsnittlig dag) 2 234 300 (genomsnittlig dag) TERTIAL 2 2014 RÄCKVIDDSPLATTFORMAR Expressen GT KvP expressen.se Nettoräckvidd: Bruttoräckvidd: 1 836 000 (genomsnittlig dag) 2 234 300 (genomsnittlig dag) Räckvidd 685 000 Orvesto Konsument 2014:2 genomsnittlig

Läs mer

Mobilsurfande i Sverige

Mobilsurfande i Sverige Mobilsurfande i Sverige 1 Mobilsurfandet i Sverige ökar snabbt. Det är yngre, välutbildade storstadsbor som surfar mest idag, men det är rimligt att anta att också andra grupper inom en snar framtid kommer

Läs mer

Sociala medier för företag

Sociala medier för företag Sociala medier för företag EN INTRODUKTION Materialet tillhör Idenfors & Idenfors AB och får användas av dig som kursdeltagare eller prenumerant av vårt nyhetsbrev, men inte kopieras, säljas eller användas

Läs mer

Marknadskanaler Visit Linköping & Co AB

Marknadskanaler Visit Linköping & Co AB Marknadskanaler En upplevelse börjar långt före själva evenemanget. För publiken handlar det om längtan. För oss handlar det inte minst om marknadsföring. En del av Visit Linköping & Co AB Box 1397 581

Läs mer

MATTER CONTENT INTEGRATION TOOLS 1.0

MATTER CONTENT INTEGRATION TOOLS 1.0 MATTER CONTENT INTEGRATION TOOLS 1.0 Läsaranalys, Kanalinventering & Benchmark Engagemang. Tre verktyg Matter delar med sig av till Webbdagarnas publik 2015. @MatterHQ (Twitter) matter.se @MatterHQ (Instagram)

Läs mer

Nya Veckans AffArer VÅRA LÄSARE RÄCKVIDD & UPPLAGA

Nya Veckans AffArer VÅRA LÄSARE RÄCKVIDD & UPPLAGA Nya Veckans AffArer Nya Veckans Affärer är förstahandsvalet för näringslivet: Vi når 70 000 kvalificerade och köpstarka beslutsfattare inom svenskt näringsliv. I Veckans Affärer får de ny kunskap, nya

Läs mer

Kommunikation i sociala medier

Kommunikation i sociala medier Kommunikation i sociala medier. 2 Tur drabbar bara de skickliga! Hallå? 3 4 Kommunikation 2014 5 Facebook, Twitter, Linkedin, Google+, Tumbler, Wordpress, Youtube, Pinterest, Ello eller Instagram? "Istället

Läs mer

Facebookmarknadsföring

Facebookmarknadsföring Facebookmarknadsföring Gustav Bergman Kort om Kanban Marketing Google AdWords Facebook Webbyrå Sökmotoroptimering (SEO) gustav.bergman@kanban.se Kort om Kanban Marketing Google AdWords Facebook Webbyrå

Läs mer

Nå dina kunder nära köp!

Nå dina kunder nära köp! Nå dina kunder nära köp! Vi hjälper dig att nå ditt mål Vill du få kunden att agera direkt, eller vill du profilera ditt varumärke? Oavsett vilket mål du har med din annonsering kan vi hitta en bra lösning

Läs mer

Fakta. Upplaga: Räckvidd: 50 000 läsare (Orvesto konsument 2012) Frekvens: 12 nr/år + 4 temautgåvor. Målgrupp

Fakta. Upplaga: Räckvidd: 50 000 läsare (Orvesto konsument 2012) Frekvens: 12 nr/år + 4 temautgåvor. Målgrupp kamera&bild ANNONSpriser 2013 Fakta Upplaga: 20 000 ex varav ca 7 000 är prenumeranter. Räckvidd: 50 000 läsare (Orvesto konsument 2012) Frekvens: 12 nr/år + 4 temautgåvor Målgrupp Privatpersoner Kamera

Läs mer

CONTENT MARKETING. 4 steg som hjälper dig att skapa en träffsäker strategi.

CONTENT MARKETING. 4 steg som hjälper dig att skapa en träffsäker strategi. CONTENT MARKETING 4 steg som hjälper dig att skapa en träffsäker strategi. Vad är nyttan med content marketing? Content marketing handlar om att använda egenproducerat innehåll i din marknadsföring för

Läs mer

Byggindustrin. Sveriges stora byggår. Tidning Webb Nyhetsbrev Mobil 2016 - ÖVERSIKT. Passion för affärer OFFICIELL MÄSSTIDNING NORDBYGG 2016

Byggindustrin. Sveriges stora byggår. Tidning Webb Nyhetsbrev Mobil 2016 - ÖVERSIKT. Passion för affärer OFFICIELL MÄSSTIDNING NORDBYGG 2016 OFFICIELL MÄSSTIDNING NORDBYGG 2016 Byggindustrin Tidning Webb Nyhetsbrev Mobil 2016 - Sveriges stora byggår ÖVERSIKT MÅLGRUPP: Byggsektorn ANTAL läsare: 20 000 Orvesto Näringsliv 2015 Helsida: 34 400

Läs mer

jobb & karriär PLATSANNONSER Priser & format för platsannonsering i jobb & karriär & på dagensmedicin.se

jobb & karriär PLATSANNONSER Priser & format för platsannonsering i jobb & karriär & på dagensmedicin.se jobb & karriär 2015 PLATSANNONSER Priser & format för platsannonsering i jobb & karriär & på dagensmedicin.se PLATSANNONSER Nå vårdens samtliga resurser, nyckelpersoner och studerande med din platsannons.

Läs mer

Strategi för digitala kanaler 2016-2017

Strategi för digitala kanaler 2016-2017 Strategi för digitala kanaler 2016-2017 Inledning Kommuninvånare ändrar ständigt sina vanor och vill nå kommunal service och information på andra sätt och i nya format. Vi vill möta våra kommuninvånare

Läs mer

Tidskrifter säljer produkter!

Tidskrifter säljer produkter! säljer produkter! engagerar! är det medium man generellt värdesätter högst. Dessutom sysslar man sällan med annat samtidigt som man läser. Konsumenterna i Ball States undersökning ägnade sitt främsta intresse

Läs mer

Träffa politikerna före alla andra! ALMEDALEN

Träffa politikerna före alla andra! ALMEDALEN Träffa politikerna före alla andra! ALMEDALEN 2016 Med Dagens Samhälle når du politikerna inför och på plats i Almedalen Nr 25 Inför Almedalen 30 juni 30 juni gör Dagens Samhälles redaktion återigen en

Läs mer

SOFIA FÖRSAMLINGS TRE FÖRSTA ÅR PÅ FACEBOOK

SOFIA FÖRSAMLINGS TRE FÖRSTA ÅR PÅ FACEBOOK SOFIA FÖRSAMLINGS TRE FÖRSTA ÅR PÅ FACEBOOK Rapport av David Rutström om Svenska kyrkan Sofia församlings i Stockholm verksamhet på Facebook för perioden 4 februari 2010 till och med 31 januari 2013. Förord

Läs mer

2013-03-08. Hej, Här ser ni skillnaden mellan den GAMLA logotypen (t v) och den NYA logotypen (t h) i fyrfärg. Nyhetsbrev mars 2013

2013-03-08. Hej, Här ser ni skillnaden mellan den GAMLA logotypen (t v) och den NYA logotypen (t h) i fyrfärg. Nyhetsbrev mars 2013 Page 1 of 5 Nyhetsbrev mars 2013 Ser du inte nyhetsbrevet? Läs det i din webbläsare. Nyhetsbrev mars 2013 Hej, Här kommer mars månads nyhetsbrev från oss på kontoret. Var vänlig sprid det till alla medlemmar

Läs mer

MEDIEFAKTA 2015 2016 VASALOPPET Vasalöparen och vasaloppet.se

MEDIEFAKTA 2015 2016 VASALOPPET Vasalöparen och vasaloppet.se MEDIEFAKTA 2015 2016 VASALOPPET Vasalöparen och vasaloppet.se 1 Mediefakta 2015 2016 Vasaloppets mediefakta ger dig en samlad bild av Vasaloppets medie- kanaler Vasalöparen och vasaloppet.se samt vilka

Läs mer

Modern företagstelefoni Förenkla och förbättra er kommunikation

Modern företagstelefoni Förenkla och förbättra er kommunikation Modern företagstelefoni Förenkla och förbättra er kommunikation Kraven om ett mobilt arbetssätt, har satt en ny standard för vår kommunikation. icentrex har gett oss de verktyg våra medarbetare behöver

Läs mer

Den personliga inredningstidningen

Den personliga inredningstidningen Den personliga inredningstidningen VÄLKOMMEN TILL ÄLSKADE HEM! Lustfylldhet, glädje, inspiration och människors historier kring sina hem. Det här är kärnan i Sveriges hjärtligaste inredningstidning Älskade

Läs mer

Detta whitepaper har t ex hashtag #vadmenasmedhashtags eller #hashtagstrategiforetag Så om du delar detta vidare, ange gärna någon av dessa.

Detta whitepaper har t ex hashtag #vadmenasmedhashtags eller #hashtagstrategiforetag Så om du delar detta vidare, ange gärna någon av dessa. 7 steg för att skapa en Hashtag- strategi för B2B- företag Marketinghouse (källor: Google, Hubspot, Twitter, Instagram och olika bloggar) Detta whitepaper har t ex hashtag #vadmenasmedhashtags eller #hashtagstrategiforetag

Läs mer

FACEBOOK Hur det funkar och vad man kan göra

FACEBOOK Hur det funkar och vad man kan göra FACEBOOK Hur det funkar och vad man kan göra 2 SANDRA TEROBI GROSSE SOCIAL MEDIA EXECUTIVE/ PRODUCTION MANAGER Det sociala nätverket Facebook 3 4-04 -06-09 -11-12 5 6 7 8 Pages 9 PAGES Var börjar man?

Läs mer

Branding Att äga sitt varumärke Marknadsföring i Sociala Medier för HRT-branschen del 1 Robin Sörbom 2015

Branding Att äga sitt varumärke Marknadsföring i Sociala Medier för HRT-branschen del 1 Robin Sörbom 2015 Branding Att äga sitt varumärke Marknadsföring i Sociala Medier för HRT-branschen del 1 Robin Sörbom 2015 Marknadsföring har under de senaste 20 åren förändrats radikalt i grunden, så även inom HRTbranschen.

Läs mer

PÅ ETT HELT KÖP 20% Östra Storgatan 5 & Östra Storgatan 28A, Jönköping Tel:036 291 54 30 & 010 744 15 80

PÅ ETT HELT KÖP 20% Östra Storgatan 5 & Östra Storgatan 28A, Jönköping Tel:036 291 54 30 & 010 744 15 80 20% GÄLLER PÅ ETT HELT KÖP EJ BÖCKER MED STUDENTPRISER, SMART- BOX, PRESENTKORT, FRIMÄRKEN ELLER RÄKNARE Östra Storgatan 5 & Östra Storgatan 28A, Jönköping Tel:036 291 54 30 & 010 744 15 80 Med Med reservation

Läs mer

Digital kommunikation Vallagruppen

Digital kommunikation Vallagruppen Digital kommunikation Vallagruppen Vi sätter kursen för framtiden Vallagruppen är er proffsleverantör när det kommer till webbutveckling av hemsidor, e-handelssystem, lösningar för Sociala medier, drift

Läs mer

Materialet i detta nyhetsbrev är skyddat av upphovsrättslagen Copyright Sveriges Civilförsvarsförbund

Materialet i detta nyhetsbrev är skyddat av upphovsrättslagen Copyright Sveriges Civilförsvarsförbund Nytt från Civilförsvarsförbundet Sverige #1 (utgivningsdag torsdag 29 januari 2015) Kontaktuppgifter: E-post red@civil.se eller Box 2034, 169 02 Solna Materialet i detta nyhetsbrev är skyddat av upphovsrättslagen

Läs mer

Om rapporten. Direkt effekt 2014 - PostNord

Om rapporten. Direkt effekt 2014 - PostNord Direkt effekt 0 - PostNord Om rapporten Rapporten DR-monitorn 0 bygger på resultaten från en undersökning av svenskarnas attityder till och vanor kring att ta emot reklam i olika kanaler, främst direktreklam

Läs mer

Vi når mediebranschens beslutsfattare!

Vi når mediebranschens beslutsfattare! "Det närmaste DN Debatt man kommer för mediebranschen" Mikael Marklund Axel Andén Lisa Bjurwald Thomas Mattsson, chefredaktör Expressen Vi når mediebranschens beslutsfattare! n Medievärlden bevakar affärerna

Läs mer

Webbversion. Preheader. Maj på Kroken

Webbversion. Preheader. Maj på Kroken Preheader Webbversion Maj på Kroken Tiden för avslutningsmiddagar med kollegor och syjuntor är här, och vi på Kroken har minst sagt en fullspäckad agenda. I denna månad kommer stora hemligheter avslöjas.

Läs mer

8 sätt att öka engagemanget hos dina kunder med QR! Hur du kan använda QR-koder för att skapa nytta för er och värde för kunden.

8 sätt att öka engagemanget hos dina kunder med QR! Hur du kan använda QR-koder för att skapa nytta för er och värde för kunden. 8 sätt att öka engagemanget hos dina kunder med QR! Hur du kan använda QR-koder för att skapa nytta för er och värde för kunden. Innehållsförteckning 1. Introduktion 2. Actionkoder 3. Statistik 4. Värden

Läs mer

Email: david@davidhallstrom.se

Email: david@davidhallstrom.se David is the founder of 2 companies: Getfound and Pacific Fencing. Through his entrepreneurial career David has helped large corporations like Plan, ANZ Bank, Goodman and RipCurl make more money from the

Läs mer

Kommunikationsplan Samiska Apoteket

Kommunikationsplan Samiska Apoteket Kommunikationsplan Samiska Apoteket Kreatörer: Camilla Palm, Johan Skogqvist, Elin Leyonberg, Viyan Ateaa Målgrupp: Kvinnor mellan 35-60, intresserade av, kultur, historia, hälsa och hållbar utveckling.

Läs mer

Sioux-ordspråk: När du upptäcker att du rider en död häst, är den bästa strategin att hoppa av.

Sioux-ordspråk: När du upptäcker att du rider en död häst, är den bästa strategin att hoppa av. The Workshop i sammanfattning Why Your Returns Are Love I dag konsumeras mer och mer media samtidigt som konsumenter i allt större utsträckning anstränger sig för att undvika traditionell reklam. Fragmenteringen

Läs mer

RÄTT! Vi hjälper dig att välja. Denna bilaga handlar om Råd & Rön och hur vi gör våra tester. Riktiga tester som du kan lita på!

RÄTT! Vi hjälper dig att välja. Denna bilaga handlar om Råd & Rön och hur vi gör våra tester. Riktiga tester som du kan lita på! Vi hjälper dig att välja RÄTT! Denna bilaga handlar om Råd & Rön och hur vi gör våra tester. Riktiga tester som du kan lita på! Oberoende professionella tester Varje år får hundratals produkter genomgå

Läs mer

Ämne: Skogen i skolan 2012-03- 01 Datum: måndag den 5 mars 2012 kl. 16.08.50 Sverige Från: Foreningen_Skogen Till: Gunilla Häggström

Ämne: Skogen i skolan 2012-03- 01 Datum: måndag den 5 mars 2012 kl. 16.08.50 Sverige Från: Foreningen_Skogen Till: Gunilla Häggström måndag den 5 mars 2012 kl. 16.21.19 Sverige Ämne: Skogen i skolan 2012-03- 01 Datum: måndag den 5 mars 2012 kl. 16.08.50 Sverige Från: Foreningen_Skogen Till: Gunilla Häggström 2012-03-01 Om ditt nyhetsbrev

Läs mer

Riktlinjer för native advertising

Riktlinjer för native advertising Riktlinjer för native advertising www.iabsverige.se IAB Sverige 2014 Riktlinjer för native advertising Copyright IAB Sverige info@iabsverige.se www.iabsverige.se juni 2014 1 Innehållsförteckning 1. Introduktion

Läs mer

Event Revisionsintyg. Unikt Antal Besökare (UAB) 5 869. Definition

Event Revisionsintyg. Unikt Antal Besökare (UAB) 5 869. Definition EVENT Entreprenad Expo ARRANGÖR Mentor Communication/Leveranstidningen Entreprenad DATUM 25-27/9 2014 PLATS Borgeby Unikt Antal Besökare (UAB) 5 869 Definition Unikt antal besökare (UAB) är en summering

Läs mer

På Kryss håller drömmarna vid liv...

På Kryss håller drömmarna vid liv... mot nya horisonter På Kryss håller drömmarna vid liv... Om På Kryss På Kryss är tidningen för de riktigt inbitna båtlivsentusiasterna. Tidningen bjuder på allt från intressanta reportage om fascinerande

Läs mer

Bilden av. boras.com

Bilden av. boras.com Bilden av 27 april 2010 Vem vill bli vän med Borås Stad? Vi måste finnas där människor söker information. Dagens samhälle, 3 mars 2010 Succé för fullmäktige på webben När det gäller politiker och Internet

Läs mer

VECKANS AFFÄRER VÅRA LÄSARE RÄCKVIDD & UPPLAGA

VECKANS AFFÄRER VÅRA LÄSARE RÄCKVIDD & UPPLAGA VECKANS AFFÄRER Veckans Affärer är förstahandsvalet för näringslivet: Vi når nära 300 000 kvalificerade och köpstarka beslutsfattare inom svenskt näringsliv via vårt magasin, webb/mobil och nyhetsbrev.

Läs mer

VECKANS AFFÄRER VÅRA LÄSARE RÄCKVIDD & UPPLAGA

VECKANS AFFÄRER VÅRA LÄSARE RÄCKVIDD & UPPLAGA VECKANS AFFÄRER Veckans Affärer är förstahandsvalet för näringslivet: Vi når nära 300 000 kvalificerade och köpstarka beslutsfattare inom svenskt näringsliv via vårt magasin, webb/mobil och nyhetsbrev.

Läs mer

ANNONSINFORMATION. 1 januari 2016

ANNONSINFORMATION. 1 januari 2016 ANNONSINFORMATION 1 januari 2016 Under en vecka läser 205 000 personer VLT via tidningen, datorn, surfplattan eller mobiltelefonen. Genom att kombinera våra starka kanaler kan vi erbjuda ditt företag många

Läs mer

Fakta. Upplaga: Räckvidd: 51 000 läsare (Orvesto konsument 2009:2) Frekvens: 12 nr/år. Målgrupp

Fakta. Upplaga: Räckvidd: 51 000 läsare (Orvesto konsument 2009:2) Frekvens: 12 nr/år. Målgrupp Fakta Upplaga: 25 000 ex varav ca 6 500 är prenumeranter. Räckvidd: 51 000 läsare (Orvesto konsument 2009:2) Frekvens: 12 nr/år ANNONSpriser 2010 Målgrupp Privatpersoner Kamera&bild är valet för de privatpersoner,

Läs mer

KROGAR MOT KNARK 2014

KROGAR MOT KNARK 2014 1 KROGAR MOT KNARK 2014 Den 23 maj 2014 lanseras årets kampanj för Krogar Mot Knark. Vi på Bacill vill skapa en viral kampanj som bygger på festlig gemenskap och sprider glädje. En positiv gemenskap mot

Läs mer

Mirjamsdotter Media. Internet What s in it for you?

Mirjamsdotter Media. Internet What s in it for you? Internet What s in it for you? Sofia Mirjamsdotter Journalist med erfarenhet från radio, teve, tidning och webb Bloggare sedan 2005 Mamma till tre tonåringar Internetnörd Teknikrädd Jag bloggar Mirjamsdotter

Läs mer

Innehållsförteckning extrainsatt sommarnummer

Innehållsförteckning extrainsatt sommarnummer Nytt från Civilförsvarsförbundet Sverige #3.5 (utgivningsdag lördag 20 juni 2015) Kontaktuppgifter: E-post red@civil.se eller Box 2034, 169 02 Solna Materialet i detta nyhetsbrev är skyddat av upphovsrättslagen

Läs mer

SPRINGTIME NETWORK MEDIAFAKTA 2015

SPRINGTIME NETWORK MEDIAFAKTA 2015 MEDIAFAKTA 2015 RUNNERSWORLD.SE BICYCLING.SE WOMENSHEALTH.SE Världens största löpartidning 20 000 Prenumeranter 109 000 läsare (Orvesto) 48 000 Mailadresser 20 000 FB-fans 32 År i Sverige 12 + 2 ggr /

Läs mer

SPÄNNING, GEMENSKAP OCH UTVECKLING

SPÄNNING, GEMENSKAP OCH UTVECKLING SPÄNNING, GEMENSKAP OCH UTVECKLING 1 UNGA SOM GÖR VÄRLDEN BÄTTRE Scouterna ger över 65 000 barn och unga från alla delar av samhället chansen att uppleva äventyr tillsammans och växa som individer. Det

Läs mer

Future City 2014 2015. Så här kan ditt företag delta i Future City:

Future City 2014 2015. Så här kan ditt företag delta i Future City: Så här kan ditt företag delta i Future City: Future City 2014 2015 Guldarrangör, max sex Silverarrangör, max sex Partner Uppsats Partner Minecraft Dela ut ett pris, max tre Supporter Annonsering 100 000

Läs mer

MEDIAKIT 2014. Online // Magasin // Email. Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler!

MEDIAKIT 2014. Online // Magasin // Email. Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler! MEDIAKIT 2014 Online // Magasin // Email Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler! Vill du hitta rätt målgrupp och maxa ROI? Genom våra kanaler når du både brett och pricksäkert

Läs mer

VÄLKOMMEN! IAB, Interactive Advertising Bureau, the leading trade association in online marketing

VÄLKOMMEN! IAB, Interactive Advertising Bureau, the leading trade association in online marketing IAB, Interactive Advertising Bureau, the leading trade association in online marketing IAB Sverige verkar som en oberoende och transparent medlemsorganisation i Sverige VÄLKOMMEN! Charlotte Thür VD charlotte.thur@iabsverige.se

Läs mer

MEDIAKIT 2015. Online -Magasin - Email. Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler!

MEDIAKIT 2015. Online -Magasin - Email. Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler! MEDIAKIT 2015 Online -Magasin - Email Vill du nå var fjärde svensk man mellan 35-44 år? Annonsera i våra kanaler! Vill du hitta rätt målgrupp och maxa ROI? Genom våra kanaler når du både brett och pricksäkert

Läs mer

Strategi i sociala medier för att lyfta Region Västerbotten som organisation

Strategi i sociala medier för att lyfta Region Västerbotten som organisation Strategi i sociala medier för att lyfta Region Västerbotten som organisation Vi har i det här arbetet tagit fasta på några av de personlighetsdrag som kännetecknar Region Västerbotten. I uppdragsbeskrivningen

Läs mer

Annonsera i en av Sveriges största tidningar. Nå 1 miljon läsare.

Annonsera i en av Sveriges största tidningar. Nå 1 miljon läsare. INSPIRATION & ANNONSFAKTA 2015 ANNONSÖRERNA BERÄTTAR: Vi har sett väldigt goda resultat Annonsera i en av Sveriges största tidningar. Nå 1 miljon läsare. Kärlek till ämnet och gediget tidningsmakeri Vi

Läs mer

Acano cospace Solution

Acano cospace Solution Acano cospace Solution Acano Klienten Snabbstarts Guide Acano 1.0 October 2013 Innehåll Contents 1 Introduktion 3 2 Hålla en ad-hoc audio and video möte 4 3 Skapa ett cospace 5 4 Ansluta till ett cospace

Läs mer

Platsannonsera med Computer Sweden

Platsannonsera med Computer Sweden Hitta it-proffsen på rätt ställe Platsannonsera med Computer Sweden För att hitta rätt it-kompetens på en tuff marknad är det avgörande att välja rätt kanal för ditt rekryteringsbehov. Vi har över 30 års

Läs mer

Bakgrund. Mattias Rådström Vice President Global Social Media & PR

Bakgrund. Mattias Rådström Vice President Global Social Media & PR #Matprat i Almedalen Electrolux sociala mediebarometer om matprat under Almedalsveckan Datum: 2 juli 2014 Mattias Rådström, VP Global Social Media & PR Bakgrund Vi är glada att presentera dagens barometer

Läs mer

FRÅGOR OM DITT RESANDE NORMALT Här vill vi att ni svarar hur ni brukar resa, när ni INTE är med i tävlingen Pedal for Medal

FRÅGOR OM DITT RESANDE NORMALT Här vill vi att ni svarar hur ni brukar resa, när ni INTE är med i tävlingen Pedal for Medal Startenkät Pedal for Medal Hej deltagare i Pedal for Medal. Bra cyklat - kul att tävlingen kommit igång på allvar! Denna enkät är ett underlag för att se hur du och ditt lag förbättras under tävlingen.

Läs mer

KALAS. inspi ation och annat skoj. Nu strösslar vi världen med tårta och tatueringar!

KALAS. inspi ation och annat skoj. Nu strösslar vi världen med tårta och tatueringar! KALAS inspi ation och annat skoj NYHETSBREV MED INSPIRATION OCH ROLIGA TIPS FRÅN OSS PÅ EJVOR JANUARI 2016 NR 4 Nu strösslar vi världen med tårta och tatueringar! Lekfulla kalas, färgglada mönster och

Läs mer

STRATEGIER FÖR SOCIALA MEDIER KONSTEN ATT INTE GÖRA SAMMA SAK I ALLA KANALER. stakston.skl.projekt

STRATEGIER FÖR SOCIALA MEDIER KONSTEN ATT INTE GÖRA SAMMA SAK I ALLA KANALER. stakston.skl.projekt STRATEGIER FÖR SOCIALA MEDIER KONSTEN ATT INTE GÖRA SAMMA SAK I ALLA KANALER stakston.skl.projekt KOMMUNIKATION UR OMVÄRLDENS ÖGON Transparens Kunskapstörst Informationssökande Starka nätverk Värderingsbaserade

Läs mer

Annonsfakta & prislista. Sweden by Bike 2016

Annonsfakta & prislista. Sweden by Bike 2016 fakta & prislista Sweden by Bike 2016 ANNONSFAKTA & PRISLISTA Vill du nå ut till en av Sveriges mest hälsosamma, välutbildade och lyckliga kundgrupper? Sweden by Bike skapar en naturlig inkörsport - både

Läs mer

EFFEKTIVA PRESENTA- TIONER ARBETSBOK

EFFEKTIVA PRESENTA- TIONER ARBETSBOK EFFEKTIVA PRESENTA- TIONER ARBETSBOK Copyright Lorensbergs Organisationskonsulter AB Version LBG 5.1 SWE 2012 All rights reserved. No portion of this publication may be reproduced, distributed, stored

Läs mer

Matlagning vår tids identitetsmarkör

Matlagning vår tids identitetsmarkör Matlagning vår tids identitetsmarkör Svensken höjer sin status i köket Matlagning är hetare än någonsin. Tv-tablåerna är fyllda med olika matlagningsprogram, allt fler bloggar om sin matlagning och Instagram

Läs mer

Driva Eget - direktkanalen till Sveriges småföretagare

Driva Eget - direktkanalen till Sveriges småföretagare MEDIAPLAN 2014 Driva Eget - direktkanalen till Sveriges småföretagare - Ökar med 14 % Tidning Sajt Mobil Event FAKTA OM TIDNINGEN Småföretagare 0-10 anställda Når beslutsfattare och VD Utgåvor per år:

Läs mer

Nordens ledande kommunikations och logistikföretag

Nordens ledande kommunikations och logistikföretag PostNord Nordens ledande kommunikations och logistikföretag 2014 04 01 1 Hur började det? Axel Oxtienstierna 1636 Posten grundades 2014 04 01 2 Detta är PostNord Erbjuder kommunikations- och logistiklösningar

Läs mer

VAD ÄR CONTENT MARKETING?

VAD ÄR CONTENT MARKETING? VAD ÄR CONTENT MARKETING? Content marketing är kommunikation som är relevant och intressant för mottagaren. Det bygger på principen att själva INNEHÅLLET I SIG HAR ETT STORT VÄRDE för mottagaren. Genom

Läs mer

Relate Public Edition för sociala webbplatser och communitys. Relate Intranet Edition för intranät och extranät

Relate Public Edition för sociala webbplatser och communitys. Relate Intranet Edition för intranät och extranät Public Edition för sociala er och communitys Intranet Edition för intranät och extranät EPiServer gav oss den ideala grunden att bygga GOCityGirlsiten på. Genom att använda personaliserings- och communityverktygen

Läs mer

Målgrupper. Med målgrupper menar vi. Syfte. Målgrupperna. Vad händer inom fallskärmsvärlden?

Målgrupper. Med målgrupper menar vi. Syfte. Målgrupperna. Vad händer inom fallskärmsvärlden? Målgrupper Med målgrupper menar vi - Ett behovs- eller beteendemönster - i relation till fallskärmsförbundets kommunikation - som är relevant för vårt syfte Syfte - Transparens och insyn ger delaktighet,

Läs mer

IT-chefen 2011 Rapport om IT-chefens vardag på svenska företag

IT-chefen 2011 Rapport om IT-chefens vardag på svenska företag IT-chefen 211 Rapport om IT-chefens vardag på svenska företag J2246 Sofia Christiansson November 211 Sammanfattning Nästan tre fjärdedelar av IT-cheferna i undersökningen uppger att de lägger största delen

Läs mer

NYA VECKANS AFFARER VÅRA LÄSARE RÄCKVIDD & UPPLAGA

NYA VECKANS AFFARER VÅRA LÄSARE RÄCKVIDD & UPPLAGA NYA VECKANS AFFARER Nya Veckans Affärer är förstahandsvalet för näringslivet: Vi når 70 000 kvalificerade och köpstarka beslutsfattare inom svenskt näringsliv. I Veckans Affärer får de ny kunskap, nya

Läs mer

IAB, Interactive Advertising Bureau, the leading trade association in online marketing

IAB, Interactive Advertising Bureau, the leading trade association in online marketing IAB, Interactive Advertising Bureau, the leading trade association in online marketing IAB Sverige verkar som en oberoende och transparent medlemsorganisation Charlotte Thür charlotte.thur@iabsverige.se

Läs mer

ny vision för åmåls kommun

ny vision för åmåls kommun ny vision för åmåls kommun Introduktion och bakgrund Vårt förslag till vision för Åmåls kommun baseras på ett gediget grundarbete. Vi har tagit del av undersökningar och rapporter, medverkat vid möten,

Läs mer

De nya givarna. 2013-04-24 Frivilligorganisationernas Insamlingsråd. Mats Levin

De nya givarna. 2013-04-24 Frivilligorganisationernas Insamlingsråd. Mats Levin De nya givarna 2013-04-24 Frivilligorganisationernas Insamlingsråd Varför vintage? Befolkningsökning i olika åldersgrupper (%) Den unga marknaden är under nolltillväxt, medan den äldre växer. Således kommer

Läs mer

Din manual NOKIA 5140 http://sv.yourpdfguides.com/dref/821557

Din manual NOKIA 5140 http://sv.yourpdfguides.com/dref/821557 Du kan läsa rekommendationerna i instruktionsboken, den tekniska specifikationen eller installationsanvisningarna för NOKIA 5140. Du hittar svar på alla dina frågor i NOKIA 5140 instruktionsbok (information,

Läs mer

Future City 2016 2017. Så här kan ditt företag delta i Future City:

Future City 2016 2017. Så här kan ditt företag delta i Future City: Så här kan ditt företag delta i Future City: Future City 2016 2017 Guldarrangör, max sex 100 000 kr Silverarrangör, max sex 50 000 kr Bronsarrangör 25 000 kr Dela ut ett pris, max tre 15 000 kr Supporter

Läs mer

ORVESTO Employer Branding Hur och var når du dina framtida stjärnor?

ORVESTO Employer Branding Hur och var når du dina framtida stjärnor? ORVESTO Employer Branding Hur och var når du dina framtida stjärnor? I dagens hårda konkurrens om talangerna är det både utmanande och tidskrävande att rekrytera nya medarbetare. Det är svårt att hitta

Läs mer

Välkommen till andra upplagan av Mjölby Bomässa

Välkommen till andra upplagan av Mjölby Bomässa Välkommen till andra upplagan av Mjölby Bomässa Med E4:an precis vid knuten är Mjölby en del av den expansiva fjärde storstadsregionen och allt fler människor väljer att bosätta sig i kommunen. Här finns

Läs mer

Utveckling i antal träffar på ordet korvfestivalen i Google under Q1

Utveckling i antal träffar på ordet korvfestivalen i Google under Q1 Hej! Här kommer en kort rapport om hur Korvfestivalen synts i digitala och sociala kanaler under första kvartalet samt fokus på i mars och själva festivalen. Korvfestivalens synlighet i Google under Q1

Läs mer