Förfrågningsunderlag/! Ramavtal'för$senior'projektledning-vid- Lindholmen*Science*Park!

Storlek: px
Starta visningen från sidan:

Download "Förfrågningsunderlag/! Ramavtal'för$senior'projektledning-vid- Lindholmen*Science*Park!"


1 FÖRFRÅGNINGSUNDERLAG TJÄNSTER Refnr:LSP Förfrågningsunderlag/ Ramavtal'för$senior'projektledning-vid- Lindholmen*Science*Park Härmed'inbjuds'ni'att'lämna'anbud'enligt'nedan'angina'förutsättningar' ' ' ' ' ' Anbudstidenutgår kl.12:00 Bindningstidtill Svarapå/kommenteraallaefterfrågadeuppgifter Anbudsgivaremåsteaccepterasamtligaskallkravenligtbilaga1i underlagetförattkunnakommaifrågasomleverantör. Uppdragsbeskrivningochutvärderingskriterierfinnsibilaga2. LindholmenScienceParkABäreninternationellteknikparkmedinriktningmot treområden: MobiltInternet Intelligentafordonochtransportsystem Modernmediaochdesign Ivårmiljösamverkaraktörerfrånnäringsliv,högskolaochsamhälle.Deprojekt ochuppdragsomdrivsinomlindholmenscienceparkkännetecknasav gränsöverskridandesamarbete,bådegällandekompetens,organisationoch mellanolikaländer. Vårverksamhethartillstörstadelenenindustriellochkommersiellkaraktär, menvissaavvårauppdragdrivsmedsyftetatttillgodosebehovidetallmännas intresse.isådanafalldäruppdragetärdirektriktattilldetallmännasintresse ochviintehindrasavforskningsrelateradeochimmateriellaskälskervåra upphandlingarienlighetmedprinciperföroffentligupphandling. LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

2 OpenArenaLindholmenärenneutralmötesplatsförvårasamarbetspartners ochutgörbasenfördeprogramochprojektsominitierasochdrivspå LindholmenSciencePark. Lindholmen'Science'Park'har'inom'programmen'Test'Site'Sweden,'Closer' och'security'arena'behov'av'att'avropa'projektledningstjänster,'enligt' uppdragsbeskrivning'i'bilaga'2,'för'ledning'av'samverkansprojekt'inom' följande'tre'områden:'' ' Fordonsteknik' Transporteffektivitet/logistik'' Samhällssäkerhet' Transport' Test'Site'Sweden(www.testsitesweden.com)harsyftetattutveckla världsledandetest9ochdemomiljöerförtransportteknikinomområdenamiljö, säkerhet,transporteffektivitetochvinterprovning. CLOSERärennationellarenainomtransporteffektivitet.Closerstödjerframtida forsknings9ochutvecklingsprojektinomindustri,samhälleochakademisamt främjarensvenskvisionförökadtransporteffektivitet.verksamhetenfokuserar pånationellaochinternationellademonstrationsprojekt,därviinitierar,stödjer, bemannarochsamordnarprojekt. ' Samhällssäkerhet' Security'ArenaharsyftetattstärkaSverigesförmågaatthanterakriseroch förbättrasamhälletsmöjligheterattklaraallvarligahotochstörningar.security Arenaerbjuderenneutralsamverkansmiljöförforskningochutvecklingsprojekt inomsamhällssäkerhet. TUCAP'ärettteknisktutvecklingscentermedfokuspåmoderninformations9och kommunikationstekniksomskastödjaocheffektiviseraambulansalarmering ochprehospitalvård(sjukvårdsomutförsinnanankomsttillsjukhus). Merinformationhittardupåwww.lindholmen.sesamtibilaga6. Annons'finns'på'webbplatsen:'http://www.lindholmen.se/upphandling' LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

3 1 Anbudsanvisningar 1.1 Upphandlande enhet Lindholmen'Science'Park'AB Box8077,SE940278Göteborg,Sverige Tel Kontaktpersoner Upphandlingsfrågor: Övrigafrågor: PeterÖhman NiklasWahlberg Tel Tel Upphandlingsform DennaupphandlinggenomförssomöppenupphandlingenligtLAG(2007:1091) omoffentligupphandling,louochavserentjänsteupphandling/ramavtal. LindholmenScienceParkABavseratttecknaramavtalmedhögstsexton(16) leverantörer. Upphandlingenskerinomtreteknikområden: Fordonsteknik, Transporteffektivitet/logistik Samhällssäkerhet. Avtaltecknasmedleverantörerperområde(enleverantörkantecknasmotflera områden)enligt: Fordonsteknik:Högst6leverantörer Transporteffektivitet/logistik:Högst5leverantörer Samhällssäkerhet:Högst5leverantörer Upphandlingenären'öppenupphandlingdärallaleverantörerharrättattdelta. Deltagandeleverantörerskalämnaskriftligaanbud. 1.4 Upphandlingens volym och omfattning Dethögstasammanlagdavärdetavsamtligakontrakt(avrop)somkankomma attskeär25msek.lindholmenscienceparkgaranteraringenuppdragsvolym underprojektperioden. LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

4 1.5 Utformning Anbudetskallutformasienlighetmedbilaga3påsådantsättattdetmöjliggören utvärderingrelaterattillvadsomangesikravspecifikationen(bilaga1och2). Samtligapunkterikravspecifikationenskallbelysas/redovisas/kommenteras. OmdetfinnsoklarheteriförfrågningsunderlagetmåsteLindholmenScience Parkkontaktassnarastmöjligtochinomanbudstidensutgång. 1.6 Adress och tid för inlämning AnbudskallvaraankommettillLindholmenScienceParksenast kl.12:00.anbudsgivareansvararförattanbudinkommerirätttid.försent inkomnaanbudtasinteupptillprövning. 1.7 Märkning Anbudsförsändelsenskallmärkas"AnbudLSP Anbudslämnande Anbudlämnastill: Peter%Öhman% Lindholmen%Science%Park%AB% Box%8077,%SE;402%78%Göteborg 1.9 Frågor och svar Eventuellafrågoromupphandlingenskallställastill Frågorochsvarkommerattpublicerasoffentligtefter3arbetsdagarpå hemsidan:http://www.lindholmen.se/upphandling Leverantöransvararsjälvförattkontrolleraomnågraförtydligandenoch kompletteringargörsianbudsunderlaget Språk och valuta AnbudskallvarapåsvenskaochpriserlämnadeisvenskvalutaSEK Till anbudet skall bifogas Dokumentenligtbilaga Anbudets giltighetstid Anbudetskallvaragiltigtochfulltbindandeföranbudsgivarentillochmed LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

5 1.13 Leverantörsförbindelse Leverantörenförbindersigattunderanbudetsgiltighetstidpåbegäranav LindholmenScienceParkundertecknaupphandlingskontrakt(avtal)ienlighet medangivetanbudochvadsomöverenskommitsvideventuellaförhandlingar medlindholmensciencepark.avtalslutsförstgenomdetta upphandlingskontrakt. Avanbudetskallframgåhuranbudsgivarenmöterkraven(bilaga1ochbilaga 2),d.v.s.eventuellaförslagtilländringar/kompletteringaravavtalstextskall angesianbudet. 2 Utvärdering Detlämnadeskriftligaanbudetärdetendasomliggertillgrundförutvärdering ochbeslutvidvalavleverantör.beslutetkankommaatttasutanförhandling varföroptimalavillkorbörlämnasredanidetskriftligaanbudet.lindholmen ScienceParkförbehållersigdockmöjlighetenattkallaanbudsgivaretill personligtmöteförytterligareklargörandeavanbudisambandmed utvärderingen. Anbudetmåsteinnehållasamtligaefterfrågadeuppgifterienlighetmedbilaga3. Omanbudsgivareavstårfrånattsvarapåefterfrågaduppgiftkandettakomma atttolkassomomkravetinteuppfylls. 2.1 Uteslutning av leverantör UteslutningavleverantörfråndeltagandeiupphandlingreglerasenligtLOU15 Kap, Referenser Enligtbilaga1skallanbudetskall'innehållaenreferenslistaförverksamhet motsvarandedeniförfrågningsunderlagetefterfrågade.vidbedömningav anbudetkanstickprovblandreferensernagörasförattverifieradeuppgifter somlämnatsianbudet.referenserskalämnasförattlindholmensciencepark skakunnabedömaanbudsgivarenskvalifikationerförgenomförandeav upphandlingensamtomdeomfattardentypavtjänstersomefterfrågasavde medverkande. LindholmenScienceParkkanävenkommaattanvändaegnareferenserföratt verifieradesvarsomlämnatsianbudet.eventuelltkommerbesökattgörashos anbudsgivarenförattverifierasvar.ettalternativkanvaraattanbudsgivaren kallastilllindholmenscienceparkförattverifierasvar.anbudsgivareskall därförhaberedskapfördetta. 2.3 Bedömning av anbud Bedömningenskerienkvalificerandefasochienutvärderingsfas. LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

6 Deibilagan1begärdaskall9kravskallvarauppfyllda. Deanbudsgivaresomuppfyllersamtligakravgårvidaretillutvärderingsfasen. Deanbudsominteuppfyllerallaställdaskall9krav'ellerärofullständigapåannat sättkankommaattuteslutasfrånutvärderingsfasen. Kvalificeringsfas- Utvärderingsfas- Iutvärderingsfasenkommerprövningattskeenligtprincipendet'ekonomiskt' mest'fördelaktiga'(här'avses'förmåga'att'skapa'värde'enligt'krav'i'bilaga'2' vs.'pris)'per'område'(fordonsteknik,'transporteffektivitet/logistik'och' samhällssäkerhet). Utvärderingenkommerattgörasperområdemedhänsyntillkriterierna specificeradeibilaga2.avtalkommeratttecknasmeddeleverantörerper områdesomfåtthögstviktadpoängsättningstörreän3poäng(maxantal leverantörerperområdeangesikapitel1.3). Kriterie'förkompetensinomforskningochutvecklinggesperområdena: Fordonsteknik Transporteffektivitet/logistik Samhällssäkerhet Kostnadspåverkandereservationerskallvaraprissattaannarskananbudet förkastas. 3 Omfattning Kravspecifikationochuppdragsbeskrivningåterfinnsibilaga1ochbilaga Hela eller delar Anbudkanendastantasisinhelhet. 3.2 Systemdokumentation LeverantörenskagaranteraLindholmenScienceParkrättighetentillkällkoder, registerlayouteretc.vidleverantörenskonkurs,nedlagdaverksamhetellerannat likvärdigtförhållande. 3.3 Nyttjanderätt LindholmenScienceParkskallägafullkostnadsfrinyttjanderättoch underlicensieringsrätt,utantidsbegränsning,tilliuppdragetutveckladhårdvara ochprogramvarainklusiveritningar,källkodochallisammanhangetframställd dokumentation. LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

7 LindholmenScienceParkskallägarättattkopieradokumentationiönskatantal föregetbruk. 3.4 Underleverantörer LindholmenScienceParkförbehållersigrättenattgodkännaanbudsgivarens eventuellaunderleverantörer. 3.5 Sidoanbud Kompletteringaravfunktionsbeskrivningar,somintetäcksav kravspecifikationen,ochsomäravväsentligtintresseförutvärderingen,får bifogassomsidoanbudmenkommerinteattpåverkaanbudsutvärderingen. 4 Allmänt 4.1 Avtalstid Avtaletberäknasgällaframtilloch ellerdetdatumdåmaximalt avropsbelopp(25msek)uppnåttsberoendepåvilketsominträffarförstoch trädaikraftsåsnartupphandlingenärslutförd. 4.2 Pris Leverantörenskaangenettopris.Priserskallangesexklusivemervärdeskatt. Prisskagällafast,utanindexregleringframtillochmed Statistik Leverantörenskaengångperårsamtvidbegäran,kostnadsfrittlämnastatistik övernyttjandetavavtalet. 4.4 Tvist Tvistmedanledningavkommandeavtalstillkomst,tillämpningellertolkning skaiförstahandlösasgenomförhandlingocheventuellmedlingparterna emellan.däroenighetfortfarandekvarstårskatvistavgörasavdomstoli Göteborgmedtillämpningavsvenskrätt.Iavvaktanpåatttvistlöseshar LindholmenScienceParktolkningsföreträde. LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

8 4.5 Hävande LindholmenScienceParkägerrättatthävatecknatavtalmedomedelbarverkan: Omleverantöreniväsentligthänseendeinteutförsinaåtagandenoch rättelseinteskerutandröjsmålefterskriftligpåminnelse. Omleverantörenförsättsikonkurs,likvidationellerförövrigtärpå sådantobeståndattdenneintekanförväntasfullgörasinaskyldigheter. Omleverantörenintebetalarskatterellerfullgörandraförpliktelser gentemotdetallmännasomföljeravlagellerlagakraftvunnendomeller domslut. Omleverantöreninteinneharföruppdragetsutförandenödvändiga tillståndochgodkännandenochinteomedelbartinförskaffarsådant. Leverantörenägerrättatthävatecknatavtalmedomedelbarverkan: OmLindholmenScienceParkiväsentligthänseendelåterbliattfullgöra sinaåtagandenochrättelserinteskerutandröjsmålefterskriftlig påminnelse. 4.6 Offentlighet, sekretess Uppgifteriettupphandlingsärendeomfattasavkommersiellsekretessenligt sekretesslagentilldessallaanbudellererbjudandenoffentliggörsellerbeslutom leverantörochanbudfattatsellerärendetdessförinnanharslutförts. Uppgifternakanocksåomfattasavsekretessävenefternämndatidpunkt.För anbudsgivaregällerattuppgiftersomavserdennesaffärs9eller driftförhållandenkandessaomfattasavkommersiellsekretessomdetav särskildanledningkanantasattanbudsgivarenliderskadaomuppgifternaröjs. Omanbudsgivarenanserattdeuppgifteranbudsgivarenlämnati upphandlingsärendetuppfyllervadsomerfordrasenligtovanförkommersiell sekretess,böranbudsgivarenskriftligeninkommamedenbegäranom kommersiellsekretess.dennabegäranskallinnehållaenpreciseringomvilka uppgiftersomavsessamtvilkenskadasomanbudsgivarenskulleåsamkasom uppgifternaröjs. LindholmenScienceParkkandockintegaranteraattenhandlingblir sekretessbelagd,dåbeslutetomsekretessalltidkanöverklagastillochbliprövat idomstolochdomstolenkanbeslutaomatthandlingeninteskallvara sekretessbelagd. LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

9 4.7 Förbehåll LindholmenScienceParksundertecknandeavupphandlingskontraktet(avtalet) planerasinteskeförräntidenföröverprövningenligt7kap.192 LOUpasserat. LindholmenScienceParksundertecknandeärenförutsättningförbundenhetav avtalet. 5 Bilagor Bilaga1 Bilaga2 Bilaga3 Bilaga4 Bilaga5 Bilaga6 % Skallkrav Utvärderingskriterier Formulärochdokumentlista Typavtal Typavrop SnabbfaktaLindholmenSciencePark LindholmenScienceParkAB Box8077,SE940278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

10 Refnr:LSP Bilaga&1:&Skallkrav& Krav%på%resurser%som%erbjuds%vid%avrop%som%skall%vara%uppfyllda% De projektledare som erbjuds skall ha minst 3 års erfarenhet av projektledning inom relevant område god kompetens inom relevant område civ. ing. examen eller motsvarande erfarenhet av projektledning av internationella projekt dokumenterad förmåga att arbeta strukturerat och rapportera god vandel mycket god förmåga att uttrycka sig på svenska och engelska Krav%på%anbudsgivaren%som%skall%vara%uppfyllda% Samtligabegärdadokumentenligtbilaga3 Bolagsformskallvaraaktiebolag

11 Refnr:LSP Bilaga&2:&Uppdragsbeskrivning&och&Utvärderingskriterier&& Uppdragsbeskrivning. Leverantören skall primärt genomföra följande arbete inom ramen för Lindholmen Science Park: Leda och kvalitetssäkra nationella och internationella projekt vid Lindholmen Science Park bestående av ett antal olika partners. Sammankalla, leda och dokumentera projektmöten, styrgruppsmöten och referensgruppsmöten Ansvara för att projekteten genomförs inom projekttiden och inom budget Rapportera projektens tekniska och finansiella status till finansiärer Utvärderingskriterier. Kriteriernapoängsättsomannatejangespåenskalafrånfem(5)tillett(1)enligt följande: 5poäng 4poäng 3poäng: 2poäng: 1poäng mycketvälgodkänt,mervärde välgodkänt,överförväntan godkänt,enligtförväntan medtvekangodkänt,underförväntan ickegodkänt,kvalitetsbrister & Kriterier& Poäng& Vikt& K1 Dokumenteraderfarenhetavattplaneraochleda samverkansprojektmellanmyndigheter,akademioch privataaktörer(sk. TripleHelix ) K2 Kompetensinomrespektiveområde.Sepoängbedömningi kapitlennedan. (Ianbudetbilaga6angesvilkaområdenanbudetgäller.) K3 Dokumenteraderfarenhetavattdrivautvecklingsprojekt ochstruktureratarbete/rapportering % % % K4 Prispertimme: % & Referenspriser&per&område: Fordonsteknik: Transporteffektivitet/logistik: Samhällssäkerhet: (Ianbudetbilaga6redovisasprispertimme fördeområdenanbudetgäller) 650kr/timme 750kr/timme 750kr/timme Totalt&poäng&fås&genom&viktad&summering&av&ovanstående&poäng&

12 Refnr:LSP Kriteriet&K4&(pris):&Priserpoängsättsenligtföljandemodell,fempoängtilldetprissom ärbilligareellerlikamedreferenspriset(sek4ovan)somärspecificeratförrespektive kompetensområdeochettpoängtilldubblareferensprisetochdäremellanlinjärt sambandenligtformel:poäng=5+((y+x)/x)*4,därxärreferensprisetochyärjämfört pris.detprissomjämförsärangivettimpris.denslutligapoängenhamnariintervallet 1+5ochkanalltsåinteblinegativ. Kostnadspåverkandereservationerskallvaraprissattaannarskananbudetförkastas. Avtalkommeratttecknasmeddeleverantörerperområdesomfåtthögstviktad poängsättningstörreän3poäng(maxantalleverantörerperområdeangesikapitel 1.3).Omfleraleverantörerfårsammapoäng,rangordnasdeefterlägstprispertimme. Bedömning.av.kompetens.inom.området.fordonsteknik.(K2). Delkriterie& Poäng& Vikt& Kunskapocherfarenhetavelektromobilitet % KunskapocherfarenhetavfordonsrelateradeEUprojekt % Kunskapocherfarenhetavtekniskautvecklingsprojekt rörandefordon % Kunskapocherfarenhetavfordonsprovning % Godakontakterochnätverkinomområdet % Delpoäng&för&K2&fås&genom&viktad&summering&av&ovanstående&poäng.& Bedömning.av.kompetens.inom.området. transporteffektivitet/logistik.(k2). Delkriterie Poäng Vikt KunskapocherfarenhetavattledaochadministreraEU+projekt inomtransportområdet Kunskapocherfarenhetavprojektledninginomlogistikoch transportpåettellerfleraavcloser stemaområden:high CapacityTransports,GreenCorridorsresp.UrbanTransport % % Godakontakterochnätverkinomrelevantaområden % Delpoäng&för&K2&fås&genom&viktad&summering&av&ovanstående&poäng.

13 Refnr:LSP Bedömning.av.kompetens.inom.området.samhällssäkerhet.(K2). Delkriterie Poäng Vikt Godakontakterochnätverkinommyndighetssektorniområdet % KunskapocherfarenhetavattledaochadministreraEUprojekt inomområdet ErfarenhetavsamarbetemedMyndighetenförsamhällsskydd ochberedskap(msb) % % Erfarenhetavtriplehelixarbeteinomområdet % Delpoäng&för&K2&fås&genom&viktad&summering&av&ovanstående&poäng.&

14 Bilaga3 Efterfrågade uppgifter till upphandling LSP Refnr:LSP Anbudsgivareskallredovisaföljande(förutländskaanbudsgivaregäller motsvarandeofficielldokumentation): I bilaga 1 redovisas IfylldblankettSKV4820(ejäldreänenmånad)därdetskallframgåattskatter ochsocialaavgifterbetalatssamtattanbudsgivarenfinnsregistreradeiett officiellthandelsregister. I bilaga 2 redovisas Attintressentenharengodkreditvärdighetenligtkreditupplysningsinstitut.Vid kontrollfårejfinnasskuldsaldotillskattemyndighetoch/ellerkronofogden. I bilaga 3 redovisas RegistreringsbevisfrånBolagsverket. I bilaga 4 redovisas RegisterutdragfrånSkatteverketsomvisarattanbudsgivarenärgodkändförF+ skattochärredovisningsskyldigförmervärdesskatt. I bilaga 5 redovisas Enkortfattadbeskrivningavföretagetochdessverksamhet. I bilaga 6 redovisas VilkaavdeområdeniLSP somdetlämnasanbudpå Timarvoden(perområde)exklusivemervärdesskattförprojektledare enligtuppdragsbeskrivninglsp I bilaga 7 redovisas Vilkenerfarenhetochkompetens(perområde)somfinnshosanbudsgivaren inomdeområdensomanbudetomfattar.specielltskalltydligtredovisashurväl deolikautvärderingskriteriernailsp uppfylls. I bilaga 8 redovisas Relevantkontaktnät(perområde)somfinnshosanbudsgivaren. LINDHOLMENSCIENCEPARKAB Box8077,SE+40278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

15 I bilaga 9 redovisas Refnr:LSP Maximalttrereferenser(perområde)förföretagetpåliknadeuppdragsom utförtsunderdensenastefemårsperioden.referensernaskallinnehålla beskrivningavuppdraget,referensperson,organisationsamttelefonnummer. I bilaga 10 redovisas ReferenserochCV(max3perområde)förföreslagnapersonersomstyrker erfarenhetfrånliknadeuppdrag.referensenskallomfattanamnpåperson, telefonnummer,beskrivningavuppdraget. I bilaga 11 redovisas Övrigaanbudsuppgifterrelevantaföruppdraget LINDHOLMENSCIENCEPARKAB Box8077,SE+40278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

16 Refnr:LSP FRÅGORANGÅENDEANBUDETBESVARASAV:... Telefon... Mobil... Fax... E+post Ort Datum Anbudsgivare/företag Organisationsnr Adress Postnummer... Underskriftavansvarig... Namnförtydligande LINDHOLMENSCIENCEPARKAB Box8077,SE+40278Göteborg, Sweden VisitorsaddressLindholmspiren5 Tel+46(0) Fax+46(0)

17 Refnr: LSP Bilaga 4: Typramavtal Ramavtal mellan Lindholmen Science Park AB och PARTNER X Mellan Lindholmen Science Park AB (KUNDEN), org.nr , Box 8077, och PARTNER X (LEVERANTÖREN) har följande ramavtal tecknats. Bakgrund KUNDEN driver samverkansprojekt vilket beskrivs i upphandlingsunderlag LSP KUNDEN har behov av att avropa projektledningstjänster i ovan nämnda verksamhet. Uppdragsbeskrivning Enligt upphandlingsförfrågan (inklusie bilagor) referens LSP Genomförande och omfattning Ramavtalet gäller tom KUNDEN förbinder sig inte att upphandla någon volym av PARTNER X PARTNER X förbinder sig att kunna tillhandahålla minst 500 timmar projektledningstimmar fram till till fast timpris enligt paragrafen Arvode nedan. Arvode Arbete utförs av PARTNER X med timkostnad på XXX kr efter det av avropsavtal slutits mellan KUNDEN och PARTNER X. Villkor Enligt upphandlingsförfrågan (inklusive bilagor) referens LSP Övrigt Resultat redovisas enligt avropsavtal för respektive avrop Avropsförfrågan sker minst tre månader innan delprojektstart Resor och logi inom ramen för delprojekt bokas och betalas av KUNDEN. KUNDEN har rätt att fritt välja leverantör bland de som tecknat ramavtal i upphandlingen referens LSP Detta avtal har upprättats i två likalydande exemplar varav parterna tagit varsitt. Göteborg Stad Niklas Wahlberg Lindholmen Science Park AB xxx PARTNER X

18 Refnr: LSP BILAGA 5 Typavtal: Typavtal för avrop mellan Lindholmen Science Park AB och Partner X Mellan Lindholmen Science Park AB (KUNDEN), org.nr , Box 8077, och PARTNERX (LEVERANTÖREN) har följande beställning (avrop enligt ramavtal) tecknats. Bakgrund Detta är ett avrop i enligt med det ramavtal (REFERENS till Ramavtal) som KUNDEN och LEVERANTÖREN har ingått. Uppdragsbeskrivning I detta stycke beskrivs delprojektet och det specifika delprojektledningsuppdraget. Genomförande och omfattning Arbetet genomförs av LEVERANTÖREN under perioden DATUM_1 till DATUM_2 LSP avropar XXX timmar från LEVERANTÖREN till pris per timme enligt ramavtal (REFERENS) Arbetet utförs enligt krav ställda i ramupphandlingsavtalet (REFRENS) Betalningsvillkor Fakturering sker enligt ramavtal (REFRENS). Slutfaktura skall vara KUNDEN tillhanda senast 1 månad efter avslutat uppdrag, dock senast DATUM_3 Fakturan skall innehålla en tidsredovisning per aktivitet över upparbetad tid Faktura ska innehålla uppgifter om kostnadsställe, beställarens namn och projektnummer. Av fakturan skall framgå momsredovisningsnummer och att bolaget innehar F- skattsedel. Fakturering får inte överlåtas på tredje part. Fakturerings-, expeditions-, eller motsvarande avgifter godkänns inte. Eventuell dröjsmålsränta ska debiteras enligt räntelagens bestämmelser. Dröjsmålsräntor understigande 50 kr per faktura beaktas inte. Leverantören fakturerar i efterskott månadsvis motsvarade värdet av utfört arbete. Utbetalning sker 30 dagar efter godkänd faktura. Märk fakturan: XXX Redovisning Följande leverabler skall vara slutförda för att projektet skall vara godkänt: o Lista över delprojektunika resultat Detta avtal har upprättats i två likalydande exemplar varav parterna tagit varsitt. Göteborg Lindholmen Science Park AB Stad Y Partner X


20 En kreativ miljö för samverkan Lindholmen Science Park är en världsledande arena för forskning, innovation och utbildning inom: Mobilt internet Intelligenta fordon och transportsystem Modern media och design Internationell mötesplats för ny teknik Lindholmen Science Park erbjuder näringsliv, högskola och samhällsaktörer en internationell utvecklingsmiljö och tillgång till ett värdefullt nätverk. Genom att mäkla och leda projekt samt erbjuda öppna test- och utvecklingsmiljöer så stimulerar vi samverkan och skapar tillväxt och konkurrenskraft för Västsverige. Lindholmen Science Park AB Bakom utvecklingsmiljön i Lindholmen Science Park finns bolaget Lindholmen Science Park AB som ansvarar för varumärket och den strategiska utvecklingen. Bolaget är en partner i många projekt som kräver samverkan utöver gränser, bland annat i flera EU-finansierade utvecklingsprojekt. Ett av bolagets huvudsyften är att skapa förutsättningar för samverkan mellan näringsliv, högskola och samhälle, både på det nationella och internationella planet. Lindholmen Science Park AB:s största partners är: Göteborgs Stad, Volvo Group, Volvo Cars, Chalmers tekniska högskola, Göteborgs universitet, Business Region Göteborg, Ericsson, Saab AB, Telenor Sverige AB, Trafikverket. För områdets fysiska utveckling ansvarar Älvstranden Utveckling AB, helägt av Göteborgs Stad.

21 Arenor för forskning och utvecklingsprojekt Open Arena Lindholmen är en neutral mötesplats för våra samarbetspartners. På Open Arena möts olika forskare, företagare, studenter, kreatörer och projektledare. Här finns mötesytor, testmiljöer, labb och avancerad IT-infrastruktur. Open Arena Lindholmen utgör också basen för de program och projekt som initieras och drivs på Lindholmen Science Park: Security Arena Safety Arena Media Arena Visual Arena Test Site Sweden TUCAP Closer CISB Sweden Läs mer på

22 På Lindholmen utvecklas det nya Göteborg Lindholmen Science Park är en viktig del av Centrala Älvstadens utveckling. På Lindholmen finns det mer än 300 företag med 9700 anställda, där de största arbetsgivarna är Ericsson, Volvo Technology, IBM, Semcon, Sigma och SVT. På Campus Lindholmen finns Göteborgs universitet, Chalmers tekniska högskola och det gemensamma ITuniversitetet. Totalt är ca studerande, forskare och lärare verksamma på Campus Lindholmen personer 2020 Det långsiktiga målet är att Lindholmen år 2020 ska befolkas av människor. Den starka expansionen fortsätter 2012, med byggnation av ett stort hotell och ett p-hus vid huvudbyggnaden. Ett nytt kontorshus byggs samtidigt på andra sidan Lindholmshamnen. Samtidigt expanderar mediaområdet när Gothenburg Film Studios, med 45 företag, fortsätter sin positiva utveckling. Box 8077, Göteborg. Besök: Lindholmspiren 5. Tel: Webb:

Avtal. Parter: Avtal - Skor 2012 Backlunds. 1. Avtalsvillkor. Arbetsskor 2012-Backlunds Referensnr: Dnr 2012/96. Avtalets namn:

Avtal. Parter: Avtal - Skor 2012 Backlunds. 1. Avtalsvillkor. Arbetsskor 2012-Backlunds Referensnr: Dnr 2012/96. Avtalets namn: Avtal Avtalets namn: Upphandling: Startdatum: Arbetsskor 2012-Backlunds Referensnr: Dnr 2012/96 Arbetsskor 2012 Upph. ref.nr: Dnr 2012/96 2013-01-01 Slutdatum: 2014-12-31 Typ av avtal: Ramavtal Förlängning:

Läs mer

Förfrågningsunderlag. Förstudie Teknikindustrin. LULEÅ NÄRINGSLIV AB Kyrkogatan 13 972 32 Luleå. www.luleanaringsliv.se

Förfrågningsunderlag. Förstudie Teknikindustrin. LULEÅ NÄRINGSLIV AB Kyrkogatan 13 972 32 Luleå. www.luleanaringsliv.se Förfrågningsunderlag Förstudie Teknikindustrin LULEÅ NÄRINGSLIV AB Kyrkogatan 13 972 32 Luleå www.luleanaringsliv.se 1 Allmänt 1.1 Om Luleå Näringsliv AB Luleå Näringsliv AB är ett näringslivsbolag ägt

Läs mer

Avtalsvillkor massage, bilaga 2

Avtalsvillkor massage, bilaga 2 Datum: 2011-11-28 1 (5) Avtalsvillkor massage, bilaga 2 Skolinspektionen. Box 23069. 104 35 Stockholm. Telefon växel: 08-586 080 00, www.skolinspektionen.se 2 (5) Beställare: Leverantör (fylls i av leverantör):

Läs mer

Leverantör för följeforskning av Projekt Moving Media Southern Sweden. Handling 1 Ramavtal. Koncerninköp

Leverantör för följeforskning av Projekt Moving Media Southern Sweden. Handling 1 Ramavtal. Koncerninköp Koncerninköp Per Löwhagen Inköpare 0704-200302 per.lowhagen@swepro.se Datum 2009-04-05 Diarienr 0900930 1 (9) Leverantör för följeforskning av Projekt Moving Media Southern Sweden Handling 1 Ramavtal Koncerninköp

Läs mer

5. Övriga uppgifter enligt anvisning i anbudsformulär.

5. Övriga uppgifter enligt anvisning i anbudsformulär. 1(6) Anbudsinbjudan - Extern utvärderare i projekt Eksjö är ett mecka för behandlingshem. Eksjö kommun, Eksjö Högskolecenter, inbjuder Er till att lämna anbud på en tjänst som Extern utvärderare i ett

Läs mer

Avropsförfrågan/anbudsformulär. Gismo med GeoPanelen till Tyresö kommun

Avropsförfrågan/anbudsformulär. Gismo med GeoPanelen till Tyresö kommun 1 (10) Avropsförfrågan/anbudsformulär Gismo med GeoPanelen till Tyresö kommun 2 (10) Innehåll 1 Anbudsförfrågan... 3 2 Anbudsformulär... 5 3 Leveransavtal... 7 4 Tillägg... 10 3 (10) 1 ANBUDSFÖRFRÅGAN

Läs mer

Stockholms läns landsting Ramavtal gällande projekterande konsulter El, Allmäntele och Fastighetsnät för informationsöverföring

Stockholms läns landsting Ramavtal gällande projekterande konsulter El, Allmäntele och Fastighetsnät för informationsöverföring 1(5) Stockholms läns landsting Ramavtal gällande projekterande konsulter El, Allmäntele och Fastighetsnät för informationsöverföring Konsult Ramböll Sverige AB (org.nr: 556133-0506) Krukmakargatan 21 104

Läs mer

Direktupphandling Projektledning Guldfesten

Direktupphandling Projektledning Guldfesten Handläggare Datum Linda Petersson 15 2015-03-25 Offertförfrågan till direktupphandling Direktupphandling Projektledning Guldfesten Allmänna föreskrifter Ni inbjuds inkomma med offert avseende projektledning

Läs mer


Bilaga 1 -Ramavtal RAMAVTAL UTBILDNING OMVÅRDNADSLYFTET RAMAVTAL UTBILDNING OMVÅRDNADSLYFTET 1 Ramavtal 1.1 Allmänt Staffanstorps kommun avser att från och med 1 januari 2013, genomföra ett brett upplagt utbildningspaket för utvald personal av kommunen, inom

Läs mer

Se bilaga 1. Prislista. Priserna som anges är takpris och Leverantören ska kunna offerera nya system under förutsättning att Cisco producerar dessa.

Se bilaga 1. Prislista. Priserna som anges är takpris och Leverantören ska kunna offerera nya system under förutsättning att Cisco producerar dessa. 1 Ramavtal Detta ramavtal med dnr har träffats mellan Domstolsverket med organisationsnummer 202100-2742 och Företagsnamn med organisationsnummer Organisationsnummer. 2 Omfattning Ramavtalet omfattar Cisco

Läs mer

Offertförfrågan avseende utvärdering av projektet Utsikt & Insikt

Offertförfrågan avseende utvärdering av projektet Utsikt & Insikt 2012-02-20 Dnr: 2011-3030028. Offertförfrågan avseende utvärdering av projektet Utsikt & Insikt Härmed inbjuds ni att inkomma med offert på uppföljning och lärande utvärdering av ESF-projektet Utsikt &

Läs mer

Mellan nedanstående parter, kommunen och leverantören har följande avtal träffats.

Mellan nedanstående parter, kommunen och leverantören har följande avtal träffats. 1 Uppdragets omfattning Leverantören [ ]ska utföra utbildningssamordning till kunden enligt detta avtal, förfrågningsunderlaget samt leverantörens anbud. Kunden garanterar inga angivna volymer under avtalsperioden.

Läs mer

Förfrågningsunderlag Upphandling av översättare tyska för Swedish Lapland Visitors Board

Förfrågningsunderlag Upphandling av översättare tyska för Swedish Lapland Visitors Board Förfrågningsunderlag Upphandling av översättare tyska för Swedish Lapland Visitors Board 1. ALLMÄN ORIENTERING... 2 1.1 Upphandlingsförfarande... 2 1.2 Uppdraget... 2 1.3 Pris... 3 1.4 Syfte och målgrupp...

Läs mer



Läs mer

Förfrågningsunderlag Kompetensutvecklingsinsatser i form av utbildning för ESF projektet KUL PÅ LIMHAMN

Förfrågningsunderlag Kompetensutvecklingsinsatser i form av utbildning för ESF projektet KUL PÅ LIMHAMN Förfrågningsunderlag Kompetensutvecklingsinsatser i form av utbildning för ESF projektet KUL PÅ LIMHAMN 1. UPPHANDLINGSFORMALIA 1.1 Upphandlande myndighet PÅ Limhamns Ekonomiska förening. 1.2 Upphandlingsform

Läs mer

Energikonsult för livsmedelsbutiker i Dalafjällen

Energikonsult för livsmedelsbutiker i Dalafjällen OFFERTFÖRFRÅGAN 1(5) 2014-01-14 Dnr: 303-577-2014 Upphandling av Energikonsult för livsmedelsbutiker i Dalafjällen 1 INFORMATION OM UPPHANDLINGEN 1.1 Upphandlande myndighet Länsstyrelsen Dalarna, Näringslivsenheten

Läs mer

AVTAL. Ramavtal Möbler

AVTAL. Ramavtal Möbler Sidan 1 av 5 AVTAL Ramavtal 73-03 Möbler 1 Parter Mellan Brio Lek & Lär, nedan kallad leverantören, och Gotlands kommun, 621 81 VISBY, nedan kallad köparen, har följande avtal träffats. 2 Omfattning Successiva

Läs mer

Förfrågningsunderlag Upphandling av Grafisk designer för Swedish Lapland Visitors Board

Förfrågningsunderlag Upphandling av Grafisk designer för Swedish Lapland Visitors Board Förfrågningsunderlag Upphandling av Grafisk designer för Swedish Lapland Visitors Board 1. ALLMÄN ORIENTERING... 2 1.1 Upphandlingsförfarande... 2 1.2 Uppdraget... 2 1.3 Pris... 3 1.4 Projektets syfte

Läs mer


RAMAVTAL AVSEENDE JURISTTJÄNSTER Upphandling av ramavtal avseende juristtjänster 1 Mellan Post- och telestyrelsen org nr 202100-4359 (nedan kallad PTS) och NN org nr (nedan kallad Konsultföretaget) har träffats RAMAVTAL AVSEENDE JURISTTJÄNSTER

Läs mer

Ramavtal Växtservice SMHI - XXX

Ramavtal Växtservice SMHI - XXX Bilaga 2 Ramavtal Växtservice SMHI - XXX Innehållsförteckning 1 Parter... 1 2 Avtalets omfattning... 1 3 Avtalstid - Förlängning... 1 4 Avtalshandlingar... 1 5 Överlåtelse av avtalet... 1 6 Leverantörens

Läs mer

ANBUDSFÖRFRÅGAN. Ni inbjuds inkomma med anbud på" Ramavtal avseende uppdrag som receptionist/ kundtjänstmedarbetare till Ängelholms kommun.

ANBUDSFÖRFRÅGAN. Ni inbjuds inkomma med anbud på Ramavtal avseende uppdrag som receptionist/ kundtjänstmedarbetare till Ängelholms kommun. ÄNGELHOLMS ANBUDSFÖRFRÅGAN Ni inbjuds inkomma med anbud på" Ramavtal avseende uppdrag som receptionist/ kundtjänstmedarbetare till Ängelholms kommun." Köpare Ängelholms kommun, org.nr 212000-0977 Sista

Läs mer

Mall för ramavtal. Leverantör av tårtor, smörgåstårtor, smörgåsar, sallader och övrigt fikabröd

Mall för ramavtal. Leverantör av tårtor, smörgåstårtor, smörgåsar, sallader och övrigt fikabröd Diarienr 3133-14 Mall för ramavtal Leverantör av tårtor, smörgåstårtor, smörgåsar, sallader och övrigt fikabröd Luleå tekniska universitet/luleå University of Technology Besökadress/Visiting address: Universitetsområdet.

Läs mer

Förfrågningsunderlag Föredragshållare till Seminarium för ESF projektet KUL PÅ LIMHAMN

Förfrågningsunderlag Föredragshållare till Seminarium för ESF projektet KUL PÅ LIMHAMN Förfrågningsunderlag Föredragshållare till Seminarium för ESF projektet KUL PÅ LIMHAMN 1. UPPHANDLINGSFORMALIA 1.1 Upphandlande myndighet PÅ Limhamns Ekonomiska förening. 1.2 Upphandlingsform Förenklad

Läs mer

Upphandling av Översättare engelska för Swedish Lapland

Upphandling av Översättare engelska för Swedish Lapland Förfrågningsunderlag Upphandling av Översättare engelska för Swedish Lapland 1. ALLMÄN ORIENTERING... 2 1.1 Upphandlingsförfarande... 2 1.2 Uppdraget... 2 1.3 Pris... 2 1.4 Projektets syfte och målgrupp...

Läs mer

Avropsförfrågan. Systemutvecklare

Avropsförfrågan. Systemutvecklare AVROPSFÖRFRÅGAN 1 (8) Avropsförfrågan Systemutvecklare Innehåll Avropsförfrågan... 2 Inledning... 2 Administrativa krav... 2 Information om anbudsgivare... 3 Konsulttjänsten... 3 Redovisning hur erbjuden

Läs mer

Avtal: Referensnr: Moms reg nummer:

Avtal: Referensnr: Moms reg nummer: Avtal: Avtalets namn: Upphandling: Startdatum: Montage och Demontage Lab/kontor Montage och Demontage Lab/kontor Referensnr: Upph. ref.nr: 10029/UF 10029/UF 2011-03-01 Slutdatum: 2013-02-28 Typ av avtal:

Läs mer

Avropsförfrågan. IT-arkitekt

Avropsförfrågan. IT-arkitekt AVROPSFÖRFRÅGAN 1 (8) Avropsförfrågan IT-arkitekt Innehåll Avropsförfrågan... 2 Inledning... 2 Elektronisk anbudsgivning och informationshantering i upphandlingen... 2 Administrativa krav... 3 Information

Läs mer

Avropsförfrågan. IT-arkitekt

Avropsförfrågan. IT-arkitekt AVROPSFÖRFRÅGAN 1 (7) Avropsförfrågan IT-arkitekt Innehåll Avropsförfrågan... 2 Inledning... 2 Administrativa krav... 2 Information om anbudsgivare... 3 Konsulttjänsten... 3 Redovisning hur erbjuden konsult

Läs mer

Bilaga 3. Ramavtal SMHI och XXXXX

Bilaga 3. Ramavtal SMHI och XXXXX Bilaga 3 Ramavtal SMHI och XXXXX Innehållsförteckning 1 Parter... 1 2 Avtalets omfattning... 1 3 Avtalstid - Förlängning... 1 4 Avtalshandlingar... 1 5 Överlåtelse av avtalet... 1 6 Leverantörens åtaganden...

Läs mer

AVTAL Bilaga 1. Leverantörens prislista. 1 Parter Beställare: Katrineholms kommun Katrineholm

AVTAL Bilaga 1. Leverantörens prislista. 1 Parter Beställare: Katrineholms kommun Katrineholm AVTAL Bilaga 1. Leverantörens prislista. 1 Parter Beställare: 641 80 Katrineholm Katrineholms Fastighets AB, KFAB OCH Katrineholms Industrihus AB, KIAB Box 7 641 21 KATRINEHOLM Västra Sörmlands Räddningstjänst

Läs mer

MALL UPPHANDLINGSKONTRAKT IT-konsulttjänster 2014 Avtalsområde XXX

MALL UPPHANDLINGSKONTRAKT IT-konsulttjänster 2014 Avtalsområde XXX MALL UPPHANDLINGSKONTRAKT IT-konsulttjänster 2014 Avtalsområde XXX 2014-04-17 14LS543 2(9) 5 Innehåll 1. KONTRAKTSPARTER OCH KONTAKTPERSONER... 3 1.1. Kontraktsparter... 3 1.2. Kontaktpersoner... 3 2.

Läs mer

Dals-Eds Kommun - Upphandling Evenemangstjänster. Inbjudan

Dals-Eds Kommun - Upphandling Evenemangstjänster. Inbjudan 11-14 1. Allmän Information Inbjudan Dals-Eds kommun kommunstyrelsen upphandlar under förutsättning av nödvändiga beslut fattas anordnande av evenemang för att öka kommunens attraktionskraft. Upphandlande

Läs mer

Avropsförfrågan. Verksamhetsutvecklare it-tjänster

Avropsförfrågan. Verksamhetsutvecklare it-tjänster AVROPSFÖRFRÅGAN 1 (7) Avropsförfrågan Verksamhetsutvecklare it-tjänster Innehåll Avropsförfrågan... 2 Inledning... 2 Elektronisk anbudsgivning och informationshantering i upphandlingen... 2 Administrativa

Läs mer

IT-företagen (fd LKD) Avtal-90 och ALOS05. För mer information se hemsida www.gatubolaget.goteborg.se

IT-företagen (fd LKD) Avtal-90 och ALOS05. För mer information se hemsida www.gatubolaget.goteborg.se Ingemar Larsson tel 031 368 46 17 2007-10-22 1(6) Avtal mellan Göteborgs Gatu AB, Affärsområde Teknisk Service, nedan kallat Gatubolaget (beställare) och XXXXX (leverantör) Bilpoolssystem Allmän beskrivning

Läs mer

Avropsförfrågan. Verksamhetsutvecklare

Avropsförfrågan. Verksamhetsutvecklare AVROPSFÖRFRÅGAN 1 (7) Avropsförfrågan Verksamhetsutvecklare Innehåll Avropsförfrågan... 2 Inledning... 2 Administrativa krav... 2 Information om anbudsgivare... 3 Konsulttjänsten... 3 Redovisning hur erbjuden

Läs mer

Checklista för upphandling Internetbaserade stöd- och behandlingsprogram

Checklista för upphandling Internetbaserade stöd- och behandlingsprogram 2015-02-12 1 (5) Fredrik Söderlind Anna Östbom Checklista för upphandling Internetbaserade stöd- och behandlingsprogram Hur ser den interna organisationen och kompetensen ut? När en upphandling ska genomföras

Läs mer

Leverantör av Tolktjänster

Leverantör av Tolktjänster Koncerninköp Per Löwhagen Inköpare 0704 200302 per.lowhagen@swepro.se Datum 2009-12-08 Diarienr 0902010 1 (7) Leverantör av Tolktjänster Kompletterande förfrågningsunderlag 4, KFU 4 Fråga 1: Ni vill ha

Läs mer

Avropsförfrågan. Systemutvecklare

Avropsförfrågan. Systemutvecklare AVROPSFÖRFRÅGAN 1 (8) Avropsförfrågan Systemutvecklare Innehåll Avropsförfrågan... 2 Inledning... 2 Elektronisk anbudsgivning och informationshantering i upphandlingen... 2 Administrativa krav... 3 Information

Läs mer

Avropsförfrågan. Projektledare

Avropsförfrågan. Projektledare AVROPSFÖRFRÅGAN 1 (7) Avropsförfrågan Projektledare Innehåll Avropsförfrågan... 2 Inledning... 2 Elektronisk anbudsgivning och informationshantering i upphandlingen... 2 Administrativa krav... 3 Information

Läs mer

Avropsförfrågan. Upphandlingsspecialist it-drift

Avropsförfrågan. Upphandlingsspecialist it-drift AVROPSFÖRFRÅGAN 1 (8) Avropsförfrågan Upphandlingsspecialist it-drift Innehåll Avropsförfrågan... 2 Inledning... 2 Administrativa krav... 2 Information om anbudsgivare... 3 Konsulttjänsten... 3 Redovisning

Läs mer

Avropsförfrågan. Testledare/testare

Avropsförfrågan. Testledare/testare AVROPSFÖRFRÅGAN 1 (8) Avropsförfrågan Testledare/testare Innehåll Avropsförfrågan... 2 Inledning... 2 Administrativa krav... 2 Information om anbudsgivare... 3 Konsulttjänsten... 3 Redovisning hur erbjuden

Läs mer

Prisförfrågan. - Eco-Driving utbildning för personalen på SMHI

Prisförfrågan. - Eco-Driving utbildning för personalen på SMHI Prisförfrågan - Eco-Driving utbildning för personalen på SMHI INNEHÅLLSFÖRTECKNING PRISFÖRFRÅGAN... 1 1 ALLMÄN INFORMATION... 1 1.1 OM SMHI... 1 1.2 OM DENNA UPPHANDLING... 1 1.3 VOLYM OCH UTVÄRDERING...

Läs mer

Förfrågningsunderlag Upphandling av Interaktionsdesigner för Swedish Lapland Visitors Board

Förfrågningsunderlag Upphandling av Interaktionsdesigner för Swedish Lapland Visitors Board Förfrågningsunderlag Upphandling av Interaktionsdesigner för Swedish Lapland Visitors Board 1. ALLMÄN ORIENTERING... 2 1.1 Upphandlingsförfarande... 2 1.2 Uppdraget... 2 1.3 Pris... 3 1.4 Syfte och målgrupp...

Läs mer

Avropsförfrågan. Webb-designer

Avropsförfrågan. Webb-designer AVROPSFÖRFRÅGAN 1 (8) Avropsförfrågan Webb-designer Innehåll Avropsförfrågan... 2 Inledning... 2 Elektronisk anbudsgivning och informationshantering i upphandlingen... 2 Administrativa krav... 3 Information

Läs mer

Ramavtal Oberoende konsulttjänster för administrativa IT-system område personal. 1 Ramavtal oberoende konsulter, område personal

Ramavtal Oberoende konsulttjänster för administrativa IT-system område personal. 1 Ramavtal oberoende konsulter, område personal 1/12 Ramavtal Oberoende konsulttjänster för administrativa IT-system område personal 1 Ramavtal oberoende konsulter, område personal Mellan Ekonomistyrningsverket (nedan kallat ESV), med organisationsnummer

Läs mer

Avropsförfrågan. Systemutvecklare Word

Avropsförfrågan. Systemutvecklare Word AVROPSFÖRFRÅGAN 1 (7) Avropsförfrågan Systemutvecklare Word Innehåll Avropsförfrågan... 2 Inledning... 2 Administrativa krav... 2 Information om anbudsgivare... 3 Konsulttjänsten... 4 Redovisning hur erbjuden

Läs mer

1 Parter. 2 Omfattning. 3 Kontraktstid. 4 Parternas gemensamma åtaganden

1 Parter. 2 Omfattning. 3 Kontraktstid. 4 Parternas gemensamma åtaganden Sida 1 av 6 De kommersiella villkoren ligger till grund för kontrakt mellan uppdragsgivaren och uppdragstagaren. I anbudet skall det framgå att anbudsgivare accepterar de kommersiella villkoren i sin helhet.

Läs mer

AVTAL. Ramavtal Möbler

AVTAL. Ramavtal Möbler Sidan 1 av 4 AVTAL Ramavtal 73-03 Möbler 1 Parter Mellan Tranås Skolmöbler AB, nedan kallad leverantören, och Gotlands kommun, 621 81 VISBY, nedan kallad köparen, har följande avtal träffats. 2 Omfattning

Läs mer

Offertförfrågan avseende utvärdering av projektet Nyckeln i Låset

Offertförfrågan avseende utvärdering av projektet Nyckeln i Låset 2012-02-15 Dnr: 2011-3090046. Offertförfrågan avseende utvärdering av projektet Nyckeln i Låset Härmed inbjuds ni att inkomma med offert på en uppföljning och lärande utvärdering av ESF-projektet Nyckeln

Läs mer

Storumans kommun. Upphandling Familjerådgivning. Dnr: ON/2010:

Storumans kommun. Upphandling Familjerådgivning. Dnr: ON/2010: Storumans kommun Upphandling ANBUDSBEGÄRAN - FAMILJERÅDGIVNING Upphandlande enhet STORUMANS KOMMUN Omsorgsnämnden 923 81 Storuman Telefon: 0951-140 00 vx Telefax: 0951-140 09 Upphandlande enhets ombud

Läs mer


Inledande text UPPHANDLING AV REKLAMBYRÅTJÄNSTER Inledande text UPPHANDLING AV REKLAMBYRÅTJÄNSTER Kommunförbundet Västernorrland inbjuder leverantörer att lämna anbud för upphandling av reklambyråtjänster i enlighet med angivna förutsättningar i detta

Läs mer

De i upphandlingen angivna kvantiteterna är beställarens ungefärliga behov kan variera och således över- eller underskridas.

De i upphandlingen angivna kvantiteterna är beställarens ungefärliga behov kan variera och således över- eller underskridas. 1 Parter Mellan nedanstående parter, leverantör och beställare, har följande avtal träffats. Leverantör: Företagsnamn, Organisationsnummer Leverantörens kontaktperson Avtalsfrågor: Beställaren: Örnsköldsviks

Läs mer

Förfrågningsunderlag Upphandling av Fotograf/filmare för Swedish Lapland Visitors Board

Förfrågningsunderlag Upphandling av Fotograf/filmare för Swedish Lapland Visitors Board Förfrågningsunderlag Upphandling av Fotograf/filmare för Swedish Lapland Visitors Board 1. ALLMÄN ORIENTERING... 2 1.1 Upphandlingsförfarande... 2 1.2 Uppdraget... 2 1.3 Pris... 3 1.4 Syfte och målgrupp...

Läs mer

Avtal. Detta avtal är upprättat mellan Värnamo kommun, 212000-0555, nedan kallad Beställaren och NN (XXXXX-XXXX) nedan kallad Entreprenören.

Avtal. Detta avtal är upprättat mellan Värnamo kommun, 212000-0555, nedan kallad Beställaren och NN (XXXXX-XXXX) nedan kallad Entreprenören. Bilaga 8 1. Parter Avtal Detta avtal är upprättat mellan Värnamo kommun, 212000-0555, nedan kallad Beställaren och NN (XXXXX-XXXX) nedan kallad Entreprenören. 2. Avtalstid Avtalet gäller under perioden

Läs mer

Avtal 1. Parter Detta avtal är upprättat mellan Gislaveds kommun, nedan kallat Beställaren och NN (XXXXX-XXXX) nedan kallad Utföraren.

Avtal 1. Parter Detta avtal är upprättat mellan Gislaveds kommun, nedan kallat Beställaren och NN (XXXXX-XXXX) nedan kallad Utföraren. Avtal 1. Parter Detta avtal är upprättat mellan, nedan kallat Beställaren och NN (XXXXX-XXXX) nedan kallad Utföraren. 2. Avtalstid Avtalet gäller under perioden XXXX-XX-XX till XXXX-XX-XX med möjlighet

Läs mer

Förfrågan avser: Projektledare

Förfrågan avser: Projektledare Förfrågningsunderlag 2009-06 Förfrågningsunderlag 2009-06 Förfrågan avser: Projektledare Köpare Fiber Optic Valley AB Anbud tillhanda senast 2009-06-05 Anbudets giltighetstid 120 dagar efter sista anbudsdag

Läs mer

Ramavtal Oberoende konsulttjänster för administrativa IT-system område ekonomi

Ramavtal Oberoende konsulttjänster för administrativa IT-system område ekonomi Ramavtal Oberoende konsulttjänster för administrativa IT-system område ekonomi 1/5 Ramavtalsbilaga 7: Frågor och svar i upphandlingen av statligt ramavtal avseende oberoende konsulttjänster för administrativa

Läs mer

Ramavtal Applikations och teknikkonsulter lön/pa

Ramavtal Applikations och teknikkonsulter lön/pa Ramavtal Applikations och teknikkonsulter lön/pa 1. RAMAVTALETS SYFTE...2 2. RAMAVTALETS OMFATTNING...2 3. AVROPSAVTAL...3 4. RAMAVTALSPERIOD...3 5. FÖRETAGETS ÅTAGANDE...3 6. AVTALSHANDLINGAR...3 7. BERÄTTIGADE

Läs mer

AVTAL. Ramavtal, , Bårtransporter av avlidna

AVTAL. Ramavtal, , Bårtransporter av avlidna AVTAL Ramavtal, 108-05, Bårtransporter av avlidna Parter Mellan Åhlbergs Begravningsbyrå AB, Storgatan 4, 620 12 HEMSE, nedan kallad entreprenören och Gotlands kommun, Hälso- och sjukvårdsnämnden, 621

Läs mer

2. Kvalificering och obligatoriska krav

2. Kvalificering och obligatoriska krav Förfrågningsunderlag - Upphandlarversion 2011-02-15 Upphandlingsansvarig Upphandling Region Gotland Destinationsmarknadsföring Gotland - Turism och näringsliv Carina Westergren Larsson 2010/537 Symbolförklaring:

Läs mer

Avropsförfrågan. Systemutvecklare -stordator

Avropsförfrågan. Systemutvecklare -stordator AVROPSFÖRFRÅGAN 1 (7) Avropsförfrågan Systemutvecklare -stordator Innehåll Avropsförfrågan... 2 Inledning... 2 Administrativa krav... 2 Information om anbudsgivare... 3 Konsulttjänsten... 3 Redovisning

Läs mer

MA-Skåne Datum 2008-04-16 1 (6) Diarienr MA/070287-10

MA-Skåne Datum 2008-04-16 1 (6) Diarienr MA/070287-10 MA-Skåne Datum 2008-04-16 1 (6) Diarienr MA/070287-10 Avtal: Konsulter inom Miljöområdet för Region Skånes verksamheter. Nr: MA/070287-10 1. Avtalsparter Leverantör: SP Sveriges Tekniska Forskningsinstitut

Läs mer

Ramavtal avseende tillhandahållande av statistik om offentliga upphandlingar m.m. ur databaser.

Ramavtal avseende tillhandahållande av statistik om offentliga upphandlingar m.m. ur databaser. KKV1000, v1.1, 2010-05-05 BILAGA 3 - AVTALSUTKAST 2011-11-08 Dnr 576/2011 1 (6) Ramavtal avseende tillhandahållande av statistik om offentliga upphandlingar m.m. ur databaser. 1. Parter Mellan Konkurrensverket

Läs mer


AVTAL OM TJÄNSTER FÖR AVYTTRING AV MÖBLER OCH KONTORSINREDNING Mellan Post- och telestyrelsen organisationsnummer 202100-4359 (nedan kallad PTS) och XXXX organisationsnummer xxxxxx-xxxx (nedan kallad Företaget) har träffats följande AVTAL OM TJÄNSTER FÖR AVYTTRING

Läs mer

UMEVA, Robertsfors kommun, Vännäs kommun, Bjurholms kommun, Vindelns kommun, Sorsele kommun.

UMEVA, Robertsfors kommun, Vännäs kommun, Bjurholms kommun, Vindelns kommun, Sorsele kommun. 1 Allmänt inbjuder till anbudsgivning gällande --. Upphandlingen genomförs enligt Lagen om Offentlig Upphandling (LOU). 2 Information om upphandlande myndighet är den upphandlande myndigheten och agerar

Läs mer

1 KOMMERSIELLA VILLKOR (utkast till beställning/avtal)

1 KOMMERSIELLA VILLKOR (utkast till beställning/avtal) 1 KOMMERSIELLA VILLKOR (utkast till beställning/avtal) Nedanstående avtal har tecknats mellan följande parter Kommunen Drottninggatan 32 651 84 Karlstad Org.nr 212000-1850 Leverantören Företagsnamn Adress

Läs mer

Anbudsinbjudan. Handläggare Tel.nr. Datum Linda Lundström 0371-815 86 2006-12-22

Anbudsinbjudan. Handläggare Tel.nr. Datum Linda Lundström 0371-815 86 2006-12-22 1(11) Anbudsinbjudan Handläggare Tel.nr. Datum Linda Lundström 0371-815 86 2006-12-22 Anbudsadress Anbud ska vara kommunen tillhanda senast Anbud Glass 06-252-22 2007-01-17 Gislaveds kommun Upphandlingsenheten

Läs mer

Avropsförfrågan. Verksamhetsutvecklare -uppdragshantering

Avropsförfrågan. Verksamhetsutvecklare -uppdragshantering AVROPSFÖRFRÅGAN 1 (8) Avropsförfrågan Verksamhetsutvecklare -uppdragshantering Innehåll Avropsförfrågan... 2 Inledning... 2 Elektronisk anbudsgivning och informationshantering i upphandlingen... 2 Administrativa

Läs mer

Ramavtal för konsulttjänster inom ledarskap, ledarskapsutveckling och projektledarskap

Ramavtal för konsulttjänster inom ledarskap, ledarskapsutveckling och projektledarskap MA-Skåne 1 (5) Diarienummer MA/060087-02 Ramavtal för konsulttjänster inom ledarskap, ledarskapsutveckling och projektledarskap Avtalsnummer: MA/060087-02 Leverantör: ProjektBolaget Ögren-Skoog AB,Ersmässgränd

Läs mer

Handläggare Tel.nr. Datum Ärendenummer Niclas Olofsson 0144-350 36 2011-12-10 12/2011

Handläggare Tel.nr. Datum Ärendenummer Niclas Olofsson 0144-350 36 2011-12-10 12/2011 1(8) Anbudsinbjudan Handläggare Tel.nr. Datum Ärendenummer Niclas Olofsson 0144-350 36 2011-12-10 12/2011 Leveransadress Anbudsgivare Anbudsadress Anbud ska vara kommunen tillhanda Anbud - Maskintjänster

Läs mer

11 januari 2017 Sista anbudsdag: Referens: SBF HÖ

11 januari 2017 Sista anbudsdag: Referens: SBF HÖ Direktupphandling 11 januari 2017 Sista anbudsdag: 2017-01-17 Referens: SBF HÖ 2016-11-30 Kartsystem - GIS tjänster Tingsryds kommun inbjuder Er att lämna anbud på rubricerad direktupphandling i enlighet

Läs mer

Avropsförfrågan. Systemutvecklare

Avropsförfrågan. Systemutvecklare AVROPSFÖRFRÅGAN 1 (8) Avropsförfrågan Systemutvecklare Innehåll Avropsförfrågan... 2 Inledning... 2 Administrativa krav... 2 Information om anbudsgivare... 3 Konsulttjänsten... 3 Redovisning hur erbjuden

Läs mer

Förfrågan avser: PR, Kommunikationstjänster och Webb

Förfrågan avser: PR, Kommunikationstjänster och Webb Förfrågningsunderlag 2012-01 Förfrågningsunderlag 2012-01 Förfrågan avser: PR, Kommunikationstjänster och Webb Beställare Fiber Optic Valley AB Upphandlingsform: Förenklad upphandling Anbud tillhanda senast

Läs mer

Förfrågningsunderlag. Utvärdering för ESF projektet KUL PÅ LIMHAMN. Diarienummer KPL 2012.1

Förfrågningsunderlag. Utvärdering för ESF projektet KUL PÅ LIMHAMN. Diarienummer KPL 2012.1 Förfrågningsunderlag Utvärdering för ESF projektet KUL PÅ LIMHAMN 1. UPPHANDLINGSFORMALIA 1.1 Upphandlande myndighet PÅ Limhamns Ekonomiska förening. 1.2 Upphandlingsform Förenklad upphandling enligt Lag

Läs mer

2 Krav på leverantör Stöd- och tilläggstjänster, Företagshälsan NLL. Dnr: Ansvarig: Josefine Barsk

2 Krav på leverantör Stöd- och tilläggstjänster, Företagshälsan NLL. Dnr: Ansvarig: Josefine Barsk 2 Krav på leverantör 2014 Stöd- och tilläggstjänster, Ansvarig: Josefine Barsk 1 INNEHÅLLSFÖRTECKNING 1 KRAV PÅ LEVERANTÖR 4 1.1 INTYG OCH BEVIS ANGÅENDE LEVERANTÖR 4 1.2 LEVERANTÖRENS EKONOMISKA STÄLLNING

Läs mer

De i upphandlingen angivna kvantiteterna är beställarens ungefärliga behov kan variera och således över- eller underskridas.

De i upphandlingen angivna kvantiteterna är beställarens ungefärliga behov kan variera och således över- eller underskridas. 1 Parter Upphandlande myndighet och enheter är i detta avtal kallad beställaren. Leverantör: Företagsnamn, Organisationsnummer Leverantörens kontaktperson Avtalsfrågor: Sakfrågor: Beställaren: Örnsköldsviks

Läs mer

Fyrhjuling till Storstans Kommun Direktupphandlingen avser Vara Tjänst Anbud

Fyrhjuling till Storstans Kommun Direktupphandlingen avser Vara Tjänst Anbud Exempel på inbjudan till direktupphandling Obs! Detta är endast ett exempel. Samtliga uppgifter i exemplet är påhittade. Text markerad med blå färg i dokumentet fylls i av leverantören som lämnar anbudet.

Läs mer

AVTAL. Ramavtal, 174-04, Tryckeri- och kopieringstjänster m.m.

AVTAL. Ramavtal, 174-04, Tryckeri- och kopieringstjänster m.m. AVTAL Ramavtal, 174-04, Tryckeri- och kopieringstjänster m.m. Parter Mellan Snabba Tryck AB, Cypressgatan 4, 621 58 VISBY nedan kallad säljaren och Gotlands kommun, 621 81 VISBY, nedan kallad köparen har

Läs mer

Avtal distribution m.m. av trycksaker. Box 27215 102 53 Stockholm

Avtal distribution m.m. av trycksaker. Box 27215 102 53 Stockholm AVTALSUTKAST Dnr Adm 2008/70 Bilaga 1 Avtal distribution m.m. av trycksaker 1. Avtalsparter Statens kulturråd Box 27215 102 53 Stockholm Organisationsnummer 202100-1280 Distributören Organisationsnummer

Läs mer

AVTAL. Avseende tjänster för nykundsbearbetning och varumärkesbyggande

AVTAL. Avseende tjänster för nykundsbearbetning och varumärkesbyggande AVTAL Avseende tjänster för nykundsbearbetning och varumärkesbyggande Innehåll 1 Avtalets omfattning... 3 2 Avtalsperiod... 3 3 Avtalshandlingar... 3 4 Kontaktpersoner... 3 5 Engagerade säljare... 3 5.1

Läs mer

Ramavtal avseende tillhandahållande av information om vårdcentraler

Ramavtal avseende tillhandahållande av information om vårdcentraler KKV1000, v1.2, 2011-02-05 BILAGA 3 - AVTALSUTKAST 2014-08-13 Dnr 540 /2014 1 (6) Ramavtal avseende tillhandahållande av information om vårdcentraler 1. Parter Mellan Konkurrensverket med organisationsnummer

Läs mer



Läs mer

Förfrågningsunderlag Upphandling av Webbyrå för Swedish Lapland Visitors Board

Förfrågningsunderlag Upphandling av Webbyrå för Swedish Lapland Visitors Board Förfrågningsunderlag Upphandling av Webbyrå för Swedish Lapland Visitors Board 1. ALLMÄN ORIENTERING... 2 1.1 Upphandlingsförfarande... 2 1.2 Uppdraget... 2 1.3 Pris... 2 1.4 Syfte och målgrupp... 3 2.

Läs mer

Bilaga 10 Faktureringsrutiner

Bilaga 10 Faktureringsrutiner SID 1 (7) Bilaga 10 Faktureringsrutiner Förfrågningsunderlag 1. Systemdrift och Systemförvaltning Centrala verksamhetssystem 2. Service Desk 105 35 STOCKHOLM. Telefon 08-508 29 000. Fax 08-508 29 036.

Läs mer

Prissättning SKALL ske enligt bilaga XXXXXX. På ovannämnda priser tillkommer mervärdeskatt. Priserna SKALL vara fasta till och med

Prissättning SKALL ske enligt bilaga XXXXXX. På ovannämnda priser tillkommer mervärdeskatt. Priserna SKALL vara fasta till och med Avtal gällande har träffats mellan, org.nr 212000-2411, nedan kallad kommunen och Företagsnamn, org.nr Organisationsnummer, nedan kallad leverantören. Avrop Rätt att avropa från detta avtal har Sundsvalls

Läs mer

Upphandlingsprocessen enligt LOU - lagen om offentlig upphandling, är enkel:

Upphandlingsprocessen enligt LOU - lagen om offentlig upphandling, är enkel: April 2014 Rapport: Kommunens upphandling stor möjlighet och/eller stort krångel? Bakgrund Företag i Samverkan har upphandling som ett av fem fokusområden. Syftet är att fler affärer ska hamna hos företagen

Läs mer

Checklista för upphandling Internetbaserade stöd- och behandlingsprogram

Checklista för upphandling Internetbaserade stöd- och behandlingsprogram 2016-04-28 1 (5) Fredrik Söderlind Anna Östbom Checklista för upphandling Internetbaserade stöd- och behandlingsprogram Hur ser den interna organisationen och kompetensen ut? När en upphandling ska genomföras

Läs mer

Parter. Handlingar. Avtalsform. Giltighet. Uppdraget och dess omfattning. Priser. Parternas förhållningssätt

Parter. Handlingar. Avtalsform. Giltighet. Uppdraget och dess omfattning. Priser. Parternas förhållningssätt Avtal Parter I upphandlingen har nedanstående parter träffat följande avtal. Kommunen, 195 85 Märsta, org. nr 212000-0225 Leverantören Företagsnamn, Adress, Organisationsnummer Handlingar För avtalet gäller

Läs mer

Förnyad konkurrensutsättning Innebär att vid beställning ska samtliga leverantörer inom delområdet få en skriftlig avropsförfrågan

Förnyad konkurrensutsättning Innebär att vid beställning ska samtliga leverantörer inom delområdet få en skriftlig avropsförfrågan Nytt ramavtal för reklambyråtjänster, dnr SLU 232-1039/09 Ramavtalet omfattar Reklambyråtjänster och kringliggande tjänster. Avtalet är giltigt till och med 2012-03-01 och kan därefter förlängas med ett

Läs mer

Växtservice till SMHI

Växtservice till SMHI Prisförfrågan Växtservice till SMHI 1. Information Denna upphandling avser att resultera i ett ramavtal som består i att en extern entreprenör kommer till SMHI och ansvarar för service och underhåll av

Läs mer

Mellan parterna Gotlands kommun (212000-0803), 621 81 VISBY, nedan kallad köparen, å ena sidan, och,

Mellan parterna Gotlands kommun (212000-0803), 621 81 VISBY, nedan kallad köparen, å ena sidan, och, Mellan parterna Gotlands kommun (212000-0803), 621 81 VISBY, nedan kallad köparen, å ena sidan, och, Fotterapeut Gunnel Pettersson (530624-3220) Suderbys Hangvar Företag Organisationsnummer Adress 620

Läs mer

Avropsförfrågan. Systemutvecklare /stordator

Avropsförfrågan. Systemutvecklare /stordator AVROPSFÖRFRÅGAN 1 (7) Avropsförfrågan Systemutvecklare /stordator Innehåll Avropsförfrågan... 2 Inledning... 2 Elektronisk anbudsgivning och informationshantering i upphandlingen... 2 Administrativa krav...

Läs mer


MALL FÖR UPPHANDLINGSAVTAL MALL FÖR UPPHANDLINGSAVTAL Upphandling SF 2010-537 Avtal Destinationsmarknadsföring Gotland Turism och näringsliv Detta avtal har träffats mellan följande parter: Köpare: Region Gotland Ledningskontoret

Läs mer

Bilaga 4 - Mall för upphandlingskontrakt Upphandling av Färskt hängmörat kött

Bilaga 4 - Mall för upphandlingskontrakt Upphandling av Färskt hängmörat kött DIARIENR UE/120027 Bilaga 4 - Mall för upphandlingskontrakt Upphandling av Färskt hängmörat kött Anm: Texter med blå teckenfärg kommer att fastställas i samband med upprättande av upphandlingskontraktet.

Läs mer

Avtal. Mediebevakning Referensnr: 062978-2015. nummer: susanna.bjornfot@forsakringsk E-post: jonas.thomsgard@opoint. se

Avtal. Mediebevakning Referensnr: 062978-2015. nummer: susanna.bjornfot@forsakringsk E-post: jonas.thomsgard@opoint. se Avtal Avtalets namn: Startdatum: Mediebevakning Referensnr: 062978-2015 2015-12-22 Slutdatum: 2016-12-21 Typ av avtal: Ramavtal Förlängning: 2 st á 1 år Parter: Köpare Upph. enhet: Handläggare: Org. nr:

Läs mer

Anbudsförfrågan avseende: Kursanordnare ESF projekt - Kompetensförsörjning för företag inom besöksnäringen i Dalarna

Anbudsförfrågan avseende: Kursanordnare ESF projekt - Kompetensförsörjning för företag inom besöksnäringen i Dalarna 2013-11-10 Dnr: 2011-3060046 Anbudsförfrågan avseende: Kursanordnare ESF projekt - Kompetensförsörjning för företag inom besöksnäringen i Dalarna Härmed inbjuds ni att lämna anbud på de kurser som ESF-projektet

Läs mer

Upphandling av undersökningar av miljögifter och metaller i fisk

Upphandling av undersökningar av miljögifter och metaller i fisk LOGGO AVTAL Upphandling av undersökningar av miljögifter och metaller i fisk Avtal 1. ALLMÄNT 1.1. Avtalsparter Detta avtal upprättas av?? vattenvårdsförbund. Beställare?? vattenvårdsförbund Adress:??

Läs mer


RAMAVTAL FÖR JURIDISKA TJÄNSTER Diarienummer 2015/136 RAMAVTAL FÖR JURIDISKA TJÄNSTER Detta ramavtal, ( Ramavtalet ), har träffats mellan Tredje AP-fonden, ( AP3 ) och [firma leverantör] ( Juristbyrån ). 1. Bakgrund 1.1 AP3 har genomfört

Läs mer

Stockholms läns landsting Ramavtal gällande Byggprojektledning

Stockholms läns landsting Ramavtal gällande Byggprojektledning -locum. VÄRDEN FÖR VÅRDEN RAMAVTAL 2015-04-28 1(5) Stockholms läns landsting Ramavtal gällande Konsult Tengbomgruppen Sverige AB (orgnr: 556329-9113) Katarinavägen 15, Box 1230 111 82 Stockholm Konsultens

Läs mer

Bilaga 5b. Faktureringsrutiner. Upphandling av IT-stöd för hantering av elevdokumentation inom Skolplattform Stockholm UTBILDNINGSFÖRVALTNINGEN

Bilaga 5b. Faktureringsrutiner. Upphandling av IT-stöd för hantering av elevdokumentation inom Skolplattform Stockholm UTBILDNINGSFÖRVALTNINGEN SID 1 (6) Bilaga 5b Faktureringsrutiner Förfrågningsunderlag Upphandling av IT-stöd för hantering av elevdokumentation inom Skolplattform Stockholm Box 22049, 104 22 Stockholm. Besöksadress Hantverkargatan

Läs mer